Kelch-like protein diablo

Overview
NameKelch-like protein diablo
Smed IDSMED30011469
Length (bp)1906
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Kelch-like protein diablo (SMED30011469) t-SNE clustered cells

Violin plots show distribution of expression levels for Kelch-like protein diablo (SMED30011469) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Kelch-like protein diablo (SMED30011469) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Kelch-like protein diablo (SMED30011469) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011469

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30011469h1SMcG0016720 dd_Smed_v4_5052_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Kelch-like protein diablo vs. Ensembl Human
Match: KLHL18 (kelch like family member 18 [Source:HGNC Symbol;Acc:HGNC:29120])

HSP 1 Score: 354.755 bits (909), Expect = 3.816e-114
Identity = 171/446 (38.34%), Postives = 266/446 (59.64%), Query Frame = 2
Query:  500 CPSFYR-RISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNM-EVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIVAF 1831
            C +F R R+  +  L +R FA+++ C  L  AA+ +I+ +F+ +    EF  L  ED+LE++ +DEL V +EE VFEA + W+ Y   +R  YL +L+  IR P   P++L + V  + +++   +CR+++D  KD+ ++P++  +L     RPR    S+ G I+ +GG    G+ +N+ EV+ PI   W     + T ++RVGVAV++  +Y IGG+DG  RLS V+ +N +T  W+ V +MN  RSA+G  +++ +IYVCGGYDG  +L S E Y P+ ++W V+  M   RSA GV     ++Y  GGH+GL I +SVE +N     W     MLN+RCRHG A L   ++  GGYDG  FLS  E++S    QW  I  M   RSR+SL+++ G ++A+GG+DG  NL + E ++  +  W  M+ +  H+GGVG   +  
Sbjct:  127 CCTFLRERLHPKNCLGVRQFAETMMCAVLYDAANSFIHQHFVEVSMSEEFLALPLEDVLELVSRDELNVKSEEQVFEAALAWVRYDREQRGPYLPELLSNIRLPLCRPQFLSDRVQQDDLVRCCHKCRDLVDEAKDYHLMPERRPHLPAFRTRPRCC-TSIAGLIYAVGGLNSAGDSLNVVEVFDPIANCWERCRPMTTARSRVGVAVVNGLLYAIGGYDGQLRLSTVEAYNPETDTWTRVGSMNSKRSAMGTVVLDGQIYVCGGYDGNSSLSSVETYSPETDKWTVVTSMSSNRSAAGVTVFEGRIYVSGGHDGLQIFSSVEHYNHHTATWHPAAGMLNKRCRHGAASLGSKMFVCGGYDGSGFLSIAEMYSSVADQWCLIVPMHTRRSRVSLVASCGRLYAVGGYDGQSNLSSVEMYDPETDCWTFMAPMACHEGGVGVGCIPL 571          
BLAST of Kelch-like protein diablo vs. Ensembl Human
Match: KLHL12 (kelch like family member 12 [Source:HGNC Symbol;Acc:HGNC:19360])

HSP 1 Score: 285.419 bits (729), Expect = 1.244e-87
Identity = 150/428 (35.05%), Postives = 236/428 (55.14%), Query Frame = 2
Query:  500 CPSFYRRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNM-EVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMK---WSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQW 1771
            C     ++     L +R FA++  C DL+ AA+++   +F  ++   EF  LS  ++ ++I  DE+QV +EE VFEAVI W+++A  ER+  L +L++ +R P ++P Y+ + + +   I+ SLQCR+++D  K F + P+    ++    R R   N +   + V+GG     + +++ E Y P  ++W  L  +   +  V    L   IYVIGG+DG  RLS V+  +    +   W SVA MN  R   GAT + D IYV GG+DG+    S E Y P +++W ++  M   R   G+V  S  +Y +GG++GL I NSVE ++P    W  +TPM  +R   GVA+LN  IY  GG+DG   LSSVE +++ T  WT + SM  PR  +      G ++AI G+DG+  L + EC++     W
Sbjct:  123 CEFLESQLDPSNCLGIRDFAETHNCVDLMQAAEVFSQKHFPEVVQHEEFILLSQGEVEKLIKCDEIQVDSEEPVFEAVINWVKHAKKEREESLPNLLQYVRMPLLTPRYITDVIDAEPFIRCSLQCRDLVDEAKKFHLRPELRSQMQGPRTRARLGANEV---LLVVGGFGSQQSPIDVVEKYDPKTQEWSFLPSITRKRRYVASVSLHDRIYVIGGYDGRSRLSSVECLDYTADEDGVWYSVAPMNVRRGLAGATTLGDMIYVSGGFDGSRRHTSMERYDPNIDQWSMLGDMQTAREGAGLVVASGVIYCLGGYDGLNILNSVEKYDPHTGHWTNVTPMATKRSGAGVALLNDHIYVVGGFDGTAHLSSVEAYNIRTDSWTTVTSMTTPRCYVGATVLRGRLYAIAGYDGNSLLSSIECYDPIIDSW 547          

HSP 2 Score: 140.198 bits (352), Expect = 1.389e-34
Identity = 71/207 (34.30%), Postives = 111/207 (53.62%), Query Frame = 2
Query:  932 NLEPHNFRPRYLQNSLYG-FIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQ 1549
            ++ P N R      +  G  I+V GG   +    +ME Y P + QW  L  + T +   G+ V    IY +GG+DG   L+ V+ ++  T  W++V  M   RS  G  ++ND IYV GG+DGT  L S E Y  + + W  +  M   R   G   L  +LYAI G++G ++ +S+EC++P++  W+++T M  +RC  GV VL +
Sbjct:  361 SVAPMNVRRGLAGATTLGDMIYVSGGFDGSRRHTSMERYDPNIDQWSMLGDMQTAREGAGLVVASGVIYCLGGYDGLNILNSVEKYDPHTGHWTNVTPMATKRSGAGVALLNDHIYVVGGFDGTAHLSSVEAYNIRTDSWTTVTSMTTPRCYVGATVLRGRLYAIAGYDGNSLLSSIECYDPIIDSWEVVTSMGTQRCDAGVCVLRE 567          

HSP 3 Score: 103.605 bits (257), Expect = 1.449e-22
Identity = 53/144 (36.81%), Postives = 83/144 (57.64%), Query Frame = 2
Query:  983 GFIFVIGGSFQNGNQVN-MEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQK 1411
            G I+ +GG +   N +N +E Y P    W ++  + T ++  GVA+L+ +IYV+GGFDG+  LS V+ +N +T  W++V +M   R  +GAT++  ++Y   GYDG   L S E Y P ++ W V+  M   R   GV  L +K
Sbjct:  426 GVIYCLGG-YDGLNILNSVEKYDPHTGHWTNVTPMATKRSGAGVALLNDHIYVVGGFDGTAHLSSVEAYNIRTDSWTTVTSMTTPRCYVGATVLRGRLYAIAGYDGNSLLSSIECYDPIIDSWEVVTSMGTQRCDAGVCVLREK 568          

HSP 4 Score: 62.7734 bits (151), Expect = 1.309e-9
Identity = 41/129 (31.78%), Postives = 65/129 (50.39%), Query Frame = 2
Query: 1457 VECFNPVMKCWDLITPMLNRRCRHGVAV-LNQSIYAAGGYDGVNFLSSVEVFSVTTSQ---WTYIASMKVPRSRMSLISTFGE-IFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIVA 1828
            VE ++P  + W  + P + R+ R+  +V L+  IY  GGYDG + LSSVE    T  +   W  +A M V R  ++  +T G+ I+  GGFDGS    + E ++    QW  +  +     G G  + +
Sbjct:  299 VEKYDPKTQEWSFL-PSITRKRRYVASVSLHDRIYVIGGYDGRSRLSSVECLDYTADEDGVWYSVAPMNVRRG-LAGATTLGDMIYVSGGFDGSRRHTSMERYDPNIDQWSMLGDMQTAREGAGLVVAS 425          
BLAST of Kelch-like protein diablo vs. Ensembl Human
Match: KLHL20 (kelch like family member 20 [Source:HGNC Symbol;Acc:HGNC:25056])

HSP 1 Score: 286.189 bits (731), Expect = 2.145e-87
Identity = 158/455 (34.73%), Postives = 245/455 (53.85%), Query Frame = 2
Query:  500 CPSFYRRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSS-VANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQW-----LEMSRLLNHDGGVGCAIVAFSDAHL 1846
            C    R++     L +R FA +  C +LL  AD +  +NF  ++   EF  L    L++II  DEL V +EE VF AV+ W++Y+I ER+  L  +++ +R P +SP++L+ TV S+ +I++  +CR+++D  K++L+LPQ+   ++    RPR         +F +GG        ++E Y P   +W  +  +   +  VGV+VLD  +Y +GG DGS  L+ V+ ++ KT +WSS VA  +  R+++G  ++   +Y  GG DG   L   E Y PK N+W  +  M   R    V  L   LYA+GG +G +  N+VE +NP    W  I PM  RR   G AV    IYA GG D    LSS E ++  T+QW+ + +M   RS + L    G++ A+GGFDG+  LKT E F+  +  W     +   RL    GGVG   +   ++H+
Sbjct:  158 CEFLKRQLDPSNCLGIRAFADTHSCRELLRIADKFTQHNFQEVMESEEFMLLPANQLIDIISSDELNVRSEEQVFNAVMAWVKYSIQERRPQLPQVLQHVRLPLLSPKFLVGTVGSDPLIKSDEECRDLVDEAKNYLLLPQERPLMQGPRTRPRK-PIRCGEVLFAVGGWCSGDAISSVERYDPQTNEWRMVASMSKRRCGVGVSVLDDLLYAVGGHDGSSYLNSVERYDPKTNQWSSDVAPTSTCRTSVGVAVLGGFLYAVGGQDGVSCLNIVERYDPKENKWTRVASMSTRRLGVAVAVLGGFLYAVGGSDGTSPLNTVERYNPQENRWHTIAPMGTRRKHLGCAVYQDMIYAVGGRDDTTELSSAERYNPRTNQWSPVVAMTSRRSGVGLAVVNGQLMAVGGFDGTTYLKTIEVFDPDANTWRLYGGMNYRRL---GGGVGVIKMTHCESHI 608          
BLAST of Kelch-like protein diablo vs. Ensembl Human
Match: KLHL3 (kelch like family member 3 [Source:HGNC Symbol;Acc:HGNC:6354])

HSP 1 Score: 265.774 bits (678), Expect = 7.681e-81
Identity = 147/427 (34.43%), Postives = 230/427 (53.86%), Query Frame = 2
Query:  500 CPSFYRRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNL-EPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAID--NSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQW 1771
            C     ++     L +R FA    C DLL  A+ Y   +F  ++   EF  LS + +  +I  D+L V +EE VFEAVI WI Y    R  ++A LM+ +R P +  +YL++TV    +I+N+  C++ L     + +LP   R L +    +PR    SL   + V+GG      + ++E Y     +W  + +L + + R GV  +  ++Y +GGF+GS R+  VDV++    +W+S+A+M   RS LGA ++ND +Y  GG+DG+  L S E Y  K N W  + PM   RS+ GV  +  KLYA+GG++G +    ++VE +NP    W  +  M  RR   GV VL+  +YA GG+DG     SVEV+   T+ W  +A M + R    + +  G ++ +GG DGS NL + E +N  + +W
Sbjct:   58 CDFLQSQLHPTNCLGIRAFADVHTCTDLLQQANAYAEQHFPEVMLGEEFLSLSLDQVCSLISSDKLTVSSEEKVFEAVISWINYEKETRLEHMAKLMEHVRLPLLPRDYLVQTVEEEALIKNNNTCKDFLIEAMKYHLLPLDQRLLIKNPRTKPR-TPVSLPKVMIVVGGQAPKAIR-SVECYDFEEDRWDQIAELPSRRCRAGVVFMAGHVYAVGGFNGSLRVRTVDVYDGVKDQWTSIASMQERRSTLGAAVLNDLLYAVGGFDGSTGLASVEAYSYKTNEWFFVAPMNTRRSSVGVGVVEGKLYAVGGYDGASRQCLSTVEQYNPATNEWIYVADMSTRRSGAGVGVLSGQLYATGGHDGPLVRKSVEVYDPGTNTWKQVADMNMCRRNAGVCAVNGLLYVVGGDDGSCNLASVEYYNPVTDKW 482          

HSP 2 Score: 123.25 bits (308), Expect = 3.726e-29
Identity = 67/196 (34.18%), Postives = 108/196 (55.10%), Query Frame = 2
Query:  977 LYGFIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRR--LSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLI-TPMLNRRCRHGVAVLNQSI 1555
            L   ++ +GG   +    ++E Y     +W  +  + T ++ VGV V++  +Y +GG+DG+ R  LS V+ +N  T +W  VA+M+  RS  G  +++ ++Y  GG+DG +  KS E Y P  N W+ +  M  CR   GV  ++  LY +GG +G     SVE +NPV   W L+ T M   R   GVAV+++S+
Sbjct:  310 LNDLLYAVGGFDGSTGLASVEAYSYKTNEWFFVAPMNTRRSSVGVGVVEGKLYAVGGYDGASRQCLSTVEQYNPATNEWIYVADMSTRRSGAGVGVLSGQLYATGGHDGPLVRKSVEVYDPGTNTWKQVADMNMCRRNAGVCAVNGLLYVVGGDDGSCNLASVEYYNPVTDKWTLLPTNMSTGRSYAGVAVIHKSL 505          

HSP 3 Score: 116.701 bits (291), Expect = 4.909e-27
Identity = 61/189 (32.28%), Postives = 102/189 (53.97%), Query Frame = 2
Query: 1268 KIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGN--LKTTECFNARSQQWLEMSRLLNHDGGVGCAIVA 1828
            K+ +  G     A++S E Y  + +RW  I  +   R   GVV ++  +YA+GG NG     +V+ ++ V   W  I  M  RR   G AVLN  +YA GG+DG   L+SVE +S  T++W ++A M   RS + +    G+++A+GG+DG+    L T E +N  + +W+ ++ +     G G  +++
Sbjct:  219 KVMIVVGGQAPKAIRSVECYDFEEDRWDQIAELPSRRCRAGVVFMAGHVYAVGGFNGSLRVRTVDVYDGVKDQWTSIASMQERRSTLGAAVLNDLLYAVGGFDGSTGLASVEAYSYKTNEWFFVAPMNTRRSSVGVGVVEGKLYAVGGYDGASRQCLSTVEQYNPATNEWIYVADMSTRRSGAGVGVLS 407          

HSP 4 Score: 93.2041 bits (230), Expect = 2.424e-19
Identity = 52/180 (28.89%), Postives = 93/180 (51.67%), Query Frame = 2
Query: 1313 SCEEYCPKLNRWRVIP---------PMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIV 1825
            +C+++  +  ++ ++P         P  + R+    V L + +  +GG    AI  SVEC++     WD I  + +RRCR GV  +   +YA GG++G   + +V+V+     QWT IASM+  RS +        ++A+GGFDGS  L + E ++ ++ +W  ++ +      VG  +V
Sbjct:  182 TCKDFLIEAMKYHLLPLDQRLLIKNPRTKPRTP---VSLPKVMIVVGGQAPKAI-RSVECYDFEEDRWDQIAELPSRRCRAGVVFMAGHVYAVGGFNGSLRVRTVDVYDGVKDQWTSIASMQERRSTLGAAVLNDLLYAVGGFDGSTGLASVEAYSYKTNEWFFVAPMNTRRSSVGVGVV 357          
BLAST of Kelch-like protein diablo vs. Ensembl Human
Match: KLHL17 (kelch like family member 17 [Source:HGNC Symbol;Acc:HGNC:24023])

HSP 1 Score: 269.626 bits (688), Expect = 7.954e-81
Identity = 140/442 (31.67%), Postives = 230/442 (52.04%), Query Frame = 2
Query:  500 CPSFYRRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIV 1825
            C     ++     L +R FA +  C DLL AA  Y+  +F+ +    EF  L  + +LE++  D L V +EE V+ AV+ W+++ +  R+ ++  LMK +R P +S ++LL  V +  ++++   C+++L     F +LP+Q   L     RPR  + +    +F +GG        + E Y     +W  +  + T + RVGVA + + +Y +GG+DG+  L+ V+ ++  T  W    +M   RS LG   ++  +Y  GGYDG   L S E Y P    W  +  M   R    V  L   LYA+GG++  +   +VE + P +  W  +  ML+RR   GVAVL  ++Y AGG DG + L+SVE +S     W  +A M + RS   L++  G ++A+GG DGS +L + E +N R+ +W+  S +      VG A++
Sbjct:  182 CKFLLSQLDPSNCLGIRGFADAHSCSDLLKAAHRYVLQHFVDVAKTEEFMLLPLKQVLELVSSDSLNVPSEEEVYRAVLSWVKHDVDARRQHVPRLMKCVRLPLLSRDFLLGHVDAESLVRHHPDCKDLLIEALKFHLLPEQRGVLGTSRTRPRRCEGA-GPVLFAVGGGSLFAIHGDCEAYDTRTDRWHVVASMSTRRARVGVAAVGNRLYAVGGYDGTSDLATVESYDPVTNTWQPEVSMGTRRSCLGVAALHGLLYSAGGYDGASCLNSAERYDPLTGTWTSVAAMSTRRRYVRVATLDGNLYAVGGYDSSSHLATVEKYEPQVNVWSPVASMLSRRSSAGVAVLEGALYVAGGNDGTSCLNSVERYSPKAGAWESVAPMNIRRSTHDLVAMDGWLYAVGGNDGSSSLNSIEKYNPRTNKWVAASCMFTRRSSVGVAVL 622          
BLAST of Kelch-like protein diablo vs. Ensembl Celegans
Match: kel-3 (KELch-repeat containing protein [Source:UniProtKB/TrEMBL;Acc:O18147])

HSP 1 Score: 313.538 bits (802), Expect = 1.761e-98
Identity = 166/458 (36.24%), Postives = 260/458 (56.77%), Query Frame = 2
Query:  461 LFKLVEM*F*ISYCPSFY-RRISSQTVLPLRTFAKSLFCHD-LLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSF-QNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIV 1825
             F+++E+   + +C +F   R+     L +R F K +   + +    D YI  +FM++    +F  LS ED +E++  D L V +EE V+ A + W+   +  R    A ++  +R P +SP YL   V SN II+  + CR+++D  KD+ +LP +   ++     PR  Q  + G I  IGG   Q+ ++ ++E+Y P  ++W  +D + T +TRVGVAV    +Y IGGF+G  RL  V+ F+  T+KW++++ +   RSAL A  + +++YVCGGYDG  +L S E Y    N W   PPM   RSA GV  + + +Y  GGH+G+ I  SVE  +   + W+ I  M+ +RCR G A     IY AGGYDG +FL SVEV+     +W+ ++ M + RSR+SL+ST   +FA+ GFDG  NL + E ++  +  W   + L  H+GGVG  ++
Sbjct:  132 FFQMLEV---VQHCGNFLLTRLHPSNALSIREFCKMMCVEEKITEMTDDYIQKHFMAVSKDEDFKRLSLEDAIELLRNDHLYVDSEEQVYVAAMEWLNCDVI-RHEQAAKILPCVRLPLLSPTYLSSIVASNPIIKKDIPCRDLIDEAKDYHLLPDRRSLIKSFKCTPRLCQ-IVPGLIVAIGGLMHQSQSKSSVEIYDPTSKKWSPIDGMVTLRTRVGVAVNQRQVYAIGGFNGQDRLDLVEKFDYDTLKWTTLSPLTRKRSALAAAFVTNRLYVCGGYDGLHSLSSIEIYDINRNVWEAGPPMENMRSAAGVTVIDKHIYICGGHDGMQIFASVERLDTENQQWERIPSMIQQRCRFGAATFKGKIYVAGGYDGTSFLKSVEVYDPVEKKWSPVSPMNMRRSRVSLVSTNEGLFAVAGFDGENNLCSMEQYDDVTDSWTIATALTCHEGGVGVGVI 584          
BLAST of Kelch-like protein diablo vs. Ensembl Celegans
Match: kel-3 (KELch-repeat containing protein [Source:UniProtKB/TrEMBL;Acc:O18147])

HSP 1 Score: 313.153 bits (801), Expect = 2.131e-98
Identity = 166/458 (36.24%), Postives = 260/458 (56.77%), Query Frame = 2
Query:  461 LFKLVEM*F*ISYCPSFY-RRISSQTVLPLRTFAKSLFCHD-LLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSF-QNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIV 1825
             F+++E+   + +C +F   R+     L +R F K +   + +    D YI  +FM++    +F  LS ED +E++  D L V +EE V+ A + W+   +  R    A ++  +R P +SP YL   V SN II+  + CR+++D  KD+ +LP +   ++     PR  Q  + G I  IGG   Q+ ++ ++E+Y P  ++W  +D + T +TRVGVAV    +Y IGGF+G  RL  V+ F+  T+KW++++ +   RSAL A  + +++YVCGGYDG  +L S E Y    N W   PPM   RSA GV  + + +Y  GGH+G+ I  SVE  +   + W+ I  M+ +RCR G A     IY AGGYDG +FL SVEV+     +W+ ++ M + RSR+SL+ST   +FA+ GFDG  NL + E ++  +  W   + L  H+GGVG  ++
Sbjct:  130 FFQMLEV---VQHCGNFLLTRLHPSNALSIREFCKMMCVEEKITEMTDDYIQKHFMAVSKDEDFKRLSLEDAIELLRNDHLYVDSEEQVYVAAMEWLNCDVI-RHEQAAKILPCVRLPLLSPTYLSSIVASNPIIKKDIPCRDLIDEAKDYHLLPDRRSLIKSFKCTPRLCQ-IVPGLIVAIGGLMHQSQSKSSVEIYDPTSKKWSPIDGMVTLRTRVGVAVNQRQVYAIGGFNGQDRLDLVEKFDYDTLKWTTLSPLTRKRSALAAAFVTNRLYVCGGYDGLHSLSSIEIYDINRNVWEAGPPMENMRSAAGVTVIDKHIYICGGHDGMQIFASVERLDTENQQWERIPSMIQQRCRFGAATFKGKIYVAGGYDGTSFLKSVEVYDPVEKKWSPVSPMNMRRSRVSLVSTNEGLFAVAGFDGENNLCSMEQYDDVTDSWTIATALTCHEGGVGVGVI 582          
BLAST of Kelch-like protein diablo vs. Ensembl Celegans
Match: kel-3 (KELch-repeat containing protein [Source:UniProtKB/TrEMBL;Acc:O18147])

HSP 1 Score: 313.153 bits (801), Expect = 2.131e-98
Identity = 166/458 (36.24%), Postives = 260/458 (56.77%), Query Frame = 2
Query:  461 LFKLVEM*F*ISYCPSFY-RRISSQTVLPLRTFAKSLFCHD-LLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSF-QNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIV 1825
             F+++E+   + +C +F   R+     L +R F K +   + +    D YI  +FM++    +F  LS ED +E++  D L V +EE V+ A + W+   +  R    A ++  +R P +SP YL   V SN II+  + CR+++D  KD+ +LP +   ++     PR  Q  + G I  IGG   Q+ ++ ++E+Y P  ++W  +D + T +TRVGVAV    +Y IGGF+G  RL  V+ F+  T+KW++++ +   RSAL A  + +++YVCGGYDG  +L S E Y    N W   PPM   RSA GV  + + +Y  GGH+G+ I  SVE  +   + W+ I  M+ +RCR G A     IY AGGYDG +FL SVEV+     +W+ ++ M + RSR+SL+ST   +FA+ GFDG  NL + E ++  +  W   + L  H+GGVG  ++
Sbjct:  130 FFQMLEV---VQHCGNFLLTRLHPSNALSIREFCKMMCVEEKITEMTDDYIQKHFMAVSKDEDFKRLSLEDAIELLRNDHLYVDSEEQVYVAAMEWLNCDVI-RHEQAAKILPCVRLPLLSPTYLSSIVASNPIIKKDIPCRDLIDEAKDYHLLPDRRSLIKSFKCTPRLCQ-IVPGLIVAIGGLMHQSQSKSSVEIYDPTSKKWSPIDGMVTLRTRVGVAVNQRQVYAIGGFNGQDRLDLVEKFDYDTLKWTTLSPLTRKRSALAAAFVTNRLYVCGGYDGLHSLSSIEIYDINRNVWEAGPPMENMRSAAGVTVIDKHIYICGGHDGMQIFASVERLDTENQQWERIPSMIQQRCRFGAATFKGKIYVAGGYDGTSFLKSVEVYDPVEKKWSPVSPMNMRRSRVSLVSTNEGLFAVAGFDGENNLCSMEQYDDVTDSWTIATALTCHEGGVGVGVI 582          
BLAST of Kelch-like protein diablo vs. Ensembl Celegans
Match: kel-20 (KELch-repeat containing protein [Source:UniProtKB/TrEMBL;Acc:O61795])

HSP 1 Score: 256.914 bits (655), Expect = 7.328e-77
Identity = 139/435 (31.95%), Postives = 234/435 (53.79%), Query Frame = 2
Query:  500 CPSFYRRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRY-LQNSLYGFIFVIGGSFQNGNQVNMEVYHPIL--RQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSS-VANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLL 1792
            C    +++     L +R FA +  C +LL +AD +   NF  +I   EF  L+ E L  II  D+L   +EE+VF AVI+W+ + IS+RK +L+ L+  +R P  +P++L+  V    ++++    R+++D  K++L+LP +  N++    +PR  LQ S    ++ +GG        ++E   P+     W  +  +G  +  VGVAVL++ +Y +GG DG   L+ ++ ++  T +WSS VA     R+++G    N  +Y  GG DG   L   E+Y P+ N W  +  M   R    V  ++  +YA+GG NG A  N+VE ++P +  W+ + PML +R   G AV +  IYA GG D    L++ E +SV   +W  + +M   RS + +     +++A+GGFDG   LK+ E F+  + +W   S++ 
Sbjct:  146 CDYLKKQLDPSNCLGIRAFADTHSCKELLSSADEFALKNFSRVIGKEEFQMLTVESLTTIIKSDKLNAASEELVFSAVIQWVRHDISKRKTHLSMLLSHVRLPLCTPKFLVSVVSEEILVKSDPASRDLVDEAKNYLLLPVERPNMQGPRTKPRKPLQGS--EVLYAVGGWCSGDAIASIERLDPMKGGTTWKCVAPMGKRRCGVGVAVLENLLYAVGGHDGQSYLNSIERYDPMTNQWSSDVAPTATCRTSVGVAAFNGSLYAVGGQDGESCLDVVEKYDPRKNEWAKVASMGTRRLGVSVSVVNGCIYAVGGSNGPAPLNTVERYDPRVGKWEEVRPMLTKRKHLGTAVYDGYIYAVGGRDTTTELNTAERYSVERDEWQPVVAMSNRRSGVGVAVVGEKLYAVGGFDGQTYLKSVEIFDKDTNRWKTHSQMF 578          
BLAST of Kelch-like protein diablo vs. Ensembl Celegans
Match: kel-1 (KELch-repeat containing protein; Kel-1 protein [Source:UniProtKB/TrEMBL;Acc:G5EGS4])

HSP 1 Score: 236.498 bits (602), Expect = 4.298e-69
Identity = 132/424 (31.13%), Postives = 214/424 (50.47%), Query Frame = 2
Query:  545 LRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVL-DATKDFLILPQQMRNLEPHNFRPRYLQNSLY---------GFIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAID--NSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECF---NARSQQW 1771
            +  FA++  CH L HAA +Y   +F+ II+  E   L  +   E+I  D + V +E+ V +AV+ W+ +    R+ +LA+LM  +R P +  +YL E   ++++I++   C NV+ +      I  Q + + EPH +  + L    +           I ++GG        N++++ P  + W S   L   + R GV++ + Y+Y  GGF+G++R+  VD ++ +T  W S   M+  RS  G T     +Y  GG+DGT  L S E + P    W  +P M   RS+ GV    + +YAIGG +G++    N+VE F+     W     MLN R   GV V ++ I A GG+ G     S E+  +   +W  +A+M +PR   +  +  G ++A+GG DGS NL T EC    +    QW
Sbjct:  176 MAEFARAHACHQLAHAAQLYTRQHFVEIIDNEELLSLDKDAFCELIQDDRITVPSEKPVMQAVLNWVAHEEPSRRPFLAELMSNVRLPLLGDDYLFEKWRNDEMIKSDAACLNVIIEGMHQLKITKQDISSTEPH-YPIQELNRKWFVAREPMPESQHIMIVGGQAPKA-ITNVDLFDPDSQLWSSCASLPQRRCRSGVSMCNGYVYTTGGFNGAQRVRSVDFYDPRTDTWRSANQMSARRSTHGITTCQQVLYAVGGFDGTTGLASAEYFDPHTGNWFPLPSMSTRRSSVGVAAFEEDIYAIGGFDGVSKQCLNTVEIFDRRAHKWRPGPAMLNVRSGAGVTVYDKKIIAVGGHKGAEIHRSAEI--LIGEEWIELANMAIPRRNTAATALNGLLYAVGGDDGSSNLSTIECIQLSDRSDAQW 595          

HSP 2 Score: 84.7297 bits (208), Expect = 6.147e-17
Identity = 53/175 (30.29%), Postives = 81/175 (46.29%), Query Frame = 2
Query: 1307 LKSCEEYCP--KLNR-WRVI-PPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCA 1819
            + S E + P  +LNR W V   PM E          SQ +  +GG    AI N V+ F+P  + W     +  RRCR GV++ N  +Y  GG++G   + SV+ +   T  W     M   RS   + +    ++A+GGFDG+  L + E F+  +  W  +  +      VG A
Sbjct:  304 ISSTEPHYPIQELNRKWFVAREPMPE----------SQHIMIVGGQAPKAITN-VDLFDPDSQLWSSCASLPQRRCRSGVSMCNGYVYTTGGFNGAQRVRSVDFYDPRTDTWRSANQMSARRSTHGITTCQQVLYAVGGFDGTTGLASAEYFDPHTGNWFPLPSMSTRRSSVGVA 467          
BLAST of Kelch-like protein diablo vs. Ensembl Fly
Match: KLHL18 (gene:FBgn0037978 transcript:FBtr0082557)

HSP 1 Score: 380.178 bits (975), Expect = 8.106e-125
Identity = 184/445 (41.35%), Postives = 274/445 (61.57%), Query Frame = 2
Query:  500 CPSFY-RRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLY-GFIFVIGGSFQNGNQVN-MEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIV 1825
            C SF   R     VL +RTFA S+ C  L+ AAD YI  NF  +    EF  L  E LLE++ +DEL V TEE++FEA ++W++YA  +R      ++  +R P +SP++L + V   ++I++S QCR++LD  KDF ++P++   L+  +FR R      + G I+ +GG    G  V+ +E+Y P+ ++W   +Q+   ++RVGVAVL+  +Y  GGF+G+ RLS V+V++ +  KWS    M C RSA+G   ++D IYVCGGYDG  +L + E Y PK N W+ +  M++ RSA GV  L+  +YA+GGH+GL+I +SVE ++     W  ++PMLNRRCR GVA LN  IY  GGY G +FL SVE +   T  W  +  M   RSR++L +  G+++AIGG+DG  NL T E ++  + +W  M  +  H GGVG  ++
Sbjct:   93 CASFLISRFHPHNVLGIRTFADSMICRQLIDAADKYIDQNFAKVSQSEEFLALDCEQLLELMRRDELNVRTEEVIFEACMKWVKYAEDKRSELFPQVLAAVRLPLLSPQFLADRVAREELIRSSHQCRDLLDEAKDFHLMPERRGLLQ--SFRTRQRSGEFFTGQIYAVGGLASTGESVSTVEIYDPLTKKWKMGEQMSMMRSRVGVAVLNGKLYAFGGFNGTERLSTVEVYDPRKNKWSQGCAMLCKRSAVGVAALDDCIYVCGGYDGVTSLNTVEVYYPKSNTWKTVAQMMKYRSAGGVTQLNGYVYALGGHDGLSIFDSVERYDQAEDVWVKMSPMLNRRCRLGVATLNGKIYVCGGYCGNSFLRSVECYDPQTDTWKLVTPMNCKRSRVALAANMGKLWAIGGYDGESNLSTVEVYDPETDKWTFMPPMCAHSGGVGAGVI 535          
BLAST of Kelch-like protein diablo vs. Ensembl Fly
Match: KLHL18 (gene:FBgn0037978 transcript:FBtr0082556)

HSP 1 Score: 379.793 bits (974), Expect = 3.650e-124
Identity = 184/445 (41.35%), Postives = 274/445 (61.57%), Query Frame = 2
Query:  500 CPSFY-RRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLY-GFIFVIGGSFQNGNQVN-MEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIV 1825
            C SF   R     VL +RTFA S+ C  L+ AAD YI  NF  +    EF  L  E LLE++ +DEL V TEE++FEA ++W++YA  +R      ++  +R P +SP++L + V   ++I++S QCR++LD  KDF ++P++   L+  +FR R      + G I+ +GG    G  V+ +E+Y P+ ++W   +Q+   ++RVGVAVL+  +Y  GGF+G+ RLS V+V++ +  KWS    M C RSA+G   ++D IYVCGGYDG  +L + E Y PK N W+ +  M++ RSA GV  L+  +YA+GGH+GL+I +SVE ++     W  ++PMLNRRCR GVA LN  IY  GGY G +FL SVE +   T  W  +  M   RSR++L +  G+++AIGG+DG  NL T E ++  + +W  M  +  H GGVG  ++
Sbjct:  130 CASFLISRFHPHNVLGIRTFADSMICRQLIDAADKYIDQNFAKVSQSEEFLALDCEQLLELMRRDELNVRTEEVIFEACMKWVKYAEDKRSELFPQVLAAVRLPLLSPQFLADRVAREELIRSSHQCRDLLDEAKDFHLMPERRGLLQ--SFRTRQRSGEFFTGQIYAVGGLASTGESVSTVEIYDPLTKKWKMGEQMSMMRSRVGVAVLNGKLYAFGGFNGTERLSTVEVYDPRKNKWSQGCAMLCKRSAVGVAALDDCIYVCGGYDGVTSLNTVEVYYPKSNTWKTVAQMMKYRSAGGVTQLNGYVYALGGHDGLSIFDSVERYDQAEDVWVKMSPMLNRRCRLGVATLNGKIYVCGGYCGNSFLRSVECYDPQTDTWKLVTPMNCKRSRVALAANMGKLWAIGGYDGESNLSTVEVYDPETDKWTFMPPMCAHSGGVGAGVI 572          
BLAST of Kelch-like protein diablo vs. Ensembl Fly
Match: KLHL18 (gene:FBgn0037978 transcript:FBtr0335434)

HSP 1 Score: 379.793 bits (974), Expect = 3.650e-124
Identity = 184/445 (41.35%), Postives = 274/445 (61.57%), Query Frame = 2
Query:  500 CPSFY-RRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLY-GFIFVIGGSFQNGNQVN-MEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIV 1825
            C SF   R     VL +RTFA S+ C  L+ AAD YI  NF  +    EF  L  E LLE++ +DEL V TEE++FEA ++W++YA  +R      ++  +R P +SP++L + V   ++I++S QCR++LD  KDF ++P++   L+  +FR R      + G I+ +GG    G  V+ +E+Y P+ ++W   +Q+   ++RVGVAVL+  +Y  GGF+G+ RLS V+V++ +  KWS    M C RSA+G   ++D IYVCGGYDG  +L + E Y PK N W+ +  M++ RSA GV  L+  +YA+GGH+GL+I +SVE ++     W  ++PMLNRRCR GVA LN  IY  GGY G +FL SVE +   T  W  +  M   RSR++L +  G+++AIGG+DG  NL T E ++  + +W  M  +  H GGVG  ++
Sbjct:  130 CASFLISRFHPHNVLGIRTFADSMICRQLIDAADKYIDQNFAKVSQSEEFLALDCEQLLELMRRDELNVRTEEVIFEACMKWVKYAEDKRSELFPQVLAAVRLPLLSPQFLADRVAREELIRSSHQCRDLLDEAKDFHLMPERRGLLQ--SFRTRQRSGEFFTGQIYAVGGLASTGESVSTVEIYDPLTKKWKMGEQMSMMRSRVGVAVLNGKLYAFGGFNGTERLSTVEVYDPRKNKWSQGCAMLCKRSAVGVAALDDCIYVCGGYDGVTSLNTVEVYYPKSNTWKTVAQMMKYRSAGGVTQLNGYVYALGGHDGLSIFDSVERYDQAEDVWVKMSPMLNRRCRLGVATLNGKIYVCGGYCGNSFLRSVECYDPQTDTWKLVTPMNCKRSRVALAANMGKLWAIGGYDGESNLSTVEVYDPETDKWTFMPPMCAHSGGVGAGVI 572          
BLAST of Kelch-like protein diablo vs. Ensembl Fly
Match: dbo (gene:FBgn0040230 transcript:FBtr0332133)

HSP 1 Score: 280.796 bits (717), Expect = 1.350e-85
Identity = 152/442 (34.39%), Postives = 240/442 (54.30%), Query Frame = 2
Query:  500 CPSFYRRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWS-SVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNH---DGGVG 1813
            C    R++     L +R FA +  C +LL  AD +  +NF  ++   EF  L    L++IIC DEL V +EE VF AV+ W++Y ++ER+ +LA +++ +R P +SP++L+ TV S+ ++++   CR+++D  K++L+LPQ+ R L                 +F +GG        ++E + P    W  +  +   +  VGVAVL+  +Y +GG DG   L+ ++ ++ +T +WS  VA     R+++G  +++  +Y  GG DG   L   E Y PK N+W  + PM   R    V  L   LYAIGG +G    N+VE ++P    W  ++PM  RR   G AV N  IYA GG D    LSS E ++  T+ W+ I +M   RS + L    G+++A+GGFDGS  LKT E ++  + QW  +   +N+    GGVG
Sbjct:  162 CEFLKRQLDPTNCLGIRAFADTHSCRELLRIADKFTQHNFQEVMESEEFLLLPVGQLVDIICSDELNVRSEEQVFNAVMSWLKYNVAERRQHLAQVLQHVRLPLLSPKFLVGTVGSDLLVRSDEACRDLVDEAKNYLLLPQE-RPLMQGPRTRPRKPTRRGEVLFAVGGWCSGDAIASVERFDPQTNDWKMVAPMSKRRCGVGVAVLNDLLYAVGGHDGQSYLNSIERYDPQTNQWSCDVAPTTSCRTSVGVAVLDGFLYAVGGQDGVQCLNHVERYDPKENKWSKVAPMTTRRLGVAVAVLGGFLYAIGGSDGQCPLNTVERYDPRHNKWVAVSPMSTRRKHLGCAVFNNYIYAVGGRDDCMELSSAERYNPLTNTWSPIVAMTSRRSGVGLAVVNGQLYAVGGFDGSAYLKTIEVYDPETNQW-RLCGCMNYRRLGGGVG 601          

HSP 2 Score: 119.013 bits (297), Expect = 1.074e-27
Identity = 68/191 (35.60%), Postives = 102/191 (53.40%), Query Frame = 2
Query:  977 LYGFIFVIGGSFQNGNQV--NMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVL 1543
            L GF++ +GG  Q+G Q   ++E Y P   +W  +  + T +  V VAVL  ++Y IGG DG   L+ V+ ++ +  KW +V+ M+  R  LG  + N+ IY  GG D  + L S E Y P  N W  I  M   RS  G+  ++ +LYA+GG +G A   ++E ++P    W L   M  RR   GV V+
Sbjct:  415 LDGFLYAVGG--QDGVQCLNHVERYDPKENKWSKVAPMTTRRLGVAVAVLGGFLYAIGGSDGQCPLNTVERYDPRHNKWVAVSPMSTRRKHLGCAVFNNYIYAVGGRDDCMELSSAERYNPLTNTWSPIVAMTSRRSGVGLAVVNGQLYAVGGFDGSAYLKTIEVYDPETNQWRLCGCMNYRRLGGGVGVM 603          
BLAST of Kelch-like protein diablo vs. Ensembl Fly
Match: dbo (gene:FBgn0040230 transcript:FBtr0075505)

HSP 1 Score: 280.796 bits (717), Expect = 1.544e-85
Identity = 152/442 (34.39%), Postives = 240/442 (54.30%), Query Frame = 2
Query:  500 CPSFYRRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWS-SVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNH---DGGVG 1813
            C    R++     L +R FA +  C +LL  AD +  +NF  ++   EF  L    L++IIC DEL V +EE VF AV+ W++Y ++ER+ +LA +++ +R P +SP++L+ TV S+ ++++   CR+++D  K++L+LPQ+ R L                 +F +GG        ++E + P    W  +  +   +  VGVAVL+  +Y +GG DG   L+ ++ ++ +T +WS  VA     R+++G  +++  +Y  GG DG   L   E Y PK N+W  + PM   R    V  L   LYAIGG +G    N+VE ++P    W  ++PM  RR   G AV N  IYA GG D    LSS E ++  T+ W+ I +M   RS + L    G+++A+GGFDGS  LKT E ++  + QW  +   +N+    GGVG
Sbjct:  162 CEFLKRQLDPTNCLGIRAFADTHSCRELLRIADKFTQHNFQEVMESEEFLLLPVGQLVDIICSDELNVRSEEQVFNAVMSWLKYNVAERRQHLAQVLQHVRLPLLSPKFLVGTVGSDLLVRSDEACRDLVDEAKNYLLLPQE-RPLMQGPRTRPRKPTRRGEVLFAVGGWCSGDAIASVERFDPQTNDWKMVAPMSKRRCGVGVAVLNDLLYAVGGHDGQSYLNSIERYDPQTNQWSCDVAPTTSCRTSVGVAVLDGFLYAVGGQDGVQCLNHVERYDPKENKWSKVAPMTTRRLGVAVAVLGGFLYAIGGSDGQCPLNTVERYDPRHNKWVAVSPMSTRRKHLGCAVFNNYIYAVGGRDDCMELSSAERYNPLTNTWSPIVAMTSRRSGVGLAVVNGQLYAVGGFDGSAYLKTIEVYDPETNQW-RLCGCMNYRRLGGGVG 601          

HSP 2 Score: 119.013 bits (297), Expect = 1.079e-27
Identity = 68/191 (35.60%), Postives = 102/191 (53.40%), Query Frame = 2
Query:  977 LYGFIFVIGGSFQNGNQV--NMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVL 1543
            L GF++ +GG  Q+G Q   ++E Y P   +W  +  + T +  V VAVL  ++Y IGG DG   L+ V+ ++ +  KW +V+ M+  R  LG  + N+ IY  GG D  + L S E Y P  N W  I  M   RS  G+  ++ +LYA+GG +G A   ++E ++P    W L   M  RR   GV V+
Sbjct:  415 LDGFLYAVGG--QDGVQCLNHVERYDPKENKWSKVAPMTTRRLGVAVAVLGGFLYAIGGSDGQCPLNTVERYDPRHNKWVAVSPMSTRRKHLGCAVFNNYIYAVGGRDDCMELSSAERYNPLTNTWSPIVAMTSRRSGVGLAVVNGQLYAVGGFDGSAYLKTIEVYDPETNQWRLCGCMNYRRLGGGVGVM 603          
BLAST of Kelch-like protein diablo vs. Ensembl Zebrafish
Match: klhl18 (kelch-like family member 18 [Source:ZFIN;Acc:ZDB-GENE-030131-5785])

HSP 1 Score: 361.303 bits (926), Expect = 7.127e-117
Identity = 168/448 (37.50%), Postives = 273/448 (60.94%), Query Frame = 2
Query:  500 CPSFYRRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNM-EVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIVAFSDA 1840
            C    +R+  +  L +R FA+++ C  L  AA+ +++ +F+ +    EF  L  E++LE++  DEL V  EE VFEAV+ W+ +   +R+  L +L+ +IR P   P++L + V  +++++   +CR+++D  KD+ ++P++  +L  +  R R    S+ G I+ +GG    G+ +N+ EV+ PI   W     + T ++RVGVAV++  +Y IGG+DG  RL  V+V+N  T  W+ VA+MN  RSA+G  +++  IYVCGGYDG  +L S E Y P+ +RW ++  M   RSA GV     ++Y  GGH+GL I N++E +N     W  + PM+N+RCRHG A L  ++Y AGGYDG  FLS  EV+S    QW+++ +M   RSR+SL++  G ++A+GG+DG  NL + E ++  + +W  M+ ++ H+GGVG   +    A
Sbjct:  130 CSFLQQRLHPKNCLGVRQFAETMMCTTLYDAANSFVHQHFVEVSVSEEFLALRPEEVLELVGCDELNVQAEEQVFEAVLAWVRHERDDRESRLPELLSKIRLPLCRPQFLADRVQQDELVRCCHKCRDLVDEAKDYHLMPERRPHLPAYKTRQRCC-TSIAGLIYAVGGLNSAGDSLNVVEVFDPIGNCWERCQPMSTARSRVGVAVVNGLLYAIGGYDGQSRLRTVEVYNPDTDTWTKVASMNTQRSAMGTVVVDGHIYVCGGYDGKSSLNSVECYAPETDRWTIVTEMSASRSAAGVTVFEGRIYVSGGHDGLQIFNTMEYYNQHTASWHPVAPMINKRCRHGAAALGSNLYVAGGYDGSAFLSGAEVYSSVADQWSHLVAMNTRRSRISLVANCGRLYAVGGYDGQSNLSSLEMYDQETNRWTFMAPMVCHEGGVGVGCIPLQPA 576          
BLAST of Kelch-like protein diablo vs. Ensembl Zebrafish
Match: klhl20 (kelch-like family member 20 [Source:ZFIN;Acc:ZDB-GENE-040426-1935])

HSP 1 Score: 283.108 bits (723), Expect = 1.189e-86
Identity = 155/455 (34.07%), Postives = 245/455 (53.85%), Query Frame = 2
Query:  500 CPSFYRRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSS-VANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQW-----LEMSRLLNHDGGVGCAIVAFSDAHL 1846
            C    R++     L +R FA +  C +LL  AD +  +NF  ++   EF  L    L++II  DEL V +EE VF AV+ W++Y+I ER+  L  +++ +R P +SP++L+ TV S+ +I++  +CR+++D  K++L+LPQ+   ++    RPR         +F +GG        ++E Y P   +W  +  +   +  VGV+VLD  +Y +GG DGS  L+ V+ ++ KT +WSS VA  +  R+++G  ++   +Y  GG DG   L   E Y PK N+W  +  M   R    V  L   LYA+GG +G +  N+VE +NP    W  + PM  RR   G AV    IY+ GG D    LSS E ++  T+QW+ + +M   RS + L    G++ A+GGFDG+  LKT E ++  +  W     +   RL    GGVG   +   ++H+
Sbjct:  140 CEFLKRQLDPSNCLGIRAFADTHSCRELLRIADKFTQHNFQEVMESEEFMLLPANQLIDIISSDELNVRSEEQVFNAVMAWVKYSIQERRPQLPQVLQHVRLPLLSPKFLVGTVGSDPLIKSDEECRDLVDEAKNYLLLPQERPLMQGPRTRPRK-PIRCGEVLFAVGGWCSGDAISSVERYDPQTNEWRMVASMSKRRCGVGVSVLDDLLYAVGGHDGSSYLNSVERYDPKTNQWSSDVAPTSTCRTSVGVAVLGGYLYAVGGQDGVSCLNIVERYDPKENKWTRVASMSTRRLGVAVAVLGGFLYAVGGSDGTSPLNTVERYNPQENRWHTVAPMGTRRKHLGCAVYQDMIYSVGGRDDTTELSSAERYNPRTNQWSPVVAMTSRRSGVGLAVVNGQLMAVGGFDGTTYLKTIEVYDPDANTWRLYGGMNYRRL---GGGVGVIKMTHCESHI 590          
BLAST of Kelch-like protein diablo vs. Ensembl Zebrafish
Match: klhl17 (kelch-like family member 17 [Source:ZFIN;Acc:ZDB-GENE-030131-8131])

HSP 1 Score: 267.7 bits (683), Expect = 7.706e-81
Identity = 139/444 (31.31%), Postives = 234/444 (52.70%), Query Frame = 2
Query:  500 CPSFYRRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIVAF 1831
            C     ++     L +R FA +  C DLL +A  Y+  +F+ +    EF  L  + +L++I  D L V +EE V+ AV+ W+++ I  R+ ++  LMK +R P ++ ++L+  V +  ++++  +C+++L     + ++P+Q   L     RPR  + +    +F +GG        + E Y     +W  +  + T + RVGVA + + +Y +GG+DG+  L+ V+ ++  T  W    +M   RS LG  +++  +Y  GGYDG   L S E Y P  + W  I  M   R    V  L   LYA+GG++  +   +VE ++P    W  I  ML+RR   GVAVL   +Y AGG DG + L+SVE ++  T+ W  +A M + RS   L++  G ++A+GG DGS +L + E +N RS +W+  S +      VG A++  
Sbjct:  131 CKFLLSQLDPSNCLGIRGFADTHSCSDLLKSAHKYVLQHFVEVSKTEEFMLLPLKQVLDLISSDNLNVPSEEEVYRAVLSWVKHDIDGRRQHVPRLMKCVRLPLLTRDFLMSNVDTELLVRHHSECKDLLIEALKYHLMPEQRGVLSNSRTRPRRCEGA-SPVLFAVGGGSLFAIHGDCEAYDTRTDRWHMVASMSTRRARVGVAAIGNKLYAVGGYDGTSDLATVESYDPVTNAWQPEVSMGTRRSCLGVAVLHGLLYAAGGYDGASCLNSAERYDPLTSTWTSIAAMSTRRRYVRVATLDGSLYAVGGYDSSSHLATVEKYDPQSNAWTAIANMLSRRSSAGVAVLEGMLYVAGGNDGTSCLNSVERYNPKTNTWEGVAPMNIRRSTHDLVAMDGWLYAVGGNDGSSSLNSIEKYNPRSNKWVAASCMFTRRSSVGVAVLEL 573          
BLAST of Kelch-like protein diablo vs. Ensembl Zebrafish
Match: klhl17 (kelch-like family member 17 [Source:ZFIN;Acc:ZDB-GENE-030131-8131])

HSP 1 Score: 267.7 bits (683), Expect = 1.465e-80
Identity = 139/444 (31.31%), Postives = 234/444 (52.70%), Query Frame = 2
Query:  500 CPSFYRRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIVAF 1831
            C     ++     L +R FA +  C DLL +A  Y+  +F+ +    EF  L  + +L++I  D L V +EE V+ AV+ W+++ I  R+ ++  LMK +R P ++ ++L+  V +  ++++  +C+++L     + ++P+Q   L     RPR  + +    +F +GG        + E Y     +W  +  + T + RVGVA + + +Y +GG+DG+  L+ V+ ++  T  W    +M   RS LG  +++  +Y  GGYDG   L S E Y P  + W  I  M   R    V  L   LYA+GG++  +   +VE ++P    W  I  ML+RR   GVAVL   +Y AGG DG + L+SVE ++  T+ W  +A M + RS   L++  G ++A+GG DGS +L + E +N RS +W+  S +      VG A++  
Sbjct:  158 CKFLLSQLDPSNCLGIRGFADTHSCSDLLKSAHKYVLQHFVEVSKTEEFMLLPLKQVLDLISSDNLNVPSEEEVYRAVLSWVKHDIDGRRQHVPRLMKCVRLPLLTRDFLMSNVDTELLVRHHSECKDLLIEALKYHLMPEQRGVLSNSRTRPRRCEGA-SPVLFAVGGGSLFAIHGDCEAYDTRTDRWHMVASMSTRRARVGVAAIGNKLYAVGGYDGTSDLATVESYDPVTNAWQPEVSMGTRRSCLGVAVLHGLLYAAGGYDGASCLNSAERYDPLTSTWTSIAAMSTRRRYVRVATLDGSLYAVGGYDSSSHLATVEKYDPQSNAWTAIANMLSRRSSAGVAVLEGMLYVAGGNDGTSCLNSVERYNPKTNTWEGVAPMNIRRSTHDLVAMDGWLYAVGGNDGSSSLNSIEKYNPRSNKWVAASCMFTRRSSVGVAVLEL 600          
BLAST of Kelch-like protein diablo vs. Ensembl Zebrafish
Match: klhl17 (kelch-like family member 17 [Source:ZFIN;Acc:ZDB-GENE-030131-8131])

HSP 1 Score: 267.7 bits (683), Expect = 1.465e-80
Identity = 139/444 (31.31%), Postives = 234/444 (52.70%), Query Frame = 2
Query:  500 CPSFYRRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIVAF 1831
            C     ++     L +R FA +  C DLL +A  Y+  +F+ +    EF  L  + +L++I  D L V +EE V+ AV+ W+++ I  R+ ++  LMK +R P ++ ++L+  V +  ++++  +C+++L     + ++P+Q   L     RPR  + +    +F +GG        + E Y     +W  +  + T + RVGVA + + +Y +GG+DG+  L+ V+ ++  T  W    +M   RS LG  +++  +Y  GGYDG   L S E Y P  + W  I  M   R    V  L   LYA+GG++  +   +VE ++P    W  I  ML+RR   GVAVL   +Y AGG DG + L+SVE ++  T+ W  +A M + RS   L++  G ++A+GG DGS +L + E +N RS +W+  S +      VG A++  
Sbjct:  158 CKFLLSQLDPSNCLGIRGFADTHSCSDLLKSAHKYVLQHFVEVSKTEEFMLLPLKQVLDLISSDNLNVPSEEEVYRAVLSWVKHDIDGRRQHVPRLMKCVRLPLLTRDFLMSNVDTELLVRHHSECKDLLIEALKYHLMPEQRGVLSNSRTRPRRCEGA-SPVLFAVGGGSLFAIHGDCEAYDTRTDRWHMVASMSTRRARVGVAAIGNKLYAVGGYDGTSDLATVESYDPVTNAWQPEVSMGTRRSCLGVAVLHGLLYAAGGYDGASCLNSAERYDPLTSTWTSIAAMSTRRRYVRVATLDGSLYAVGGYDSSSHLATVEKYDPQSNAWTAIANMLSRRSSAGVAVLEGMLYVAGGNDGTSCLNSVERYNPKTNTWEGVAPMNIRRSTHDLVAMDGWLYAVGGNDGSSSLNSIEKYNPRSNKWVAASCMFTRRSSVGVAVLEL 600          
BLAST of Kelch-like protein diablo vs. Ensembl Xenopus
Match: klhl18 (kelch like family member 18 [Source:NCBI gene;Acc:100170176])

HSP 1 Score: 359.377 bits (921), Expect = 5.846e-116
Identity = 169/450 (37.56%), Postives = 272/450 (60.44%), Query Frame = 2
Query:  500 CPSFYRRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGG-----SFQNGNQVNM-EVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIVAF 1831
            C     R+  +  L +R FA+++ C  L  A++ +I+ +F+ +    EF  L+FE++LE++ +DEL V  EE VFEA + W+ Y   +R+ +L +L+ +IR P   P++L + V  + +++   +CR+++D  KD+ ++P++  +L     RPR    S+ G I+ +GG     +F  G+ +N+ EV+ PI  +W     + T ++RVGVAV++  +Y IGG+DG  RLS V+V+N  T  W+ V +MN  RSA+G  +++ +IYVCGGYDG  +L S E Y P+ ++W V+ PM   RSA GV     ++Y  GGH+GL I N+VE +N     W  +  M+N+RCRHG A L   +Y  GGY+G  FLS  EV++    QW  I  M   RSR+SL++  G ++A+GG+DG  NL + E ++  + +W  M+ ++ H+GGVG   +  
Sbjct:  127 CTFLKERLHPKNCLGVRQFAETMMCSVLHDASNRFIHEHFVEVSMSEEFLALAFEEVLELVSRDELNVKAEEQVFEAALAWVRYDREKREVFLPELLSKIRLPLCRPQFLTDRVQQDDLVRCCHKCRDLVDEAKDYHLMPERRPHLLAFKTRPRCC-TSIAGLIYAVGGLNSAANFYAGDSLNVVEVFDPIANRWEKCQPMTTARSRVGVAVVNGLLYAIGGYDGQSRLSTVEVYNPDTDTWTKVGSMNSKRSAMGTVVLDGQIYVCGGYDGNCSLNSVEAYSPETDKWTVVTPMSSNRSAAGVTVFEGRIYVSGGHDGLQIFNTVEYYNHHTATWHPVASMMNKRCRHGAASLGSKMYICGGYEGSAFLSVAEVYNSMADQWYLITPMNTRRSRVSLVANCGRLYAVGGYDGQSNLNSVEMYDPETNRWTFMAPMVCHEGGVGVGCIPL 575          
BLAST of Kelch-like protein diablo vs. Ensembl Xenopus
Match: klhl18 (kelch like family member 18 [Source:NCBI gene;Acc:100170176])

HSP 1 Score: 359.762 bits (922), Expect = 6.006e-116
Identity = 169/450 (37.56%), Postives = 272/450 (60.44%), Query Frame = 2
Query:  500 CPSFYRRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGG-----SFQNGNQVNM-EVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIVAF 1831
            C     R+  +  L +R FA+++ C  L  A++ +I+ +F+ +    EF  L+FE++LE++ +DEL V  EE VFEA + W+ Y   +R+ +L +L+ +IR P   P++L + V  + +++   +CR+++D  KD+ ++P++  +L     RPR    S+ G I+ +GG     +F  G+ +N+ EV+ PI  +W     + T ++RVGVAV++  +Y IGG+DG  RLS V+V+N  T  W+ V +MN  RSA+G  +++ +IYVCGGYDG  +L S E Y P+ ++W V+ PM   RSA GV     ++Y  GGH+GL I N+VE +N     W  +  M+N+RCRHG A L   +Y  GGY+G  FLS  EV++    QW  I  M   RSR+SL++  G ++A+GG+DG  NL + E ++  + +W  M+ ++ H+GGVG   +  
Sbjct:  132 CTFLKERLHPKNCLGVRQFAETMMCSVLHDASNRFIHEHFVEVSMSEEFLALAFEEVLELVSRDELNVKAEEQVFEAALAWVRYDREKREVFLPELLSKIRLPLCRPQFLTDRVQQDDLVRCCHKCRDLVDEAKDYHLMPERRPHLLAFKTRPRCC-TSIAGLIYAVGGLNSAANFYAGDSLNVVEVFDPIANRWEKCQPMTTARSRVGVAVVNGLLYAIGGYDGQSRLSTVEVYNPDTDTWTKVGSMNSKRSAMGTVVLDGQIYVCGGYDGNCSLNSVEAYSPETDKWTVVTPMSSNRSAAGVTVFEGRIYVSGGHDGLQIFNTVEYYNHHTATWHPVASMMNKRCRHGAASLGSKMYICGGYEGSAFLSVAEVYNSMADQWYLITPMNTRRSRVSLVANCGRLYAVGGYDGQSNLNSVEMYDPETNRWTFMAPMVCHEGGVGVGCIPL 580          
BLAST of Kelch-like protein diablo vs. Ensembl Xenopus
Match: usb1 (U6 snRNA biogenesis phosphodiesterase 1 [Source:Xenbase;Acc:XB-GENE-948670])

HSP 1 Score: 286.574 bits (732), Expect = 1.063e-87
Identity = 158/455 (34.73%), Postives = 245/455 (53.85%), Query Frame = 2
Query:  500 CPSFYRRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSS-VANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQW-----LEMSRLLNHDGGVGCAIVAFSDAHL 1846
            C    R++     L +R FA +  C +LL  AD +  +NF  ++   EF  L    L++II  DEL V +EE VF AV+ W++Y+I ER+  L  +++ +R P +SP++L+ TV S+ +I++  +CR+++D  K++L+LPQ+   ++    RPR         +F +GG        ++E Y P   +W  +  +   +  VGV+VLD  +Y +GG DGS  L+ V+ ++ KT +WSS VA  +  R+++G  ++   +Y  GG DG   L   E Y PK N+W  +  M   R    V  L   LYA+GG +G +  N+VE +NP    W  I PM  RR   G AV    IYA GG D    LSS E ++  T+QW+ + +M   RS + L    G++ A+GGFDG+  LKT E F+  +  W     +   RL    GGVG   +   ++H+
Sbjct:  151 CEFLKRQLDPSNCLGIRAFADTHSCRELLRIADKFTQHNFQEVMESEEFMLLPANQLIDIISSDELNVRSEEQVFNAVMAWVKYSIQERRPQLPQVLQHVRLPLLSPKFLVGTVGSDPLIKSDEECRDLVDEAKNYLLLPQERPLMQGPRTRPRK-PIRCGEVLFAVGGWCSGDAISSVERYDPQTNEWRMVASMSKRRCGVGVSVLDDLLYAVGGHDGSSYLNSVERYDPKTNQWSSDVAPTSTCRTSVGVAVLGGYLYAVGGQDGVSCLNIVERYDPKENKWTRVASMSTRRLGVAVAVLGGFLYAVGGSDGTSPLNTVERYNPQENRWHTIAPMGTRRKHLGCAVYQDMIYAVGGRDDTTELSSAERYNPRTNQWSPVVAMTSRRSGVGLAVVNGQLMAVGGFDGTTYLKTIEVFDPDANTWRLYGGMNYRRL---GGGVGVIKMTHCESHI 601          
BLAST of Kelch-like protein diablo vs. Ensembl Xenopus
Match: usb1 (U6 snRNA biogenesis phosphodiesterase 1 [Source:Xenbase;Acc:XB-GENE-948670])

HSP 1 Score: 286.574 bits (732), Expect = 1.259e-87
Identity = 158/455 (34.73%), Postives = 245/455 (53.85%), Query Frame = 2
Query:  500 CPSFYRRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSS-VANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQW-----LEMSRLLNHDGGVGCAIVAFSDAHL 1846
            C    R++     L +R FA +  C +LL  AD +  +NF  ++   EF  L    L++II  DEL V +EE VF AV+ W++Y+I ER+  L  +++ +R P +SP++L+ TV S+ +I++  +CR+++D  K++L+LPQ+   ++    RPR         +F +GG        ++E Y P   +W  +  +   +  VGV+VLD  +Y +GG DGS  L+ V+ ++ KT +WSS VA  +  R+++G  ++   +Y  GG DG   L   E Y PK N+W  +  M   R    V  L   LYA+GG +G +  N+VE +NP    W  I PM  RR   G AV    IYA GG D    LSS E ++  T+QW+ + +M   RS + L    G++ A+GGFDG+  LKT E F+  +  W     +   RL    GGVG   +   ++H+
Sbjct:  157 CEFLKRQLDPSNCLGIRAFADTHSCRELLRIADKFTQHNFQEVMESEEFMLLPANQLIDIISSDELNVRSEEQVFNAVMAWVKYSIQERRPQLPQVLQHVRLPLLSPKFLVGTVGSDPLIKSDEECRDLVDEAKNYLLLPQERPLMQGPRTRPRK-PIRCGEVLFAVGGWCSGDAISSVERYDPQTNEWRMVASMSKRRCGVGVSVLDDLLYAVGGHDGSSYLNSVERYDPKTNQWSSDVAPTSTCRTSVGVAVLGGYLYAVGGQDGVSCLNIVERYDPKENKWTRVASMSTRRLGVAVAVLGGFLYAVGGSDGTSPLNTVERYNPQENRWHTIAPMGTRRKHLGCAVYQDMIYAVGGRDDTTELSSAERYNPRTNQWSPVVAMTSRRSGVGLAVVNGQLMAVGGFDGTTYLKTIEVFDPDANTWRLYGGMNYRRL---GGGVGVIKMTHCESHI 607          
BLAST of Kelch-like protein diablo vs. Ensembl Xenopus
Match: usb1 (U6 snRNA biogenesis phosphodiesterase 1 [Source:Xenbase;Acc:XB-GENE-948670])

HSP 1 Score: 286.189 bits (731), Expect = 1.428e-87
Identity = 158/455 (34.73%), Postives = 245/455 (53.85%), Query Frame = 2
Query:  500 CPSFYRRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSS-VANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQW-----LEMSRLLNHDGGVGCAIVAFSDAHL 1846
            C    R++     L +R FA +  C +LL  AD +  +NF  ++   EF  L    L++II  DEL V +EE VF AV+ W++Y+I ER+  L  +++ +R P +SP++L+ TV S+ +I++  +CR+++D  K++L+LPQ+   ++    RPR         +F +GG        ++E Y P   +W  +  +   +  VGV+VLD  +Y +GG DGS  L+ V+ ++ KT +WSS VA  +  R+++G  ++   +Y  GG DG   L   E Y PK N+W  +  M   R    V  L   LYA+GG +G +  N+VE +NP    W  I PM  RR   G AV    IYA GG D    LSS E ++  T+QW+ + +M   RS + L    G++ A+GGFDG+  LKT E F+  +  W     +   RL    GGVG   +   ++H+
Sbjct:  154 CEFLKRQLDPSNCLGIRAFADTHSCRELLRIADKFTQHNFQEVMESEEFMLLPANQLIDIISSDELNVRSEEQVFNAVMAWVKYSIQERRPQLPQVLQHVRLPLLSPKFLVGTVGSDPLIKSDEECRDLVDEAKNYLLLPQERPLMQGPRTRPRK-PIRCGEVLFAVGGWCSGDAISSVERYDPQTNEWRMVASMSKRRCGVGVSVLDDLLYAVGGHDGSSYLNSVERYDPKTNQWSSDVAPTSTCRTSVGVAVLGGYLYAVGGQDGVSCLNIVERYDPKENKWTRVASMSTRRLGVAVAVLGGFLYAVGGSDGTSPLNTVERYNPQENRWHTIAPMGTRRKHLGCAVYQDMIYAVGGRDDTTELSSAERYNPRTNQWSPVVAMTSRRSGVGLAVVNGQLMAVGGFDGTTYLKTIEVFDPDANTWRLYGGMNYRRL---GGGVGVIKMTHCESHI 604          
BLAST of Kelch-like protein diablo vs. Ensembl Mouse
Match: Klhl18 (kelch-like 18 [Source:MGI Symbol;Acc:MGI:2143315])

HSP 1 Score: 357.836 bits (917), Expect = 2.499e-116
Identity = 171/446 (38.34%), Postives = 268/446 (60.09%), Query Frame = 2
Query:  500 CPSFYR-RISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNM-EVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIVAF 1831
            C +F R R+  +  L +R FA+++ C  L  AA+ +I+ +F+ +    EF  L  ED+LE++ +DEL V +EE VFEA + W+ Y   +R   L +L+  IR P   P++L + V  + +++   +CR+++D  KD+ ++P++  +L     RPR    S+ G I+ +GG    G+ +N+ EV+ PI  +W     + T ++RVGVAV++  +Y IGG+DG  RLS V+ +N +T  W+ V +MN  RSA+G  +++ +IYVCGGYDG  +L S E Y P+ ++W V+ PM   RSA GV     ++Y  GGH+GL I +SVE +N     W     MLN+RCRHG A L   ++  GGYDG  FLS  E++S    QW  I  M   RSR+SL+++ G ++A+GG+DG  NL + E ++  + +W  M+ +  H+GGVG   +  
Sbjct:   62 CCTFLRERLHPKNCLGVRQFAETMMCAVLYDAANSFIHQHFVEVSLSEEFLALPLEDVLELVSRDELNVKSEEQVFEAALAWVRYDREQRGPCLPELLSNIRLPLCRPQFLSDRVQQDDLVRCCHKCRDLVDEAKDYHLMPERRPHLPAFRTRPRCC-TSIAGLIYAVGGLNSAGDSLNVVEVFDPIANRWEKCHPMTTARSRVGVAVVNGLLYAIGGYDGQLRLSTVEAYNPETDTWTRVGSMNSKRSAMGTVVLDGQIYVCGGYDGNSSLNSVETYSPETDKWTVVTPMSSNRSAAGVTVFEGRIYVSGGHDGLQIFSSVEHYNHHTATWHPAASMLNKRCRHGAASLGSKMFVCGGYDGSGFLSIAEMYSSVADQWCLIVPMHTRRSRVSLVASCGRLYAVGGYDGQSNLSSVEMYDPETDRWTFMAPMACHEGGVGVGCIPL 506          
BLAST of Kelch-like protein diablo vs. Ensembl Mouse
Match: Klhl18 (kelch-like 18 [Source:MGI Symbol;Acc:MGI:2143315])

HSP 1 Score: 357.836 bits (917), Expect = 1.842e-115
Identity = 171/446 (38.34%), Postives = 268/446 (60.09%), Query Frame = 2
Query:  500 CPSFYR-RISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNM-EVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIVAF 1831
            C +F R R+  +  L +R FA+++ C  L  AA+ +I+ +F+ +    EF  L  ED+LE++ +DEL V +EE VFEA + W+ Y   +R   L +L+  IR P   P++L + V  + +++   +CR+++D  KD+ ++P++  +L     RPR    S+ G I+ +GG    G+ +N+ EV+ PI  +W     + T ++RVGVAV++  +Y IGG+DG  RLS V+ +N +T  W+ V +MN  RSA+G  +++ +IYVCGGYDG  +L S E Y P+ ++W V+ PM   RSA GV     ++Y  GGH+GL I +SVE +N     W     MLN+RCRHG A L   ++  GGYDG  FLS  E++S    QW  I  M   RSR+SL+++ G ++A+GG+DG  NL + E ++  + +W  M+ +  H+GGVG   +  
Sbjct:  127 CCTFLRERLHPKNCLGVRQFAETMMCAVLYDAANSFIHQHFVEVSLSEEFLALPLEDVLELVSRDELNVKSEEQVFEAALAWVRYDREQRGPCLPELLSNIRLPLCRPQFLSDRVQQDDLVRCCHKCRDLVDEAKDYHLMPERRPHLPAFRTRPRCC-TSIAGLIYAVGGLNSAGDSLNVVEVFDPIANRWEKCHPMTTARSRVGVAVVNGLLYAIGGYDGQLRLSTVEAYNPETDTWTRVGSMNSKRSAMGTVVLDGQIYVCGGYDGNSSLNSVETYSPETDKWTVVTPMSSNRSAAGVTVFEGRIYVSGGHDGLQIFSSVEHYNHHTATWHPAASMLNKRCRHGAASLGSKMFVCGGYDGSGFLSIAEMYSSVADQWCLIVPMHTRRSRVSLVASCGRLYAVGGYDGQSNLSSVEMYDPETDRWTFMAPMACHEGGVGVGCIPL 571          
BLAST of Kelch-like protein diablo vs. Ensembl Mouse
Match: Klhl18 (kelch-like 18 [Source:MGI Symbol;Acc:MGI:2143315])

HSP 1 Score: 355.91 bits (912), Expect = 1.119e-114
Identity = 172/451 (38.14%), Postives = 270/451 (59.87%), Query Frame = 2
Query:  500 CPSFYR-RISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGG-----SFQNGNQVNM-EVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIVAF 1831
            C +F R R+  +  L +R FA+++ C  L  AA+ +I+ +F+ +    EF  L  ED+LE++ +DEL V +EE VFEA + W+ Y   +R   L +L+  IR P   P++L + V  + +++   +CR+++D  KD+ ++P++  +L     RPR    S+ G I+ +GG     +F  G+ +N+ EV+ PI  +W     + T ++RVGVAV++  +Y IGG+DG  RLS V+ +N +T  W+ V +MN  RSA+G  +++ +IYVCGGYDG  +L S E Y P+ ++W V+ PM   RSA GV     ++Y  GGH+GL I +SVE +N     W     MLN+RCRHG A L   ++  GGYDG  FLS  E++S    QW  I  M   RSR+SL+++ G ++A+GG+DG  NL + E ++  + +W  M+ +  H+GGVG   +  
Sbjct:  127 CCTFLRERLHPKNCLGVRQFAETMMCAVLYDAANSFIHQHFVEVSLSEEFLALPLEDVLELVSRDELNVKSEEQVFEAALAWVRYDREQRGPCLPELLSNIRLPLCRPQFLSDRVQQDDLVRCCHKCRDLVDEAKDYHLMPERRPHLPAFRTRPRCC-TSIAGLIYAVGGLNSAANFYAGDSLNVVEVFDPIANRWEKCHPMTTARSRVGVAVVNGLLYAIGGYDGQLRLSTVEAYNPETDTWTRVGSMNSKRSAMGTVVLDGQIYVCGGYDGNSSLNSVETYSPETDKWTVVTPMSSNRSAAGVTVFEGRIYVSGGHDGLQIFSSVEHYNHHTATWHPAASMLNKRCRHGAASLGSKMFVCGGYDGSGFLSIAEMYSSVADQWCLIVPMHTRRSRVSLVASCGRLYAVGGYDGQSNLSSVEMYDPETDRWTFMAPMACHEGGVGVGCIPL 576          
BLAST of Kelch-like protein diablo vs. Ensembl Mouse
Match: Klhl12 (kelch-like 12 [Source:MGI Symbol;Acc:MGI:2385619])

HSP 1 Score: 287.345 bits (734), Expect = 1.546e-88
Identity = 151/428 (35.28%), Postives = 236/428 (55.14%), Query Frame = 2
Query:  500 CPSFYRRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNM-EVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMK---WSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQW 1771
            C     ++     L +R FA++  C DL+ AA+++   +F  ++   EF  LS  ++ ++I  DE+QV +EE VFEAVI W+++A  ER+  L DL++ +R P ++P Y+ + + +   I+ SLQCR+++D  K F + P+    ++    R R   N +   + V+GG     + +++ E Y P  ++W  L  +   +  V    L   IYVIGG+DG  RLS V+  +    +   W SVA MN  R   GAT + D IYV GG+DG+    S E Y P +++W ++  M   R   G+V  S  +Y +GG++GL I NSVE ++P    W  +TPM  +R   GVA+LN  IY  GG+DG   LSSVE +++ T  WT + SM  PR  +      G ++AI G+DG+  L + EC++     W
Sbjct:  123 CEFLESQLDPSNCLGIRDFAETHNCVDLMQAAEVFSQKHFPEVVQHEEFILLSQGEVEKLIKCDEIQVDSEEPVFEAVINWVKHAKKEREESLPDLLQYVRMPLLTPRYITDVIDAEPFIRCSLQCRDLVDEAKKFHLRPELRSQMQGPRTRARLGANEV---LLVVGGFGSQQSPIDVVEKYDPKTQEWSFLPSITRKRRYVASVSLHDRIYVIGGYDGRSRLSSVECLDYTADEDGVWYSVAPMNVRRGLAGATTLGDMIYVSGGFDGSRRHTSMERYDPNIDQWSMLGDMQTAREGAGLVVASGIIYCLGGYDGLNILNSVEKYDPHTGHWTNVTPMATKRSGAGVALLNDHIYVVGGFDGTAHLSSVEAYNIRTDSWTTVTSMTTPRCYVGATVLRGRLYAIAGYDGNSLLSSIECYDPIIDSW 547          

HSP 2 Score: 138.272 bits (347), Expect = 3.848e-34
Identity = 70/207 (33.82%), Postives = 110/207 (53.14%), Query Frame = 2
Query:  932 NLEPHNFRPRYLQNSLYG-FIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQ 1549
            ++ P N R      +  G  I+V GG   +    +ME Y P + QW  L  + T +   G+ V    IY +GG+DG   L+ V+ ++  T  W++V  M   RS  G  ++ND IYV GG+DGT  L S E Y  + + W  +  M   R   G   L  +LYAI G++G ++ +S+EC++P++  W+++  M  +RC  GV VL +
Sbjct:  361 SVAPMNVRRGLAGATTLGDMIYVSGGFDGSRRHTSMERYDPNIDQWSMLGDMQTAREGAGLVVASGIIYCLGGYDGLNILNSVEKYDPHTGHWTNVTPMATKRSGAGVALLNDHIYVVGGFDGTAHLSSVEAYNIRTDSWTTVTSMTTPRCYVGATVLRGRLYAIAGYDGNSLLSSIECYDPIIDSWEVVASMGTQRCDAGVCVLRE 567          

HSP 3 Score: 103.99 bits (258), Expect = 7.027e-23
Identity = 53/144 (36.81%), Postives = 83/144 (57.64%), Query Frame = 2
Query:  983 GFIFVIGGSFQNGNQVN-MEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQK 1411
            G I+ +GG +   N +N +E Y P    W ++  + T ++  GVA+L+ +IYV+GGFDG+  LS V+ +N +T  W++V +M   R  +GAT++  ++Y   GYDG   L S E Y P ++ W V+  M   R   GV  L +K
Sbjct:  426 GIIYCLGG-YDGLNILNSVEKYDPHTGHWTNVTPMATKRSGAGVALLNDHIYVVGGFDGTAHLSSVEAYNIRTDSWTTVTSMTTPRCYVGATVLRGRLYAIAGYDGNSLLSSIECYDPIIDSWEVVASMGTQRCDAGVCVLREK 568          

HSP 4 Score: 62.7734 bits (151), Expect = 8.990e-10
Identity = 41/129 (31.78%), Postives = 65/129 (50.39%), Query Frame = 2
Query: 1457 VECFNPVMKCWDLITPMLNRRCRHGVAV-LNQSIYAAGGYDGVNFLSSVEVFSVTTSQ---WTYIASMKVPRSRMSLISTFGE-IFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIVA 1828
            VE ++P  + W  + P + R+ R+  +V L+  IY  GGYDG + LSSVE    T  +   W  +A M V R  ++  +T G+ I+  GGFDGS    + E ++    QW  +  +     G G  + +
Sbjct:  299 VEKYDPKTQEWSFL-PSITRKRRYVASVSLHDRIYVIGGYDGRSRLSSVECLDYTADEDGVWYSVAPMNVRRG-LAGATTLGDMIYVSGGFDGSRRHTSMERYDPNIDQWSMLGDMQTAREGAGLVVAS 425          
BLAST of Kelch-like protein diablo vs. Ensembl Mouse
Match: Klhl12 (kelch-like 12 [Source:MGI Symbol;Acc:MGI:2385619])

HSP 1 Score: 287.345 bits (734), Expect = 1.546e-88
Identity = 151/428 (35.28%), Postives = 236/428 (55.14%), Query Frame = 2
Query:  500 CPSFYRRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNM-EVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMK---WSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQW 1771
            C     ++     L +R FA++  C DL+ AA+++   +F  ++   EF  LS  ++ ++I  DE+QV +EE VFEAVI W+++A  ER+  L DL++ +R P ++P Y+ + + +   I+ SLQCR+++D  K F + P+    ++    R R   N +   + V+GG     + +++ E Y P  ++W  L  +   +  V    L   IYVIGG+DG  RLS V+  +    +   W SVA MN  R   GAT + D IYV GG+DG+    S E Y P +++W ++  M   R   G+V  S  +Y +GG++GL I NSVE ++P    W  +TPM  +R   GVA+LN  IY  GG+DG   LSSVE +++ T  WT + SM  PR  +      G ++AI G+DG+  L + EC++     W
Sbjct:  123 CEFLESQLDPSNCLGIRDFAETHNCVDLMQAAEVFSQKHFPEVVQHEEFILLSQGEVEKLIKCDEIQVDSEEPVFEAVINWVKHAKKEREESLPDLLQYVRMPLLTPRYITDVIDAEPFIRCSLQCRDLVDEAKKFHLRPELRSQMQGPRTRARLGANEV---LLVVGGFGSQQSPIDVVEKYDPKTQEWSFLPSITRKRRYVASVSLHDRIYVIGGYDGRSRLSSVECLDYTADEDGVWYSVAPMNVRRGLAGATTLGDMIYVSGGFDGSRRHTSMERYDPNIDQWSMLGDMQTAREGAGLVVASGIIYCLGGYDGLNILNSVEKYDPHTGHWTNVTPMATKRSGAGVALLNDHIYVVGGFDGTAHLSSVEAYNIRTDSWTTVTSMTTPRCYVGATVLRGRLYAIAGYDGNSLLSSIECYDPIIDSW 547          

HSP 2 Score: 138.272 bits (347), Expect = 3.848e-34
Identity = 70/207 (33.82%), Postives = 110/207 (53.14%), Query Frame = 2
Query:  932 NLEPHNFRPRYLQNSLYG-FIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQ 1549
            ++ P N R      +  G  I+V GG   +    +ME Y P + QW  L  + T +   G+ V    IY +GG+DG   L+ V+ ++  T  W++V  M   RS  G  ++ND IYV GG+DGT  L S E Y  + + W  +  M   R   G   L  +LYAI G++G ++ +S+EC++P++  W+++  M  +RC  GV VL +
Sbjct:  361 SVAPMNVRRGLAGATTLGDMIYVSGGFDGSRRHTSMERYDPNIDQWSMLGDMQTAREGAGLVVASGIIYCLGGYDGLNILNSVEKYDPHTGHWTNVTPMATKRSGAGVALLNDHIYVVGGFDGTAHLSSVEAYNIRTDSWTTVTSMTTPRCYVGATVLRGRLYAIAGYDGNSLLSSIECYDPIIDSWEVVASMGTQRCDAGVCVLRE 567          

HSP 3 Score: 103.99 bits (258), Expect = 7.027e-23
Identity = 53/144 (36.81%), Postives = 83/144 (57.64%), Query Frame = 2
Query:  983 GFIFVIGGSFQNGNQVN-MEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQK 1411
            G I+ +GG +   N +N +E Y P    W ++  + T ++  GVA+L+ +IYV+GGFDG+  LS V+ +N +T  W++V +M   R  +GAT++  ++Y   GYDG   L S E Y P ++ W V+  M   R   GV  L +K
Sbjct:  426 GIIYCLGG-YDGLNILNSVEKYDPHTGHWTNVTPMATKRSGAGVALLNDHIYVVGGFDGTAHLSSVEAYNIRTDSWTTVTSMTTPRCYVGATVLRGRLYAIAGYDGNSLLSSIECYDPIIDSWEVVASMGTQRCDAGVCVLREK 568          

HSP 4 Score: 62.7734 bits (151), Expect = 8.990e-10
Identity = 41/129 (31.78%), Postives = 65/129 (50.39%), Query Frame = 2
Query: 1457 VECFNPVMKCWDLITPMLNRRCRHGVAV-LNQSIYAAGGYDGVNFLSSVEVFSVTTSQ---WTYIASMKVPRSRMSLISTFGE-IFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIVA 1828
            VE ++P  + W  + P + R+ R+  +V L+  IY  GGYDG + LSSVE    T  +   W  +A M V R  ++  +T G+ I+  GGFDGS    + E ++    QW  +  +     G G  + +
Sbjct:  299 VEKYDPKTQEWSFL-PSITRKRRYVASVSLHDRIYVIGGYDGRSRLSSVECLDYTADEDGVWYSVAPMNVRRG-LAGATTLGDMIYVSGGFDGSRRHTSMERYDPNIDQWSMLGDMQTAREGAGLVVAS 425          
BLAST of Kelch-like protein diablo vs. UniProt/SwissProt
Match: sp|E9Q4F2|KLH18_MOUSE (Kelch-like protein 18 OS=Mus musculus OX=10090 GN=Klhl18 PE=1 SV=1)

HSP 1 Score: 357.836 bits (917), Expect = 1.289e-114
Identity = 171/446 (38.34%), Postives = 268/446 (60.09%), Query Frame = 2
Query:  500 CPSFYR-RISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNM-EVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIVAF 1831
            C +F R R+  +  L +R FA+++ C  L  AA+ +I+ +F+ +    EF  L  ED+LE++ +DEL V +EE VFEA + W+ Y   +R   L +L+  IR P   P++L + V  + +++   +CR+++D  KD+ ++P++  +L     RPR    S+ G I+ +GG    G+ +N+ EV+ PI  +W     + T ++RVGVAV++  +Y IGG+DG  RLS V+ +N +T  W+ V +MN  RSA+G  +++ +IYVCGGYDG  +L S E Y P+ ++W V+ PM   RSA GV     ++Y  GGH+GL I +SVE +N     W     MLN+RCRHG A L   ++  GGYDG  FLS  E++S    QW  I  M   RSR+SL+++ G ++A+GG+DG  NL + E ++  + +W  M+ +  H+GGVG   +  
Sbjct:  127 CCTFLRERLHPKNCLGVRQFAETMMCAVLYDAANSFIHQHFVEVSLSEEFLALPLEDVLELVSRDELNVKSEEQVFEAALAWVRYDREQRGPCLPELLSNIRLPLCRPQFLSDRVQQDDLVRCCHKCRDLVDEAKDYHLMPERRPHLPAFRTRPRCC-TSIAGLIYAVGGLNSAGDSLNVVEVFDPIANRWEKCHPMTTARSRVGVAVVNGLLYAIGGYDGQLRLSTVEAYNPETDTWTRVGSMNSKRSAMGTVVLDGQIYVCGGYDGNSSLNSVETYSPETDKWTVVTPMSSNRSAAGVTVFEGRIYVSGGHDGLQIFSSVEHYNHHTATWHPAASMLNKRCRHGAASLGSKMFVCGGYDGSGFLSIAEMYSSVADQWCLIVPMHTRRSRVSLVASCGRLYAVGGYDGQSNLSSVEMYDPETDRWTFMAPMACHEGGVGVGCIPL 571          
BLAST of Kelch-like protein diablo vs. UniProt/SwissProt
Match: sp|O94889|KLH18_HUMAN (Kelch-like protein 18 OS=Homo sapiens OX=9606 GN=KLHL18 PE=1 SV=3)

HSP 1 Score: 354.755 bits (909), Expect = 1.833e-113
Identity = 171/446 (38.34%), Postives = 266/446 (59.64%), Query Frame = 2
Query:  500 CPSFYR-RISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNM-EVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIVAF 1831
            C +F R R+  +  L +R FA+++ C  L  AA+ +I+ +F+ +    EF  L  ED+LE++ +DEL V +EE VFEA + W+ Y   +R  YL +L+  IR P   P++L + V  + +++   +CR+++D  KD+ ++P++  +L     RPR    S+ G I+ +GG    G+ +N+ EV+ PI   W     + T ++RVGVAV++  +Y IGG+DG  RLS V+ +N +T  W+ V +MN  RSA+G  +++ +IYVCGGYDG  +L S E Y P+ ++W V+  M   RSA GV     ++Y  GGH+GL I +SVE +N     W     MLN+RCRHG A L   ++  GGYDG  FLS  E++S    QW  I  M   RSR+SL+++ G ++A+GG+DG  NL + E ++  +  W  M+ +  H+GGVG   +  
Sbjct:  127 CCTFLRERLHPKNCLGVRQFAETMMCAVLYDAANSFIHQHFVEVSMSEEFLALPLEDVLELVSRDELNVKSEEQVFEAALAWVRYDREQRGPYLPELLSNIRLPLCRPQFLSDRVQQDDLVRCCHKCRDLVDEAKDYHLMPERRPHLPAFRTRPRCC-TSIAGLIYAVGGLNSAGDSLNVVEVFDPIANCWERCRPMTTARSRVGVAVVNGLLYAIGGYDGQLRLSTVEAYNPETDTWTRVGSMNSKRSAMGTVVLDGQIYVCGGYDGNSSLSSVETYSPETDKWTVVTSMSSNRSAAGVTVFEGRIYVSGGHDGLQIFSSVEHYNHHTATWHPAAGMLNKRCRHGAASLGSKMFVCGGYDGSGFLSIAEMYSSVADQWCLIVPMHTRRSRVSLVASCGRLYAVGGYDGQSNLSSVEMYDPETDCWTFMAPMACHEGGVGVGCIPL 571          
BLAST of Kelch-like protein diablo vs. UniProt/SwissProt
Match: sp|Q5U374|KLH12_DANRE (Kelch-like protein 12 OS=Danio rerio OX=7955 GN=klhl12 PE=2 SV=2)

HSP 1 Score: 291.967 bits (746), Expect = 2.153e-89
Identity = 153/443 (34.54%), Postives = 245/443 (55.30%), Query Frame = 2
Query:  500 CPSFYRRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNM-EVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMK---WSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNH--DGGV 1810
            C     ++     L +R FA++  C DL+ AA+++   +F  ++   EF  LS  ++ ++I  DE+QV +EE VFEAV+ W+++   ER+ YL DL++ +R P ++P Y+ + + +  +I+ SL CR+++D  K F + P+    ++    + R     +   + VIGG     + +++ E Y P  R+W  L  +   +  V    L+  +YVIGG+DG  RLS V+  +    +   W SVA MN  R   GAT + D IYV GG+DG+    S E Y P +++W ++  M   R   G+V  S  +Y +GG++GL I NSVE ++P    W  +TPM N+R   GVA+LN  IY  GG+DG   LSSVEV+++ T  WT +A+M  PR  +      G ++AI G+DG+  L + EC++     W  ++ +     D GV
Sbjct:  119 CDFLNSQLDPSNCLGIRDFAETHNCLDLMQAAELFSQKHFAEVVQQEEFMLLSQSEVEKLIKCDEIQVDSEEPVFEAVLNWVKHNRKEREPYLPDLLEYVRMPLLTPRYITDVIDAEPLIRCSLPCRDLVDEAKKFHLRPELRSEMQSPRTQARLGAKEV---LLVIGGFGSQQSPIDIVEKYDPKTREWSFLPNIARKRRYVATVALNDRVYVIGGYDGRSRLSSVECLDYTADEDGVWYSVATMNVRRGLAGATTLGDMIYVAGGFDGSRRHTSMERYDPNIDQWSMLGDMQTAREGAGLVVASGLIYCLGGYDGLNILNSVERYDPHTGHWTSVTPMANKRSGAGVALLNDHIYVVGGFDGTAHLSSVEVYNIRTDYWTTVANMTTPRCYVGATVLRGRLYAIAGYDGNSLLSSIECYDPVIDSWEVVTSMATQRCDAGV 558          

HSP 2 Score: 140.969 bits (354), Expect = 3.972e-34
Identity = 70/193 (36.27%), Postives = 106/193 (54.92%), Query Frame = 2
Query:  971 NSLYGFIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQ 1549
             +L   I+V GG   +    +ME Y P + QW  L  + T +   G+ V    IY +GG+DG   L+ V+ ++  T  W+SV  M   RS  G  ++ND IYV GG+DGT  L S E Y  + + W  +  M   R   G   L  +LYAI G++G ++ +S+EC++PV+  W+++T M  +RC  GV VL +
Sbjct:  371 TTLGDMIYVAGGFDGSRRHTSMERYDPNIDQWSMLGDMQTAREGAGLVVASGLIYCLGGYDGLNILNSVERYDPHTGHWTSVTPMANKRSGAGVALLNDHIYVVGGFDGTAHLSSVEVYNIRTDYWTTVANMTTPRCYVGATVLRGRLYAIAGYDGNSLLSSIECYDPVIDSWEVVTSMATQRCDAGVCVLRE 563          

HSP 3 Score: 108.997 bits (271), Expect = 1.192e-23
Identity = 56/144 (38.89%), Postives = 84/144 (58.33%), Query Frame = 2
Query:  983 GFIFVIGGSFQNGNQVN-MEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQK 1411
            G I+ +GG +   N +N +E Y P    W S+  +   ++  GVA+L+ +IYV+GGFDG+  LS V+V+N +T  W++VANM   R  +GAT++  ++Y   GYDG   L S E Y P ++ W V+  M   R   GV  L +K
Sbjct:  422 GLIYCLGG-YDGLNILNSVERYDPHTGHWTSVTPMANKRSGAGVALLNDHIYVVGGFDGTAHLSSVEVYNIRTDYWTTVANMTTPRCYVGATVLRGRLYAIAGYDGNSLLSSIECYDPVIDSWEVVTSMATQRCDAGVCVLREK 564          

HSP 4 Score: 65.0846 bits (157), Expect = 1.103e-9
Identity = 38/128 (29.69%), Postives = 61/128 (47.66%), Query Frame = 2
Query: 1457 VECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQ---WTYIASMKVPRSRMSLISTFGE-IFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIVA 1828
            VE ++P  + W  +  +  +R       LN  +Y  GGYDG + LSSVE    T  +   W  +A+M V R  ++  +T G+ I+  GGFDGS    + E ++    QW  +  +     G G  + +
Sbjct:  295 VEKYDPKTREWSFLPNIARKRRYVATVALNDRVYVIGGYDGRSRLSSVECLDYTADEDGVWYSVATMNVRRG-LAGATTLGDMIYVAGGFDGSRRHTSMERYDPNIDQWSMLGDMQTAREGAGLVVAS 421          
BLAST of Kelch-like protein diablo vs. UniProt/SwissProt
Match: sp|Q8R2H4|KLH12_RAT (Kelch-like protein 12 OS=Rattus norvegicus OX=10116 GN=Klhl12 PE=2 SV=2)

HSP 1 Score: 287.73 bits (735), Expect = 7.798e-88
Identity = 151/428 (35.28%), Postives = 236/428 (55.14%), Query Frame = 2
Query:  500 CPSFYRRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNM-EVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMK---WSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQW 1771
            C     ++     L +R FA++  C DL+ AA+++   +F  ++   EF  LS  ++ ++I  DE+QV +EE VFEAVI W+++A  ER+  L DL++ +R P ++P Y+ + + +   I+ SLQCR+++D  K F + P+    ++    R R   N +   + V+GG     + +++ E Y P  ++W  L  +   +  V    L   IYVIGG+DG  RLS V+  +    +   W SVA MN  R   GAT + D IYV GG+DG+    S E Y P +++W ++  M   R   G+V  S  +Y +GG++GL I NSVE ++P    W  +TPM  +R   GVA+LN  IY  GG+DG   LSSVE +++ T  WT + SM  PR  +      G ++AI G+DG+  L + EC++     W
Sbjct:  123 CEFLESQLDPSNCLGIRDFAETHNCVDLMQAAEVFSQKHFPEVVQHEEFILLSQGEVEKLIKCDEIQVDSEEPVFEAVINWVKHAKKEREESLPDLLQYVRMPLLTPRYITDVIDAEPFIRCSLQCRDLVDEAKKFHLRPELRSQMQGPRTRARLGDNEV---LLVVGGFGSQQSPIDVVEKYDPKTQEWSFLPSITRKRRYVASVSLHDRIYVIGGYDGRSRLSSVECLDYTADEDGVWYSVAPMNVRRGLAGATTLGDMIYVSGGFDGSRRHTSMERYDPNIDQWSMLGDMQTAREGAGLVVASGIIYCLGGYDGLNILNSVEKYDPHTGHWTNVTPMATKRSGAGVALLNDHIYVVGGFDGTAHLSSVEAYNIRTDSWTTVTSMTTPRCYVGATVLRGRLYAIAGYDGNSLLSSIECYDPIIDSW 547          

HSP 2 Score: 138.272 bits (347), Expect = 2.794e-33
Identity = 70/207 (33.82%), Postives = 110/207 (53.14%), Query Frame = 2
Query:  932 NLEPHNFRPRYLQNSLYG-FIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQ 1549
            ++ P N R      +  G  I+V GG   +    +ME Y P + QW  L  + T +   G+ V    IY +GG+DG   L+ V+ ++  T  W++V  M   RS  G  ++ND IYV GG+DGT  L S E Y  + + W  +  M   R   G   L  +LYAI G++G ++ +S+EC++P++  W+++  M  +RC  GV VL +
Sbjct:  361 SVAPMNVRRGLAGATTLGDMIYVSGGFDGSRRHTSMERYDPNIDQWSMLGDMQTAREGAGLVVASGIIYCLGGYDGLNILNSVEKYDPHTGHWTNVTPMATKRSGAGVALLNDHIYVVGGFDGTAHLSSVEAYNIRTDSWTTVTSMTTPRCYVGATVLRGRLYAIAGYDGNSLLSSIECYDPIIDSWEVVASMGTQRCDAGVCVLRE 567          

HSP 3 Score: 103.99 bits (258), Expect = 4.959e-22
Identity = 53/144 (36.81%), Postives = 83/144 (57.64%), Query Frame = 2
Query:  983 GFIFVIGGSFQNGNQVN-MEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQK 1411
            G I+ +GG +   N +N +E Y P    W ++  + T ++  GVA+L+ +IYV+GGFDG+  LS V+ +N +T  W++V +M   R  +GAT++  ++Y   GYDG   L S E Y P ++ W V+  M   R   GV  L +K
Sbjct:  426 GIIYCLGG-YDGLNILNSVEKYDPHTGHWTNVTPMATKRSGAGVALLNDHIYVVGGFDGTAHLSSVEAYNIRTDSWTTVTSMTTPRCYVGATVLRGRLYAIAGYDGNSLLSSIECYDPIIDSWEVVASMGTQRCDAGVCVLREK 568          

HSP 4 Score: 62.7734 bits (151), Expect = 5.918e-9
Identity = 41/129 (31.78%), Postives = 65/129 (50.39%), Query Frame = 2
Query: 1457 VECFNPVMKCWDLITPMLNRRCRHGVAV-LNQSIYAAGGYDGVNFLSSVEVFSVTTSQ---WTYIASMKVPRSRMSLISTFGE-IFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIVA 1828
            VE ++P  + W  + P + R+ R+  +V L+  IY  GGYDG + LSSVE    T  +   W  +A M V R  ++  +T G+ I+  GGFDGS    + E ++    QW  +  +     G G  + +
Sbjct:  299 VEKYDPKTQEWSFL-PSITRKRRYVASVSLHDRIYVIGGYDGRSRLSSVECLDYTADEDGVWYSVAPMNVRRG-LAGATTLGDMIYVSGGFDGSRRHTSMERYDPNIDQWSMLGDMQTAREGAGLVVAS 425          
BLAST of Kelch-like protein diablo vs. UniProt/SwissProt
Match: sp|Q8BZM0|KLH12_MOUSE (Kelch-like protein 12 OS=Mus musculus OX=10090 GN=Klhl12 PE=2 SV=1)

HSP 1 Score: 287.345 bits (734), Expect = 1.082e-87
Identity = 151/428 (35.28%), Postives = 236/428 (55.14%), Query Frame = 2
Query:  500 CPSFYRRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNM-EVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMK---WSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQW 1771
            C     ++     L +R FA++  C DL+ AA+++   +F  ++   EF  LS  ++ ++I  DE+QV +EE VFEAVI W+++A  ER+  L DL++ +R P ++P Y+ + + +   I+ SLQCR+++D  K F + P+    ++    R R   N +   + V+GG     + +++ E Y P  ++W  L  +   +  V    L   IYVIGG+DG  RLS V+  +    +   W SVA MN  R   GAT + D IYV GG+DG+    S E Y P +++W ++  M   R   G+V  S  +Y +GG++GL I NSVE ++P    W  +TPM  +R   GVA+LN  IY  GG+DG   LSSVE +++ T  WT + SM  PR  +      G ++AI G+DG+  L + EC++     W
Sbjct:  123 CEFLESQLDPSNCLGIRDFAETHNCVDLMQAAEVFSQKHFPEVVQHEEFILLSQGEVEKLIKCDEIQVDSEEPVFEAVINWVKHAKKEREESLPDLLQYVRMPLLTPRYITDVIDAEPFIRCSLQCRDLVDEAKKFHLRPELRSQMQGPRTRARLGANEV---LLVVGGFGSQQSPIDVVEKYDPKTQEWSFLPSITRKRRYVASVSLHDRIYVIGGYDGRSRLSSVECLDYTADEDGVWYSVAPMNVRRGLAGATTLGDMIYVSGGFDGSRRHTSMERYDPNIDQWSMLGDMQTAREGAGLVVASGIIYCLGGYDGLNILNSVEKYDPHTGHWTNVTPMATKRSGAGVALLNDHIYVVGGFDGTAHLSSVEAYNIRTDSWTTVTSMTTPRCYVGATVLRGRLYAIAGYDGNSLLSSIECYDPIIDSW 547          

HSP 2 Score: 138.272 bits (347), Expect = 2.691e-33
Identity = 70/207 (33.82%), Postives = 110/207 (53.14%), Query Frame = 2
Query:  932 NLEPHNFRPRYLQNSLYG-FIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQ 1549
            ++ P N R      +  G  I+V GG   +    +ME Y P + QW  L  + T +   G+ V    IY +GG+DG   L+ V+ ++  T  W++V  M   RS  G  ++ND IYV GG+DGT  L S E Y  + + W  +  M   R   G   L  +LYAI G++G ++ +S+EC++P++  W+++  M  +RC  GV VL +
Sbjct:  361 SVAPMNVRRGLAGATTLGDMIYVSGGFDGSRRHTSMERYDPNIDQWSMLGDMQTAREGAGLVVASGIIYCLGGYDGLNILNSVEKYDPHTGHWTNVTPMATKRSGAGVALLNDHIYVVGGFDGTAHLSSVEAYNIRTDSWTTVTSMTTPRCYVGATVLRGRLYAIAGYDGNSLLSSIECYDPIIDSWEVVASMGTQRCDAGVCVLRE 567          

HSP 3 Score: 103.99 bits (258), Expect = 4.915e-22
Identity = 53/144 (36.81%), Postives = 83/144 (57.64%), Query Frame = 2
Query:  983 GFIFVIGGSFQNGNQVN-MEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQK 1411
            G I+ +GG +   N +N +E Y P    W ++  + T ++  GVA+L+ +IYV+GGFDG+  LS V+ +N +T  W++V +M   R  +GAT++  ++Y   GYDG   L S E Y P ++ W V+  M   R   GV  L +K
Sbjct:  426 GIIYCLGG-YDGLNILNSVEKYDPHTGHWTNVTPMATKRSGAGVALLNDHIYVVGGFDGTAHLSSVEAYNIRTDSWTTVTSMTTPRCYVGATVLRGRLYAIAGYDGNSLLSSIECYDPIIDSWEVVASMGTQRCDAGVCVLREK 568          

HSP 4 Score: 62.7734 bits (151), Expect = 6.288e-9
Identity = 41/129 (31.78%), Postives = 65/129 (50.39%), Query Frame = 2
Query: 1457 VECFNPVMKCWDLITPMLNRRCRHGVAV-LNQSIYAAGGYDGVNFLSSVEVFSVTTSQ---WTYIASMKVPRSRMSLISTFGE-IFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIVA 1828
            VE ++P  + W  + P + R+ R+  +V L+  IY  GGYDG + LSSVE    T  +   W  +A M V R  ++  +T G+ I+  GGFDGS    + E ++    QW  +  +     G G  + +
Sbjct:  299 VEKYDPKTQEWSFL-PSITRKRRYVASVSLHDRIYVIGGYDGRSRLSSVECLDYTADEDGVWYSVAPMNVRRG-LAGATTLGDMIYVSGGFDGSRRHTSMERYDPNIDQWSMLGDMQTAREGAGLVVAS 425          
BLAST of Kelch-like protein diablo vs. TrEMBL
Match: A0A0L8FL82 (BTB domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22015467mg PE=4 SV=1)

HSP 1 Score: 402.905 bits (1034), Expect = 2.893e-129
Identity = 189/443 (42.66%), Postives = 286/443 (64.56%), Query Frame = 2
Query:  500 CPSFYRRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVN-MEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIV 1825
            C     R+  Q  L +R+F +   C  L+ AA+ YI  +F  + N  EF +L   ++LEII +DEL V TEE+VFEAVI W++     RK  L +LM ++R P ++P+YL + V   ++I++S+ CR++LD  KD+ ++P++   L+    RPR   + + G I+ +GG   +G+ ++ +E + P+ R+W   + + T ++RVGVAVL+  +Y IGG+DG  RLS V+VF   T +W  VA+MNC RSALGA  +  K+Y+CGGYDG  +L+S E Y PK+N W +I  ML+ RSA GV  L +++YA GGH+GL+I +SVEC+NP    W ++ PM ++RCR GVA LN  +YAAGGYDG  FL +VE +   T  WTY+  M + RSR++L++T G+++AIGG+DG  NL + E ++     W   + +  H+GGVG  ++
Sbjct:  150 CNFLKTRLHPQNCLGIRSFGEQYMCPSLVEAANKYIQKHFKDVANSEEFLNLDKAEILEIISRDELHVKTEELVFEAVIAWVKRNPVLRKEALPELMVKVRLPLLTPQYLSDYVAPEELIKSSIPCRDLLDEAKDYHLMPERRPLLQTFKTRPRCCTD-IPGIIYAVGGLTSSGDSLSTVECFDPVNRRWKIAEAMSTMRSRVGVAVLNSKLYAIGGYDGQDRLSTVEVFKPDTKRWRKVASMNCKRSALGAASLGRKLYICGGYDGVSSLRSVEVYDPKINVWTIISNMLKHRSAAGVAVLDEEIYACGGHDGLSIFDSVECYNPATNTWWMVQPMQSKRCRLGVATLNGKLYAAGGYDGSVFLRTVERYDPCTQTWTYVKHMNLKRSRVALVATCGKLYAIGGYDGVANLNSVEMYDPEMDTWTFAASMCAHEGGVGVGVM 591          
BLAST of Kelch-like protein diablo vs. TrEMBL
Match: T1PJ05 (Kelch motif protein OS=Musca domestica OX=7370 GN=101894315 PE=2 SV=1)

HSP 1 Score: 401.364 bits (1030), Expect = 5.173e-129
Identity = 187/444 (42.12%), Postives = 284/444 (63.96%), Query Frame = 2
Query:  500 CPSFY-RRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVN-MEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIV 1825
            C  F   R     VL +R FA S+ C  L+ AAD YI  NF  +    EF +L F++L+E+I  D L + +EE+VFEA ++W++++ ++R      ++ Q+R P +SP++L + V   ++I++S QCR++LD  KDF ++P++   L+  +FR R+    + G I+ +GG   NG  V+ +E+Y PI  +W   +Q+   ++RVGVAV+D  +Y  GGF+GS RLS V+V++ +  KWS  + MNC RSA+G   +ND IYVCGGYDG  +L + E YCPK + W+ + PM++ RSA GV  L + +YA+GGH+GL+I +SVE ++PV   W  + PMLNRRCR GVA L+  +YA GGYDG +FL SVEV+      W+ + SM   RSR++L +  G+++AIGG+DG  NL T E ++  +  W  +  +  H GGVG  ++
Sbjct:  132 CAEFLISRFHPHNVLGIRHFADSMSCQHLIKAADKYIDQNFAKVSQSEEFLNLEFDELIELIKSDYLNIKSEEVVFEACLKWVKFSEAKRVELFPQVLSQVRLPLLSPQFLADRVAREELIRSSHQCRDLLDEAKDFHLMPERRGLLQ--SFRTRHRGEFISGQIYAVGGLTSNGESVSTVEIYDPITHKWRMGEQMSMMRSRVGVAVMDGKLYAFGGFNGSERLSTVEVYDPQENKWSQGSAMNCKRSAVGVAALNDCIYVCGGYDGVTSLNTVECYCPKTDVWKTVAPMMKYRSAGGVAALDKYVYALGGHDGLSIFDSVERYDPVNDVWQKMKPMLNRRCRLGVAALDGKLYACGGYDGNSFLRSVEVYDPIKDSWSLVTSMNCKRSRVALAANMGKLWAIGGYDGETNLSTVEVYDPEADTWSFVPSMCAHSGGVGAGVI 573          
BLAST of Kelch-like protein diablo vs. TrEMBL
Match: A0A1I8PHH2 (BTB domain-containing protein OS=Stomoxys calcitrans OX=35570 GN=106088668 PE=4 SV=1)

HSP 1 Score: 398.667 bits (1023), Expect = 5.613e-128
Identity = 188/444 (42.34%), Postives = 283/444 (63.74%), Query Frame = 2
Query:  500 CPSFY-RRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVN-MEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIV 1825
            C  F   R     VL +R FA S+ C  L+ AAD YI  NF  +    EF  L FE+L+++I  D L V +EE+VFEA ++W+++   +R      ++ ++R P +SP++L + V   ++I++S QCR++LD  KDF ++P++   L+  +FR R+    + G I+ +GG   NG  V+ +E+Y PI ++W   +Q+   ++RVGVAV+D  +Y  GGF+GS RLS V+V++ +  KWS  + MNC RSA+G   +ND IYVCGGYDG  +L + E YCPK + W+++ PM++ RSA GV  L + +YA+GGH+GL+I +SVE ++PV   W  + PMLNRRCR GVA LN  +YA GGYDG +FL SVEV+      W+ + SM   RSR++L +  G+++AIGG+DG  NL T E ++  +  W  +  +  H GGVG  ++
Sbjct:  128 CAEFLISRFHPHNVLGIRHFADSMSCVHLIKAADKYIDQNFEKVSQSEEFLSLGFEELIDLIKSDYLNVKSEEVVFEACMKWVKHCEPKRAELFPQVLAKVRLPLLSPQFLADRVAREEMIRSSHQCRDLLDEAKDFHLMPERRGLLQ--SFRTRHRGEFISGQIYAVGGLASNGESVSTVEIYDPITQKWRMGEQMSMMRSRVGVAVMDGQLYAFGGFNGSERLSTVEVYDPRQNKWSQGSAMNCKRSAVGVAALNDCIYVCGGYDGVTSLNTVECYCPKTDLWKIVAPMMKYRSAGGVAALDKYVYALGGHDGLSIFDSVERYDPVSDVWHKMKPMLNRRCRLGVAALNGKLYACGGYDGNSFLRSVEVYDPIKDSWSLVTSMNCKRSRVALAANMGKLWAIGGYDGETNLSTVEVYDPEADLWSFVPSMCAHSGGVGAGVI 569          
BLAST of Kelch-like protein diablo vs. TrEMBL
Match: A0A2B4RP72 (Kelch-like protein 20 OS=Stylophora pistillata OX=50429 GN=klhl20 PE=4 SV=1)

HSP 1 Score: 396.741 bits (1018), Expect = 1.223e-126
Identity = 194/444 (43.69%), Postives = 281/444 (63.29%), Query Frame = 2
Query:  500 CPSFYRRISSQT-VLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVN-MEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIV 1825
            C  F  R+   T  L +R+FA +  C DL+ AAD++   NF  +    EF  L+ E ++E+I ++EL V TEE VFEA+  W+     ERK +L +L+K +R P ISP+YL + V S+++I+++L CR+++D  KD+L++P++   L+    +PR    +  G I+ IGG   +G  ++ +E Y  +  QW     + T +TRVGVAVLD+ +Y +GGFDG +RLS V+ FN +   W +VA MN  RSALGA +++ +IYV GGYDG I+L + E Y P  N W+ + PM   RSA GV  L+ K++AIGGHNGL+I N+VE +NP    W    PM  RRCR GVA LN  IY  GGYDG  FL++VE F   T QWT++A M   RSR+++++  G ++AIGG+DG  NL T ECF+  S +W  ++ +  H GGVG  ++
Sbjct:  169 CVEFLHRVLHPTNCLGIRSFADTYSCVDLVEAADVFAVKNFSEVARSEEFLSLAPEAVVEMISREELNVRTEEEVFEAISAWVRREEDERKDFLPELLKNVRLPLISPQYLCDKVSSDELIKSNLACRDLVDEAKDYLLMPERRCKLQSIRTKPRRCSEAA-GLIYAIGGLTSSGEALSTVETYDTLTGQWLPGLPMSTLRTRVGVAVLDNKLYALGGFDGHKRLSTVECFNPQFQTWKAVAPMNTRRSALGAVVVSGRIYVVGGYDGHISLSTVECYSPAANSWKFVAPMGTLRSAAGVTELNGKIFAIGGHNGLSIFNTVEVYNPQTNTWVQSPPMSVRRCRVGVATLNGRIYVCGGYDGSCFLNTVECFDPETGQWTFVAPMNTRRSRVAVVTLGGRLYAIGGYDGLSNLNTVECFDVLSNRWTPVASMGMHQGGVGVGVL 611          

HSP 2 Score: 61.2326 bits (147), Expect = 5.113e-6
Identity = 34/106 (32.08%), Postives = 51/106 (48.11%), Query Frame = 2
Query: 1514 RRCRHGVAVLNQSIYAAGGYDGVN-FLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIVA 1828
            RRC     +    IYA GG       LS+VE +   T QW     M   R+R+ +     +++A+GGFDG   L T ECFN + Q W  ++ +      +G  +V+
Sbjct:  323 RRCSEAAGL----IYAIGGLTSSGEALSTVETYDTLTGQWLPGLPMSTLRTRVGVAVLDNKLYALGGFDGHKRLSTVECFNPQFQTWKAVAPMNTRRSALGAVVVS 424          
BLAST of Kelch-like protein diablo vs. TrEMBL
Match: A0A444SVL9 (Kelch-like protein 18 OS=Armadillidium vulgare OX=13347 GN=Avbf_08402 PE=4 SV=1)

HSP 1 Score: 390.193 bits (1001), Expect = 1.469e-125
Identity = 181/446 (40.58%), Postives = 290/446 (65.02%), Query Frame = 2
Query:  500 CPSFY-RRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVN-MEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIVAF 1831
            C  F  RR+    VL +R FA +L C  L+ A + Y+  +F+ + + +EF +L F ++ +IIC+DEL V +EE VFEAV+ W++  +  R  +L +L+ ++R P ++P+YL + V +  +I++S +CR++LD  KD+ ++P++   L+    +PR   N + G I+ +GG  ++G+ +  +E Y PI+ +W   + +   ++RVGV V++  +Y IGG++G  RL+ V+VF+  +  W+ VA MNC RSA+GA ++N  IYVCGGYDG  +L + E+Y  + N+W ++  M + RSA GVV     +YAIGGH+GL+I +SVE ++P    W  +TPML++RCR G A LN  +Y  GGYDG  FL +VEV+   TS+W+Y+ASM V RSR++L++  G ++AIGG+DG  NL T E +N  + QW  ++ +  H+GGVG  ++  
Sbjct:   62 CGDFLKRRLHPHNVLGVRGFADTLSCWSLVEACNRYLNKHFVEVSHSDEFLNLPFSEIRDIICRDELNVQSEENVFEAVMTWVKKDLEVRSFHLPELLAKVRMPLLTPQYLTDKVATESLIKSSHECRDLLDEAKDYHLMPERRLLLQSFRTQPRCC-NDIVGLIYAVGGLTKSGDSLKTVEYYDPIIGRWKMAENMSMLRSRVGVVVMNKKLYAIGGYNGLDRLATVEVFDPISKVWNKVAPMNCKRSAVGAAVLNSYIYVCGGYDGVASLNTVEQYDSENNKWSMVTSMTKHRSAAGVVAFEGHIYAIGGHDGLSIFDSVERYDPTSGQWTDVTPMLSKRCRLGAATLNGKLYVCGGYDGSTFLRTVEVYDPITSKWSYVASMNVIRSRVALVANMGRLYAIGGYDGVSNLSTVEVYNPETDQWEFITSMCAHEGGVGVGVIPL 506          
BLAST of Kelch-like protein diablo vs. Ensembl Cavefish
Match: klhl18 (kelch like family member 18 [Source:NCBI gene;Acc:103041569])

HSP 1 Score: 358.221 bits (918), Expect = 9.032e-116
Identity = 168/448 (37.50%), Postives = 271/448 (60.49%), Query Frame = 2
Query:  500 CPSFYRRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNM-EVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIVAFSDA 1840
            C     R+  +  L +R FA+++ C  L  AA+ +++ +F+ +    EF  L  E++LE++  DEL +  EE VFEAV+ W+ +   +R+  L +L+ + R P   P++L + V  +++++   +CR+++D  KD+ ++P++  +L     R R    S+ G I+ +GG    G+ +N+ EV+ PI   W     + T ++RVGVAV++  +Y IGG+DG  RLS V+V+N +T  WS VA+MN  RSA+G  +++  IYVCGGYDG  +L S E Y P+ +RW V+  M   RSA GV     +++  GGH+GL I N+VE +N     W  + PM+N+RCRHG A +   +Y AGGYDG  FLS  EV+S    QW+++  M   RSR+SL+++ G ++A+GG+DG  NL + E ++  + +W  M+ ++ H+GGVG   +    A
Sbjct:  128 CTFLQERLHPKNCLGVRQFAETMMCTGLYDAANSFVHQHFVEVSMSEEFLSLRPEEVLELVGCDELNIKAEEQVFEAVLTWVRHQREDREPCLPELLSKTRLPLCRPQFLADRVQQDELVRCCHKCRDLVDEAKDYHLMPERRPHLPAFKTRQRCC-TSIAGLIYAVGGLNSAGDSLNVVEVFDPIGNCWERCQPMSTARSRVGVAVVNGLLYAIGGYDGQSRLSTVEVYNPETDTWSKVASMNSQRSAMGTVVVDGHIYVCGGYDGKSSLNSVECYSPETDRWVVVTEMSASRSAAGVTVFEGRIFVSGGHDGLQIFNTVEYYNQHTALWHPMAPMMNKRCRHGAAAVGSQLYIAGGYDGSGFLSGAEVYSSVVDQWSHLVPMNTRRSRVSLVASCGHLYAVGGYDGQSNLNSVEMYDPETNRWTFMAPMVCHEGGVGVGCIPLQPA 574          
BLAST of Kelch-like protein diablo vs. Ensembl Cavefish
Match: klhl18 (kelch like family member 18 [Source:NCBI gene;Acc:103041569])

HSP 1 Score: 355.525 bits (911), Expect = 2.071e-111
Identity = 167/442 (37.78%), Postives = 270/442 (61.09%), Query Frame = 2
Query:  518 RISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNM-EVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIVAFSDA 1840
            R+  +  L +R FA+++ C  L  AA+ +++ +F+ +    EF  L  E++LE++  DEL +  EE VFEAV+ W+ +   +R+  L +L+ + R P   P++L + V  +++++   +CR+++D  KD+ ++P++  +L     R R    S+ G I+ +GG    G+ +N+ EV+ PI   W     + T ++RVGVAV++  +Y IGG+DG  RLS V+V+N +T  WS VA+MN  RSA+G  +++  IYVCGGYDG  +L S E Y P+ +RW V+  M   RSA GV     +++  GGH+GL I N+VE +N     W  + PM+N+RCRHG A +   +Y AGGYDG  FLS  EV+S    QW+++  M   RSR+SL+++ G ++A+GG+DG  NL + E ++  + +W  M+ ++ H+GGVG   +    A
Sbjct:  431 RLHPKNCLGVRQFAETMMCTGLYDAANSFVHQHFVEVSMSEEFLSLRPEEVLELVGCDELNIKAEEQVFEAVLTWVRHQREDREPCLPELLSKTRLPLCRPQFLADRVQQDELVRCCHKCRDLVDEAKDYHLMPERRPHLPAFKTRQRCC-TSIAGLIYAVGGLNSAGDSLNVVEVFDPIGNCWERCQPMSTARSRVGVAVVNGLLYAIGGYDGQSRLSTVEVYNPETDTWSKVASMNSQRSAMGTVVVDGHIYVCGGYDGKSSLNSVECYSPETDRWVVVTEMSASRSAAGVTVFEGRIFVSGGHDGLQIFNTVEYYNQHTALWHPMAPMMNKRCRHGAAAVGSQLYIAGGYDGSGFLSGAEVYSSVVDQWSHLVPMNTRRSRVSLVASCGHLYAVGGYDGQSNLNSVEMYDPETNRWTFMAPMVCHEGGVGVGCIPLQPA 871          
BLAST of Kelch-like protein diablo vs. Ensembl Cavefish
Match: KLHL12 (kelch like family member 12 [Source:NCBI gene;Acc:103031735])

HSP 1 Score: 286.574 bits (732), Expect = 2.521e-88
Identity = 150/443 (33.86%), Postives = 245/443 (55.30%), Query Frame = 2
Query:  500 CPSFYRRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNM-EVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMK---WSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNH--DGGV 1810
            C     ++     L +R FA++  C DL+ AA+++   +F  ++   EF  LS  ++ ++I  DE+QV +EE VFEAV+ W+++   ER+ YL+D+++ +R P ++P Y+ + + S  +I+ SL CR+++D  K F + P+    ++    + R     +   + VIGG     + +++ E Y P  ++W  L  +   +  V    L+  +YVIGG+DG  RLS V+  +    +   W +VA MN  R   GAT + D IYV GG+DG+    S E Y P +++W ++  M   R   G+V  S  +Y +GG++GL I NSVE ++P    W  +TPM N+R   GVA+LN  IY  GG+DG   L+SVEV+++ T  WT +A M  PR  +      G ++AI G+DG+  L + EC++     W  ++ +     D GV
Sbjct:  119 CDFLNSQLDPSNCLGIRDFAETHNCVDLMQAAELFSQKHFSEVVQHEEFMLLSQTEVEKLIKCDEIQVDSEEPVFEAVLNWVKHNRKEREPYLSDMLEYVRMPLLTPRYITDVIDSEPLIRCSLACRDLVDEAKKFHLRPELRSEMQGPRTQARLGAKEV---LLVIGGFGSQQSPIDVVEKYDPKTQEWSFLPNIARKRRYVATVSLNDRVYVIGGYDGRSRLSSVECLDYTADEDGVWYTVATMNVRRGLAGATTLGDMIYVAGGFDGSRRHTSMERYDPNIDQWSMLGDMQTAREGAGLVVASGLIYCLGGYDGLNILNSVERYDPHTGHWTSVTPMANKRSGAGVALLNDHIYVVGGFDGTAHLASVEVYNIRTDYWTTVAPMTTPRCYVGATVLRGRLYAIAGYDGNSLLSSIECYDPVLDSWEVVTSMATQRCDAGV 558          

HSP 2 Score: 145.206 bits (365), Expect = 1.455e-36
Identity = 71/193 (36.79%), Postives = 107/193 (55.44%), Query Frame = 2
Query:  971 NSLYGFIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQ 1549
             +L   I+V GG   +    +ME Y P + QW  L  + T +   G+ V    IY +GG+DG   L+ V+ ++  T  W+SV  M   RS  G  ++ND IYV GG+DGT  L S E Y  + + W  + PM   R   G   L  +LYAI G++G ++ +S+EC++PV+  W+++T M  +RC  GV VL +
Sbjct:  371 TTLGDMIYVAGGFDGSRRHTSMERYDPNIDQWSMLGDMQTAREGAGLVVASGLIYCLGGYDGLNILNSVERYDPHTGHWTSVTPMANKRSGAGVALLNDHIYVVGGFDGTAHLASVEVYNIRTDYWTTVAPMTTPRCYVGATVLRGRLYAIAGYDGNSLLSSIECYDPVLDSWEVVTSMATQRCDAGVCVLRE 563          

HSP 3 Score: 106.301 bits (264), Expect = 1.117e-23
Identity = 55/144 (38.19%), Postives = 83/144 (57.64%), Query Frame = 2
Query:  983 GFIFVIGGSFQNGNQVN-MEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQK 1411
            G I+ +GG +   N +N +E Y P    W S+  +   ++  GVA+L+ +IYV+GGFDG+  L+ V+V+N +T  W++VA M   R  +GAT++  ++Y   GYDG   L S E Y P L+ W V+  M   R   GV  L +K
Sbjct:  422 GLIYCLGG-YDGLNILNSVERYDPHTGHWTSVTPMANKRSGAGVALLNDHIYVVGGFDGTAHLASVEVYNIRTDYWTTVAPMTTPRCYVGATVLRGRLYAIAGYDGNSLLSSIECYDPVLDSWEVVTSMATQRCDAGVCVLREK 564          

HSP 4 Score: 64.3142 bits (155), Expect = 2.235e-10
Identity = 41/129 (31.78%), Postives = 65/129 (50.39%), Query Frame = 2
Query: 1457 VECFNPVMKCWDLITPMLNRRCRHGVAV-LNQSIYAAGGYDGVNFLSSVEVFSVTTSQ---WTYIASMKVPRSRMSLISTFGE-IFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIVA 1828
            VE ++P  + W  + P + R+ R+   V LN  +Y  GGYDG + LSSVE    T  +   W  +A+M V R  ++  +T G+ I+  GGFDGS    + E ++    QW  +  +     G G  + +
Sbjct:  295 VEKYDPKTQEWSFL-PNIARKRRYVATVSLNDRVYVIGGYDGRSRLSSVECLDYTADEDGVWYTVATMNVRRG-LAGATTLGDMIYVAGGFDGSRRHTSMERYDPNIDQWSMLGDMQTAREGAGLVVAS 421          
BLAST of Kelch-like protein diablo vs. Ensembl Cavefish
Match: klhl20 (kelch like family member 20 [Source:NCBI gene;Acc:103022090])

HSP 1 Score: 283.108 bits (723), Expect = 8.785e-87
Identity = 155/455 (34.07%), Postives = 245/455 (53.85%), Query Frame = 2
Query:  500 CPSFYRRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSS-VANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQW-----LEMSRLLNHDGGVGCAIVAFSDAHL 1846
            C    R++     L +R FA +  C +LL  AD +  +NF  ++   EF  L    L++II  DEL V +EE VF AV+ W++Y+I ER+  L  +++ +R P +SP++L+ TV S+ +I++  +CR+++D  K++L+LPQ+   ++    RPR         +F +GG        ++E Y P   +W  +  +   +  VGV+VLD  +Y +GG DGS  L+ V+ ++ KT +WSS VA  +  R+++G  ++   +Y  GG DG   L   E Y PK N+W  +  M   R    V  L   LYA+GG +G +  N+VE +NP    W  + PM  RR   G AV    IY+ GG D    LSS E ++  T+QW+ + +M   RS + L    G++ A+GGFDG+  LKT E ++  +  W     +   RL    GGVG   +   ++H+
Sbjct:  140 CEFLKRQLDPSNCLGIRAFADTHSCRELLRIADKFTQHNFQEVMESEEFMLLPANQLIDIISSDELNVRSEEQVFNAVMAWVKYSIQERRPQLPQVLQHVRLPLLSPKFLVGTVGSDPLIKSDEECRDLVDEAKNYLLLPQERPLMQGPRTRPRK-PIRCGEVLFAVGGWCSGDAISSVERYDPQTNEWRMVASMSKRRCGVGVSVLDDLLYAVGGHDGSSYLNSVERYDPKTNQWSSDVAPTSTCRTSVGVAVLGGYLYAVGGQDGVSCLNIVERYDPKENKWTRVASMSTRRLGVAVAVLGGFLYAVGGSDGTSPLNTVERYNPQENRWHTVAPMGTRRKHLGCAVYQDMIYSVGGRDDTTELSSAERYNPRTNQWSPVVAMTSRRSGVGLAVVNGQLMAVGGFDGTTYLKTIEVYDPDANTWRLYGGMNYRRL---GGGVGVIKMTHCESHI 590          
BLAST of Kelch-like protein diablo vs. Ensembl Cavefish
Match: klhl17 (kelch like family member 17 [Source:NCBI gene;Acc:103036751])

HSP 1 Score: 267.314 bits (682), Expect = 9.420e-81
Identity = 139/444 (31.31%), Postives = 234/444 (52.70%), Query Frame = 2
Query:  500 CPSFYRRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIVAF 1831
            C     ++     L +R FA +  C DLL +A  Y+  +F+ +    EF  L  + +L++I  D L V +EE V+ AV+ W+++ I  R+ ++  LMK +R P ++ ++L+  V +  ++++  +C+++L     + ++P+Q   L     RPR  + +    +F +GG        + E Y     +W  +  + T + RVGVA + + +Y +GG+DG+  L+ V+ ++  T  W    +M   RS LG  +++  +Y  GGYDG   L S E Y P  + W  I  M   R    V  L   LYA+GG++  +   +VE ++P    W  I  ML+RR   GVAVL   +Y AGG DG + L+SVE ++  T+ W  +A M + RS   L++  G ++A+GG DGS +L + E +N RS +W+  S +      VG A++  
Sbjct:  131 CKFLLSQLDPSNCLGIRGFADTHSCSDLLKSAHKYVLQHFVEVSKTEEFMLLPLKQVLDLISSDNLNVPSEEEVYRAVLSWVKHDIDGRRQHVPRLMKCVRLPLLTRDFLMSNVDTELLVRHHSECKDLLIEALKYHLMPEQRGVLSNSRTRPRRCEGA-SPVLFAVGGGSLFAIHGDCEAYDTRTDRWHMVASMSTRRARVGVAAIGNKLYAVGGYDGTSDLATVESYDPVTNGWQPEVSMGTRRSCLGVAVLHGLLYAAGGYDGASCLNSAERYDPLTSTWTSIAAMSTRRRYVRVATLDGSLYAVGGYDSSSHLATVEKYDPQSNAWTAIANMLSRRSSAGVAVLEGMLYVAGGNDGTSCLNSVERYNPKTNTWEGVAPMNIRRSTHDLVAMDGWLYAVGGNDGSSSLNSIEKYNPRSNKWVAASCMFTRRSSVGVAVLEL 573          
BLAST of Kelch-like protein diablo vs. Ensembl Sea Lamprey
Match: klhl18 (kelch-like family member 18 [Source:ZFIN;Acc:ZDB-GENE-030131-5785])

HSP 1 Score: 355.91 bits (912), Expect = 1.703e-115
Identity = 174/445 (39.10%), Postives = 260/445 (58.43%), Query Frame = 2
Query:  500 CPSFYRRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNM-EVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIVAF 1831
            C     R+  + VL +R+FA+++ C  L   A+ ++  +F+   +  EF  L  E+LLE+  +DEL V  EE VFEAV+ W+      R   L DL+  +R P   P +L + V  +++I+   +CR++LD  KD+ ++P +   L  +  RPR    SL G ++ +GG    G+ V M EVY P+  +W +   +G+ ++RVGVAVL   +Y +GG DG  RLS V+V++     W+ VA+MN  RSA+G  +++ +IYVCGGYDG  +L S E Y  + ++W ++  M   RSATGV     ++Y  GGH+GL I N+VE +NP    W    PM  RRCRHG A L+  +YA GGY G  FLSSVE +   + QW+ +  M   RSR++L +  G ++A+GG+DG  NL T ECF   S  W + +++  H GGVG   + F
Sbjct:  137 CHFLKERLHPKNVLGVRSFAEAMMCPALYDTANSFLQQHFVEASSGEEFLGLPGEELLELAARDELHVEGEEQVFEAVLAWVRRDREGRAPLLPDLLTCVRLPLCRPHFLTDRVQQDELIRACHKCRDLLDEAKDYHLMPDRRPVLPAYKTRPRCC-TSLAGRVYAVGGLNSAGDAVTMVEVYDPLTNRWEACCPMGSPRSRVGVAVLGGRLYAVGGSDGQERLSSVEVYDPDRNIWTKVASMNSKRSAMGVAVLDGQIYVCGGYDGVSSLSSVECYSSEADKWTMVTAMNSPRSATGVAFFEGRVYVTGGHDGLQIFNTVEYYNPHTGSWHKAAPMQQRRCRHGAAALSGRLYAVGGYTGSAFLSSVETYDTASDQWSALTPMLASRSRVALAACSGRLYALGGYDGYANLGTVECFTPESNTWRQAAQMSWHTGGVGTGCLPF 580          
BLAST of Kelch-like protein diablo vs. Ensembl Sea Lamprey
Match: klhl5 (kelch-like family member 5 [Source:ZFIN;Acc:ZDB-GENE-080424-7])

HSP 1 Score: 253.062 bits (645), Expect = 3.724e-76
Identity = 135/436 (30.96%), Postives = 226/436 (51.83%), Query Frame = 2
Query:  500 CPSFYRRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYD--GVNFLSS----VEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRL 1789
            C    +++     L +R+FA +  C DL   A  Y   NF+ ++   EF  L  E + ++   +E+ V  EE VF+A++ W+ + +  R+H L  L+  +R P +SP++L + + SN ++ + ++C+ +L     + +LP++   ++  + RPR    S  G +F +GG        ++E Y      W  +  L   + + GVAVLD  +YV+GG DG + L+ V+ +N +T  WS +  M+ +R  LG  ++   +Y  GG+DG   L + E + P+  +W  +  M   RS  GV  L+ KLYA+GG +G +   SVECF+P    W    PM  RR   GV+  N  +YA GG+D    N  S     VE F   T  WT +A + V R  + +      ++A+GG+DG   L T E ++  + +W +++ L
Sbjct:  140 CGFLMKQLHPSNCLGIRSFADAQGCTDLHKVAHNYTMENFLEVMRNQEFLLLPTEAVADLFASEEMNVPGEETVFQALMAWVMHEVETRRHVLPGLLAHVRLPLLSPQFLGD-LESNPLLCDDVECQRLLLQAMKYHLLPERRPAMQGASTRPR---KSTVGTMFAVGGMDATKGATSIERYDLRTNTWTQVAMLSGRRLQFGVAVLDDKVYVVGGRDGLKTLNTVECYNPRTHTWSVLPPMSTHRHGLGVAVLEGPMYAVGGHDGWSYLNTVERWDPQARQWNYVANMSNPRSTVGVAVLNGKLYAVGGRDGSSCLRSVECFDPHTNKWTACAPMCKRRGGVGVSACNGFLYAVGGHDTPASNHCSRISDCVERFDPKTDAWTAVAPLSVSRDAVGVGLLGDRLYAVGGYDGQTYLNTVEAYDPVANEWTQVAPL 571          

HSP 2 Score: 83.5741 bits (205), Expect = 4.356e-17
Identity = 43/146 (29.45%), Postives = 75/146 (51.37%), Query Frame = 2
Query:  977 LYGFIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDG------SRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVV 1396
            L G ++ +GG   +    ++E + P   +W +   +   +  VGV+  + ++Y +GG D       SR    V+ F+ KT  W++VA ++ +R A+G  ++ D++Y  GGYDG   L + E Y P  N W  + P+   R+   VV
Sbjct:  436 LNGKLYAVGGRDGSSCLRSVECFDPHTNKWTACAPMCKRRGGVGVSACNGFLYAVGGHDTPASNHCSRISDCVERFDPKTDAWTAVAPLSVSRDAVGVGLLGDRLYAVGGYDGQTYLNTVEAYDPVANEWTQVAPLCLGRAGACVV 581          

HSP 3 Score: 60.8474 bits (146), Expect = 5.052e-10
Identity = 26/92 (28.26%), Postives = 49/92 (53.26%), Query Frame = 2
Query: 1550 SIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIV 1825
            +++A GG D     +S+E + + T+ WT +A +   R +  +     +++ +GG DG   L T EC+N R+  W  +  +  H  G+G A++
Sbjct:  298 TMFAVGGMDATKGATSIERYDLRTNTWTQVAMLSGRRLQFGVAVLDDKVYVVGGRDGLKTLNTVECYNPRTHTWSVLPPMSTHRHGLGVAVL 389          
BLAST of Kelch-like protein diablo vs. Ensembl Sea Lamprey
Match: klhl8 (kelch-like family member 8 [Source:ZFIN;Acc:ZDB-GENE-070209-226])

HSP 1 Score: 233.417 bits (594), Expect = 1.502e-68
Identity = 129/454 (28.41%), Postives = 228/454 (50.22%), Query Frame = 2
Query:  491 ISYCPSFYRR-ISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQN---SLYGFIFVIGGSFQNGNQV-NMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALG-ATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIVAFS 1834
            +  C ++ +R + +   L +R FA+      L+ AAD +   NF ++    EF D+S   L+ ++   +L V+ E  V+EA +RW+       + +L  + +Q+RFP +  ++L+ T    ++++ +++CR++LD  K+F +  Q    L    F  R       +  G +F +GG    G+   ++E Y      W    ++ + +  VGV  +   +Y +GG DG+  L+ +++F+  T KW   A+MN  R  +  A + +  IY  GG D +   ++ E Y    + W  +  M   R   G V L + +YA+GG+NG     +VE ++P +  W+ +  M  RR   GV VLN+ +Y  GG+D    L+SVE +     +W  +A +  PR  + + +  G+IFA+GG +GS  L T E ++  + +W  +  +     G G AI A S
Sbjct:  142 VGACSTYMQRNLDASNCLGVRAFAEMHNLKKLMSAADDFTRENFGAVAVAEEFLDVSPSHLVALLSSCDLSVVGEVQVYEATMRWLRRNSQHHERWLPTIAEQVRFPLLPLDFLMRTAFREELLKRNIRCRDLLDEAKNFHLHMQHQDELTEFEFSVRTTPRKSAAGEGVLFCVGGRGSMGDPFRSIECYDLQTGSWFLAAEMNSRRRHVGVISVGGKVYAVGGHDGNEHLTSMEMFDPLTNKWIPRASMNTKRRGIALAALASGPIYAIGGLDDSACFQTVERYDVAADSWSTVHCMNLPRGGVGAVALGRYIYAVGGNNGQTSLATVERYDPPLDKWEEVKGMKQRRAGAGVTVLNRCLYVVGGFDDNAPLNSVEKYDPQKDRWEEVADLTTPRGGVGVATLIGKIFAVGGHNGSTYLNTVEAYDPLTNKWEAVGSISQCRAGAGVAICACS 595          

HSP 2 Score: 117.087 bits (292), Expect = 1.027e-27
Identity = 61/191 (31.94%), Postives = 95/191 (49.74%), Query Frame = 2
Query:  983 GFIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSI 1555
            G I+ IGG   +     +E Y      W ++  +   +  VG   L  YIY +GG +G   L+ V+ ++    KW  V  M   R+  G T++N  +YV GG+D    L S E+Y P+ +RW  +  +   R   GV  L  K++A+GGHNG    N+VE ++P+   W+ +  +   R   GVA+   SI
Sbjct:  406 GPIYAIGGLDDSACFQTVERYDVAADSWSTVHCMNLPRGGVGAVALGRYIYAVGGNNGQTSLATVERYDPPLDKWEEVKGMKQRRAGAGVTVLNRCLYVVGGFDDNAPLNSVEKYDPQKDRWEEVADLTTPRGGVGVATLIGKIFAVGGHNGSTYLNTVEAYDPLTNKWEAVGSISQCRAGAGVAICACSI 596          
BLAST of Kelch-like protein diablo vs. Ensembl Sea Lamprey
Match: klhl20 (kelch-like family member 20 [Source:ZFIN;Acc:ZDB-GENE-040426-1935])

HSP 1 Score: 231.106 bits (588), Expect = 8.122e-68
Identity = 139/466 (29.83%), Postives = 236/466 (50.64%), Query Frame = 2
Query:  500 CPSFYRRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQC--RNVLDATKDFLILPQQMRNLEPHNFRPRY---LQNSLYGFIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSS-VANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNS------VECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQW-----LEMSRLLNHDGGVGCAIVAFSDAHL 1846
            C    R++     L +R FA +  C DLL  AD +  +NF  ++   EF  L    L++II  DEL V +EE V+ AVI W++Y I ER+  L  +++ +R P ++P++L+ TV ++ ++++   C  R+++D  K++L+LPQ+   ++    +PR        L+     +GG        ++E Y P   +W  +  +   +  VGVAVLD  +Y +GG DGS  L+ V+ ++ KT +WSS VA  +  R+++G  ++   +Y  GG DG   L   E Y PK N+W  +  M   R    V  L   LYA+GG +G +  N+      +    P++ CW  + P+++   R     L  ++ A         + +VE +S   +++  I     P + + L    G++ A+GGFDG+  LKT E ++A +  W     +   RL    GGVG   +   ++H+
Sbjct:  151 CEFLKRQLDPSNCLGIRAFADTHACRDLLRTADKFTQHNFQEVMESEEFMLLPANQLIDIISSDELNVRSEEQVYSAVIAWVKYNIQERRPQLPQVLQHVRLPLLTPKFLVGTVGTDLLVKSDEACSSRDLVDEAKNYLLLPQERPLMQGPRTKPRKPIRCGEVLFADHGAVGGWCSGDAISSVERYDPQTNEWRMVASMSKRRCGVGVAVLDDLLYAVGGHDGSSYLNSVERYDPKTNQWSSDVAPTSTCRTSVGVAVLAGFLYAVGGQDGVSCLNIVERYDPKENKWSRVASMSTRRLGVAVAVLGGHLYAVGGSDGTSPLNTGLSLVPIWLAQPMLSCWRSLFPLVSPHPRAREGTLRMAVCAR--------VRAVERYSPADNRFLTILKTTAPHT-VGLAVVNGQLMAVGGFDGTTYLKTIEVYDAEANTWRLYGGMNYRRL---GGGVGVVKMTQCESHI 604          
BLAST of Kelch-like protein diablo vs. Ensembl Sea Lamprey
Match: klhl2 (kelch-like family member 2 [Source:ZFIN;Acc:ZDB-GENE-090312-193])

HSP 1 Score: 228.794 bits (582), Expect = 8.946e-68
Identity = 134/396 (33.84%), Postives = 208/396 (52.53%), Query Frame = 2
Query:  500 CPSFYRRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVL-DATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTR------VGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAID--NSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPR 1660
            C     ++     L +RTFA    C DLL  A+ Y   +F  ++   EF  LS E + ++I  D L V +EE VFEAV+ W+ +   +R+  +A L++ +R P +S EYL+E V    +++N+  C++ L +A K  L+  +Q   ++    RPR     L   + V+GG      + ++E Y     +W  + +L + + R       GV VL+  +Y +GGF+GS R+  VDV++     W +  NM   RS LGA ++N  +Y  GG+DG+  L + E Y  K N W  +  M   RS+ GV  +   LYA+GG++G +     SVE FNP+   W  +  M  RR   GV VL+  ++A GG+DG     SVEVF+  T+ W  +A M + R
Sbjct:  110 CEFLQSQLHPSNCLGIRTFADIHACSDLLQHANTYAEQHFSDVVQAEEFLSLSVEQVCDLIASDRLMVPSEEKVFEAVLAWVNHNREKRQELMASLLENVRLPLLSREYLVERVEEESLVKNNSTCKDFLIEAMKYHLLSSEQRALMKSDRTRPR-TPVGLPKMMIVVGGQAPKAIR-SVECYDLKEERWFQVGELPSRRCRAAVHADAGVVVLNGMVYAVGGFNGSLRVRTVDVYDAAKDVWLAAPNMQDRRSTLGAAVLNGVLYAVGGFDGSTGLATVEAYNYKTNEWVHVASMNTRRSSVGVGVVGGILYAVGGYDGASRQCLGSVEAFNPISNEWTYVKEMSIRRSGAGVGVLDGLLFAVGGHDGPLVRKSVEVFNPPTNSWRQVADMNMCR 503          

HSP 2 Score: 105.145 bits (261), Expect = 3.365e-24
Identity = 63/194 (32.47%), Postives = 100/194 (51.55%), Query Frame = 2
Query: 1268 KIYVCGGYDGTIALKSCEEYCPKLNRWRVIP--PMLECRSA----TGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGN--LKTTECFNARSQQWLEMSRLLNHDGGVGCAIV 1825
            K+ +  G     A++S E Y  K  RW  +   P   CR+A     GVV L+  +YA+GG NG     +V+ ++     W     M +RR   G AVLN  +YA GG+DG   L++VE ++  T++W ++ASM   RS + +    G ++A+GG+DG+    L + E FN  S +W  +  +     G G  ++
Sbjct:  271 KMMIVVGGQAPKAIRSVECYDLKEERWFQVGELPSRRCRAAVHADAGVVVLNGMVYAVGGFNGSLRVRTVDVYDAAKDVWLAAPNMQDRRSTLGAAVLNGVLYAVGGFDGSTGLATVEAYNYKTNEWVHVASMNTRRSSVGVGVVGGILYAVGGYDGASRQCLGSVEAFNPISNEWTYVKEMSIRRSGAGVGVL 464          

HSP 3 Score: 83.5741 bits (205), Expect = 3.204e-17
Identity = 53/179 (29.61%), Postives = 88/179 (49.16%), Query Frame = 2
Query:  866 SLQCR--NVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRR--LSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATG 1390
            SL+ R  +V DA KD  +    M++      R       L G ++ +GG   +     +E Y+    +W  +  + T ++ VGV V+   +Y +GG+DG+ R  L  V+ FN  + +W+ V  M+  RS  G  +++  ++  GG+DG +  KS E + P  N WR +  M  CR   G
Sbjct:  334 SLRVRTVDVYDAAKDVWLAAPNMQDR-----RSTLGAAVLNGVLYAVGGFDGSTGLATVEAYNYKTNEWVHVASMNTRRSSVGVGVVGGILYAVGGYDGASRQCLGSVEAFNPISNEWTYVKEMSIRRSGAGVGVLDGLLFAVGGHDGPLVRKSVEVFNPPTNSWRQVADMNMCRRNAG 507          
BLAST of Kelch-like protein diablo vs. Ensembl Nematostella
Match: EDO49374 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG74])

HSP 1 Score: 376.326 bits (965), Expect = 2.763e-123
Identity = 181/440 (41.14%), Postives = 273/440 (62.05%), Query Frame = 2
Query:  509 FYRRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQV-NMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIV 1825
             +R +     L +R+FA +  C DL+ AAD++   NF  +    EF  L+ ++++ +I  +EL V  EE VFEAV+ W++  + ER+ +L++L+K +R P + P++L + + +  +++NSL CR+++D  KDFL+LP++   L+    +PR    +  G I+ IGG   +G  + ++E +  +  QW     + T +TRVGVAVLD+ +Y +GGFDG +RLS V+ +N    KW   A MN  RSALGA  +N KIYV GGYDG I+L + E Y    N W  + PM   RSA GV  L+ KL+ IGGHNGL+I +SVE ++P    W     +L RRCR GVA LN  IY  GGYDG +FL++VE +   T QW+++A M   RSR+++++    ++AIGG+DG  NL T ECF+ R+ +W  +S +  H GGVG  ++
Sbjct:  125 LHRALHPANCLGIRSFADTFCCGDLVQAADVFALKNFSEVSQSEEFQALAPDEVVALISSEELNVRAEEEVFEAVMFWLKKDLDERRDFLSELLKHVRLPLVRPQFLCDRIATEDLVRNSLACRDLIDEAKDFLLLPERRSKLQSSRTKPRKCSEA-AGLIYAIGGLNSSGEALCSVETFDMLSCQWSPTSPMNTLRTRVGVAVLDNRLYALGGFDGHKRLSTVEFYNPVLDKWIPAAPMNTRRSALGAATVNGKIYVVGGYDGHISLSTMECYSATANSWSFLAPMSTLRSAAGVTELNGKLFVIGGHNGLSIFSSVEVYDPQTDKWGPGASLLMRRCRVGVATLNSCIYVCGGYDGSSFLNTVECYDPQTQQWSFVAPMNTRRSRVAVVALGNCLYAIGGYDGLTNLNTVECFDPRANRWSFVSPMCKHQGGVGAGVL 563          
BLAST of Kelch-like protein diablo vs. Ensembl Nematostella
Match: EDO47170 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMV8])

HSP 1 Score: 293.508 bits (750), Expect = 1.875e-91
Identity = 157/450 (34.89%), Postives = 248/450 (55.11%), Query Frame = 2
Query:  500 CPSFYRRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSS-VANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNH---DGGVGCAIVAFSD 1837
            C    R++     L +R FA +  C DLL  AD++  +NF  ++   EF  L F  L++I+  DEL V +EE VF AV+ W++Y ++ER+ YL+ +++ +R P + P++L+  V ++ +I++   CR+++D  K++L+LP+Q   ++    RPR         IF +GG        ++E Y P   +W  +  +   +  VGV VLD+ +Y +GG DGS  L+ V+ ++ KT +WSS VA  +  R+++G  +++  +Y  GG DG   L   E+Y P  NRW  + PM   R   GV  +   LYAIGG +G +  N+VE ++P    W  +  M  RR   G AV    +Y  GG D    LSS E +   T+QW+ + +M   RS + L    G++ A+GGFDG+  LKT E F+  + QW +MS  +N+    GGVG   +  SD
Sbjct:  116 CEFLKRQLDPSNCLGIRAFADTHSCRDLLRVADLFTQHNFQEVMESEEFLLLPFAQLVDILSSDELNVRSEEQVFYAVMNWMKYNVTERRAYLSHILQHVRLPLLGPKFLVGVVGTDGLIKSDETCRDLVDEAKNYLLLPEQRLLMQGPRTRPRK-PTKCTEVIFAVGGWCSGDAISSVERYDPQTSEWKMVATMMKRRCGVGVTVLDNLLYAVGGHDGSSYLNSVERYDPKTNQWSSEVAPTSTCRTSVGVAVLDGFMYAVGGQDGVSCLNIVEKYDPSENRWARVAPMSTRRLGVGVAVVDSFLYAIGGSDGTSPLNTVERYDPSCNKWVSVASMGTRRKHLGAAVFQDKLYVVGGRDDATELSSAERYDPKTNQWSPVVAMNSRRSGVGLAVVNGQLLAVGGFDGTTYLKTIEVFDTLTNQW-KMSGGMNYRRLGGGVGVVRLPLSD 563          
BLAST of Kelch-like protein diablo vs. Ensembl Nematostella
Match: EDO46542 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPP2])

HSP 1 Score: 290.041 bits (741), Expect = 7.084e-90
Identity = 158/427 (37.00%), Postives = 236/427 (55.27%), Query Frame = 2
Query:  500 CPSFYRRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVL-DATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAID--NSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQW 1771
            C     ++     L +R FA    C DLL    I+   +F  ++  +EF  L F  + E+I  D+L V +EE VFEAV+RW+ +    R   LA LM+ +R P +S EYL+  V +  +I+NS+ C++ L +A K  L+  +Q   L+    RPR     +   +FV+GG      + ++E Y     +W  + ++ + + R GV+VLD  +Y +GGF+GS R+  VD ++    +W   A+M   RS LGA ++N  +Y  GG+DGT  L +CE Y PKLN WR I PM   RS+ GV  L+  LYA+GG++G +    +SVEC++P    W L+  M  RR   GV V    +YA GG+DG +   SVE F+V  + W  +A M + R    + S  G +F +GG DGS NL + E +N R+ QW
Sbjct:  131 CDFLKAQLHPSNCLGIRAFADMHSCPDLLRTGHIFAEQHFSEVVQGDEFLGLPFMQVAELISSDQLTVPSEEKVFEAVVRWVGHDPEHRHECLALLMEHVRLPLLSREYLVSRVETELMIKNSVACKDFLIEALKYHLLTSEQRSLLQTPRTRPR-TPIGMPKVMFVVGGQAPKAIR-SVECYDFKGERWYPVAEMNSRRCRAGVSVLDGLVYAVGGFNGSLRVRTVDCYDPIKDQWRPAASMEARRSTLGAAVLNGLLYAIGGFDGTTGLNTCEVYDPKLNEWRPIAPMSTRRSSVGVGVLNGLLYAVGGYDGGSRHCLSSVECYSPANNEWTLVPEMSTRRSGAGVGVAYGVLYAIGGHDGPHVRKSVECFNVDLNTWKPVAEMSMCRRNAGVASVNGLLFVVGGDDGSTNLASVEVYNPRTDQW 555          

HSP 2 Score: 89.7373 bits (221), Expect = 7.392e-19
Identity = 45/144 (31.25%), Postives = 79/144 (54.86%), Query Frame = 2
Query: 1394 VHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIV 1825
            + + + ++ +GG    AI  SVEC++   + W  +  M +RRCR GV+VL+  +YA GG++G   + +V+ +     QW   ASM+  RS +      G ++AIGGFDG+  L T E ++ +  +W  ++ +      VG  ++
Sbjct:  288 IGMPKVMFVVGGQAPKAI-RSVECYDFKGERWYPVAEMNSRRCRAGVSVLDGLVYAVGGFNGSLRVRTVDCYDPIKDQWRPAASMEARRSTLGAAVLNGLLYAIGGFDGTTGLNTCEVYDPKLNEWRPIAPMSTRRSSVGVGVL 430          
BLAST of Kelch-like protein diablo vs. Ensembl Nematostella
Match: EDO49628 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFM5])

HSP 1 Score: 266.929 bits (681), Expect = 4.476e-81
Identity = 149/443 (33.63%), Postives = 229/443 (51.69%), Query Frame = 2
Query:  500 CPSFYRRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVN-MEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQW---LEMSRLLNHDGGVGC 1816
            C    R +     L +R +A+   C + +H AD +    F ++++ + F  LS + L EI+  D+L V  EEIVFEA+++W+E+   +R  ++ADL+ Q+R P +  +YL+  V  N ++ +++ CRN +D  K+F + P    N+     +PR    S  G +F +GG  + G     +E Y      W    +L T +  V VA L+  +Y IGG DG + L+ V+ F+ +   W+ VA M   R  + A ++   IYV GG D     ++ E Y P+ + W ++  ML  R   GV  L   LYA+GG++G     SVE +NP    W  +  M  RR   GVAV+ Q +YA GG+D  N L SVE +   T+QW+YIASM   R  +   S    I+A+GG +G+  L + E +N     W    +MS      G  GC
Sbjct:  124 CEFMKRHLHVSNCLEMRAYAELHGCIEFIHFADKFARGCFTTLVSNDMFLKLSPKHLAEIVSGDDLNVKAEEIVFEAILKWVEHDPEKRSEHIADLISQVRLPLLPTDYLINRVEQNSLLSSNMACRNFIDEAKNFKLCPV---NVSSFRTQPR---KSTAGTLFSVGGRGKTGEPFQCIECYDWFSDSWFMTARLSTPRRHVAVASLNGRVYAIGGHDGIQHLNSVECFDPENNTWTDVAPMRTYRRGMSAGVLQGVIYVAGGLDEATCFETVERYDPETDEWSIVSSMLHRRGGVGVAGLEGYLYAVGGNDGTVSLQSVERYNPHTGRWTRVASMNRRRAGVGVAVVGQYLYAIGGFDDSNPLDSVERYDPKTNQWSYIASMSTCRGGVGAGSMGERIWAVGGHNGTQYLGSMESYNPAKDVWEASAQMSTPRAGSGVTGC 560          

HSP 2 Score: 102.834 bits (255), Expect = 5.656e-23
Identity = 52/163 (31.90%), Postives = 84/163 (51.53%), Query Frame = 2
Query: 1340 NRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIVA 1828
            + W +   +   R    V  L+ ++YAIGGH+G+   NSVECF+P    W  + PM   R      VL   IY AGG D      +VE +   T +W+ ++SM   R  + +    G ++A+GG DG+ +L++ E +N  + +W  ++ +     GVG A+V 
Sbjct:  305 DSWFMTARLSTPRRHVAVASLNGRVYAIGGHDGIQHLNSVECFDPENNTWTDVAPMRTYRRGMSAGVLQGVIYVAGGLDEATCFETVERYDPETDEWSIVSSMLHRRGGVGVAGLEGYLYAVGGNDGTVSLQSVERYNPHTGRWTRVASMNRRRAGVGVAVVG 467          

HSP 3 Score: 79.337 bits (194), Expect = 1.799e-15
Identity = 49/171 (28.65%), Postives = 82/171 (47.95%), Query Frame = 2
Query: 1313 SCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAID-NSVECFNPVMKCWDLITPMLNRRCRH-GVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCA 1819
            +C  +  +   +++ P  +           +  L+++GG          +EC++     W  +T  L+   RH  VA LN  +YA GG+DG+  L+SVE F    + WT +A M+  R  MS     G I+  GG D +   +T E ++  + +W  +S +L+  GGVG A
Sbjct:  248 ACRNFIDEAKNFKLCPVNVSSFRTQPRKSTAGTLFSVGGRGKTGEPFQCIECYDWFSDSW-FMTARLSTPRRHVAVASLNGRVYAIGGHDGIQHLNSVECFDPENNTWTDVAPMRTYRRGMSAGVLQGVIYVAGGLDEATCFETVERYDPETDEWSIVSSMLHRRGGVGVA 417          

HSP 4 Score: 48.521 bits (114), Expect = 7.152e-6
Identity = 19/76 (25.00%), Postives = 40/76 (52.63%), Query Frame = 2
Query: 1598 VEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIV 1825
            +E +   +  W   A +  PR  +++ S  G ++AIGG DG  +L + ECF+  +  W +++ +  +  G+   ++
Sbjct:  297 IECYDWFSDSWFMTARLSTPRRHVAVASLNGRVYAIGGHDGIQHLNSVECFDPENNTWTDVAPMRTYRRGMSAGVL 372          
BLAST of Kelch-like protein diablo vs. Ensembl Nematostella
Match: EDO38065 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDY1])

HSP 1 Score: 258.07 bits (658), Expect = 3.603e-78
Identity = 137/444 (30.86%), Postives = 232/444 (52.25%), Query Frame = 2
Query:  500 CPSFYRRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVN--MEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIV 1825
            C     ++     L +R F +S  C   L   D Y+  NF  ++   E+  L  E L+++I  D+L +I EE VFEAV+ WI + ++ R   L  L++ +R P IS  YLL  + ++ +I+++L CR++LD  K++ +LP Q         RPR    S+ G +F IGG  + G  ++   E Y      W S   L   + ++GV  + + +Y +GG +G  RLS V++F  ++ KW+   ++N +RS +G  ++ + +Y  GGYDG   LK+ E Y P+++ W  +      RS  GV  L  +L+ IGG++G +  NSVEC++P+   W  +  M   R   G   ++  ++A GG+DG+  L  VE+F    + WT ++ +K  R  + + +    I+A+GG DG   L T E ++ ++  W  M  +       G  ++
Sbjct:  102 CQFLESQLDPSNCLGIRKFTESHGCCKFLEVIDKYVLENFKQVMKSEEYALLPSELLVKVISSDDLNIIEEEEVFEAVMNWIRHDLNTRVAKLPSLIRYVRMPLISKHYLLNRIDTDSLIRSNLTCRDLLDEAKNYHLLPDQRARFRSDRMRPR---KSMMGTMFAIGGK-EAGETISNTTECYSLQTNTWQSSAPLIVPRQQLGVGNIGNRLYAVGGSNGYTRLSTVEMFTPESNKWTYCKSLNTSRSGVGLGVLGETLYALGGYDGRTCLKTVERYDPQVDCWSSVASTTVTRSFPGVAELGGRLFVIGGNDGASFLNSVECYDPLSNKWTTLPSMCRPRAGIGAGAIDGLLFAIGGFDGMLRLDIVEMFESRMNTWTQVSPLKSCRDGVCVAAYGCWIYAVGGIDGPSYLNTVEAYDPKTDLWETMPSMSRCRAAAGVVVL 541          
BLAST of Kelch-like protein diablo vs. Ensembl Medaka
Match: klhl18 (kelch like family member 18 [Source:NCBI gene;Acc:101157249])

HSP 1 Score: 371.703 bits (953), Expect = 1.339e-119
Identity = 178/448 (39.73%), Postives = 274/448 (61.16%), Query Frame = 2
Query:  500 CPSFYRRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNM-EVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIVAFSDA 1840
            C     R+  +  L +R FA+++ C  L  +A+ Y++ +F+ +    EF  L  E++LE++  DEL V  EE VFEAV+ W+ +    R+  L +L+ +IR P   P++L + V  +++I+   +CR+++D  KDF ++PQ+  +L P   R R   +S+ G I+ +GG   +G+ +N+ EV+ P+   W     + T ++RVGVAV++  +Y IGG+DG  RLS V+V+N +   W  V++MN  RSA+G  +++  IYVCGGYDG  +L S E Y P+ +RW V+  M   RSA GV     +++  GGH+GL I N+VE +N    CW L  PMLN+RCRHG AVL   +Y AGGYDG  FLS  EV+S  + QW+ +  M   RSR+SL++T G +FA+GG+DG  NL + E +N  + +W  M+ + +H+GGVG   +    A
Sbjct:  240 CSFLQERLHPKNCLGVRQFAETMMCTTLYDSANSYLHQHFVDVSLSEEFLGLRTEEVLELVGCDELNVKAEEQVFEAVLTWVYHDRERRESLLPELLSKIRLPLCRPQFLSDRVQQDELIRCCHKCRDLVDEAKDFHLMPQRRPHLPPFKTRQRSC-SSITGLIYAVGGLNSSGDSLNLVEVFDPLGNFWERCQPMRTARSRVGVAVVNGLLYAIGGYDGQSRLSTVEVYNPEADSWMQVSSMNSQRSAMGTVVVDGHIYVCGGYDGKSSLNSVECYSPETDRWVVVTEMSASRSAAGVTVFEGRIFVSGGHDGLQIFNTVEYYNHHTNCWHLAPPMLNKRCRHGAAVLGSHMYVAGGYDGSGFLSGAEVYSSASGQWSLLVPMNTRRSRVSLVATGGRLFAVGGYDGQSNLSSVEMYNPDTNRWTFMAAMASHEGGVGVGCIPLPPA 686          
BLAST of Kelch-like protein diablo vs. Ensembl Medaka
Match: KLHL12 (kelch like family member 12 [Source:NCBI gene;Acc:101171491])

HSP 1 Score: 284.263 bits (726), Expect = 3.743e-87
Identity = 149/443 (33.63%), Postives = 244/443 (55.08%), Query Frame = 2
Query:  500 CPSFYRRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNM-EVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMK---WSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNH--DGGV 1810
            C     ++     L +R FA++  C DL+ AA+++   +F  ++   EF  LS  ++ ++I  DE+QV +EE VFEAV+ W+++   ER+ YL D+++ +R P ++P Y+ + + +  +I+ SL CR+++D  K F + P+    ++    + R     +   + VIGG     + +++ E Y P  ++W  L  +   +  V    L   +YVIGG+DG  RLS V+  +    +   W +VA MN  R   GAT + D IYV GG+DG+    S E Y P +++W ++  M   R   G+V  S  +Y +GG++GL I NSVE ++P    W  +TPM  +R   GVA+LN  IY  GG+DG++ L SVEV+++ T  WT +ASM  PR  +      G ++AI G+DG+  L + EC++     W  ++ +     D GV
Sbjct:  153 CDFLESQLDPSNCLGIRDFAETHNCLDLMQAAELFSQKHFSEVVQHEEFMLLSQTEVEKLIKCDEIQVDSEEPVFEAVLNWVKHNRKEREPYLPDMLEFVRMPLLTPRYITDVIDAEPLIRCSLPCRDLVDEAKKFHLRPELRSEMQGPRTQARLGAKEV---LLVIGGFGSQQSPIDIVEKYDPKTQEWSFLPNIARKRRYVATVSLHDRVYVIGGYDGRSRLSSVECLDYTADEDGVWYTVATMNVRRGLAGATTLGDMIYVAGGFDGSRRHTSMERYDPNIDQWSMLGDMQTAREGAGLVVASGLIYCLGGYDGLNILNSVERYDPHTGHWTSVTPMATKRSGAGVALLNDHIYVVGGFDGISHLDSVEVYNIRTDYWTTVASMTTPRCYVGATVLRGRLYAIAGYDGNSLLSSIECYDPVVDSWEVVTSMATQRCDAGV 592          

HSP 2 Score: 139.428 bits (350), Expect = 1.926e-34
Identity = 69/193 (35.75%), Postives = 105/193 (54.40%), Query Frame = 2
Query:  971 NSLYGFIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQ 1549
             +L   I+V GG   +    +ME Y P + QW  L  + T +   G+ V    IY +GG+DG   L+ V+ ++  T  W+SV  M   RS  G  ++ND IYV GG+DG   L S E Y  + + W  +  M   R   G   L  +LYAI G++G ++ +S+EC++PV+  W+++T M  +RC  GV VL +
Sbjct:  405 TTLGDMIYVAGGFDGSRRHTSMERYDPNIDQWSMLGDMQTAREGAGLVVASGLIYCLGGYDGLNILNSVERYDPHTGHWTSVTPMATKRSGAGVALLNDHIYVVGGFDGISHLDSVEVYNIRTDYWTTVASMTTPRCYVGATVLRGRLYAIAGYDGNSLLSSIECYDPVVDSWEVVTSMATQRCDAGVCVLRE 597          

HSP 3 Score: 105.916 bits (263), Expect = 1.630e-23
Identity = 55/144 (38.19%), Postives = 83/144 (57.64%), Query Frame = 2
Query:  983 GFIFVIGGSFQNGNQVN-MEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQK 1411
            G I+ +GG +   N +N +E Y P    W S+  + T ++  GVA+L+ +IYV+GGFDG   L  V+V+N +T  W++VA+M   R  +GAT++  ++Y   GYDG   L S E Y P ++ W V+  M   R   GV  L +K
Sbjct:  456 GLIYCLGG-YDGLNILNSVERYDPHTGHWTSVTPMATKRSGAGVALLNDHIYVVGGFDGISHLDSVEVYNIRTDYWTTVASMTTPRCYVGATVLRGRLYAIAGYDGNSLLSSIECYDPVVDSWEVVTSMATQRCDAGVCVLREK 598          

HSP 4 Score: 62.3882 bits (150), Expect = 1.029e-9
Identity = 40/129 (31.01%), Postives = 65/129 (50.39%), Query Frame = 2
Query: 1457 VECFNPVMKCWDLITPMLNRRCRHGVAV-LNQSIYAAGGYDGVNFLSSVEVFSVTTSQ---WTYIASMKVPRSRMSLISTFGE-IFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIVA 1828
            VE ++P  + W  + P + R+ R+   V L+  +Y  GGYDG + LSSVE    T  +   W  +A+M V R  ++  +T G+ I+  GGFDGS    + E ++    QW  +  +     G G  + +
Sbjct:  329 VEKYDPKTQEWSFL-PNIARKRRYVATVSLHDRVYVIGGYDGRSRLSSVECLDYTADEDGVWYTVATMNVRRG-LAGATTLGDMIYVAGGFDGSRRHTSMERYDPNIDQWSMLGDMQTAREGAGLVVAS 455          
BLAST of Kelch-like protein diablo vs. Ensembl Medaka
Match: klhl20 (kelch like family member 20 [Source:NCBI gene;Acc:101170463])

HSP 1 Score: 283.878 bits (725), Expect = 7.312e-87
Identity = 155/455 (34.07%), Postives = 246/455 (54.07%), Query Frame = 2
Query:  500 CPSFYRRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSS-VANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQW-----LEMSRLLNHDGGVGCAIVAFSDAHL 1846
            C    R++     L +R FA +  C +LL  AD +  +NF  ++   EF  L    L++II  DEL V +EE VF AV+ W++Y+I ER+  L  +++ +R P +SP++L+ TV S+ +I++  +CR+++D  K++L+LPQ+   ++    RPR         +F +GG        ++E Y P   +W  +  +   +  VGV+VLD  +Y +GG DGS  L+ V+ ++ KT +WSS VA  +  R+++G  ++   +Y  GG DG   L   E Y PK N+W  +  M   R    V  L   LYA+GG +G +  N+VE +NP    W  ++PM  RR   G AV    IY+ GG D    LSS E ++  T+QW+ + +M   RS + L    G++ A+GGFDG+  LKT E ++  +  W     +   RL    GGVG   +   ++H+
Sbjct:  158 CEFLKRQLDPSNCLGIRAFADTHSCRELLRIADKFTQHNFQEVMESEEFMLLPANQLIDIISSDELNVRSEEQVFNAVMAWVKYSIQERRPQLPQVLQHVRLPLLSPKFLVGTVGSDPLIKSDEECRDLVDEAKNYLLLPQERPLMQGPRTRPRK-PIRCGEVLFAVGGWCSGDAISSVERYDPQTNEWRMVASMSKRRCGVGVSVLDDLLYAVGGHDGSSYLNSVERYDPKTNQWSSDVAPTSTCRTSVGVAVLGGYLYAVGGQDGVSCLNIVERYDPKENKWTRVASMSTRRLGVAVAVLGGFLYAVGGSDGTSPLNTVERYNPQENRWHTVSPMGTRRKHLGCAVYQDMIYSVGGRDDTTELSSAERYNPRTNQWSPVVAMTSRRSGVGLAVVNGQLMAVGGFDGTTYLKTIEVYDPDANTWRLYGGMNYRRL---GGGVGVIKMTHCESHI 608          
BLAST of Kelch-like protein diablo vs. Ensembl Medaka
Match: KLHL12 (kelch like family member 12 [Source:NCBI gene;Acc:101171491])

HSP 1 Score: 266.929 bits (681), Expect = 3.984e-81
Identity = 146/445 (32.81%), Postives = 236/445 (53.03%), Query Frame = 2
Query:  500 CPSFYRRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNS---LYGFIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMK---WSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNH--DGGV 1810
            C     ++     L +R FA++  C DL+ AA+++   +F  ++   EF  LS  ++ ++I  DE+QV +EE VFEAV+ W+++   ER+ YL D+++ +R P ++P Y+ + + +  +I+ SL CR+++D  K F + P+    ++    + R   N    L G +  +    +NGN                   +   +  V    L   +YVIGG+DG  RLS V+  +    +   W +VA MN  R   GAT + D IYV GG+DG+    S E Y P +++W ++  M   R   G+V  S  +Y +GG++GL I NSVE ++P    W  +TPM  +R   GVA+LN  IY  GG+DG++ L SVEV+++ T  WT +ASM  PR  +      G ++AI G+DG+  L + EC++     W  ++ +     D GV
Sbjct:  119 CDFLESQLDPSNCLGIRDFAETHNCLDLMQAAELFSQKHFSEVVQHEEFMLLSQTEVEKLIKCDEIQVDSEEPVFEAVLNWVKHNRKEREPYLPDMLEFVRMPLLTPRYITDVIDAEPLIRCSLPCRDLVDEAKKFHLRPELRSEMQGPRTQARLGWNPSCWLLGGLRNMIPKLKNGN-------------------IARKRRYVATVSLHDRVYVIGGYDGRSRLSSVECLDYTADEDGVWYTVATMNVRRGLAGATTLGDMIYVAGGFDGSRRHTSMERYDPNIDQWSMLGDMQTAREGAGLVVASGLIYCLGGYDGLNILNSVERYDPHTGHWTSVTPMATKRSGAGVALLNDHIYVVGGFDGISHLDSVEVYNIRTDYWTTVASMTTPRCYVGATVLRGRLYAIAGYDGNSLLSSIECYDPVVDSWEVVTSMATQRCDAGV 544          

HSP 2 Score: 138.658 bits (348), Expect = 1.880e-34
Identity = 69/193 (35.75%), Postives = 105/193 (54.40%), Query Frame = 2
Query:  971 NSLYGFIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQ 1549
             +L   I+V GG   +    +ME Y P + QW  L  + T +   G+ V    IY +GG+DG   L+ V+ ++  T  W+SV  M   RS  G  ++ND IYV GG+DG   L S E Y  + + W  +  M   R   G   L  +LYAI G++G ++ +S+EC++PV+  W+++T M  +RC  GV VL +
Sbjct:  357 TTLGDMIYVAGGFDGSRRHTSMERYDPNIDQWSMLGDMQTAREGAGLVVASGLIYCLGGYDGLNILNSVERYDPHTGHWTSVTPMATKRSGAGVALLNDHIYVVGGFDGISHLDSVEVYNIRTDYWTTVASMTTPRCYVGATVLRGRLYAIAGYDGNSLLSSIECYDPVVDSWEVVTSMATQRCDAGVCVLRE 549          

HSP 3 Score: 108.227 bits (269), Expect = 2.174e-24
Identity = 62/206 (30.10%), Postives = 97/206 (47.09%), Query Frame = 2
Query: 1217 ANMNCNRSALGATMMNDKIYVCGGYDGTIALKS--CEEYCPKLNR-WRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIV 1825
             N+   R  +    ++D++YV GGYDG   L S  C +Y    +  W  +  M   R   G   L   +Y  GG +G     S+E ++P +  W ++  M   R   G+ V +  IY  GGYDG+N L+SVE +   T  WT +  M   RS   +      I+ +GGFDG  +L + E +N R+  W  ++ +      VG  ++
Sbjct:  295 GNIARKRRYVATVSLHDRVYVIGGYDGRSRLSSVECLDYTADEDGVWYTVATMNVRRGLAGATTLGDMIYVAGGFDGSRRHTSMERYDPNIDQWSMLGDMQTAREGAGLVVASGLIYCLGGYDGLNILNSVERYDPHTGHWTSVTPMATKRSGAGVALLNDHIYVVGGFDGISHLDSVEVYNIRTDYWTTVASMTTPRCYVGATVL 500          

HSP 4 Score: 105.531 bits (262), Expect = 1.563e-23
Identity = 55/144 (38.19%), Postives = 83/144 (57.64%), Query Frame = 2
Query:  983 GFIFVIGGSFQNGNQVN-MEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQK 1411
            G I+ +GG +   N +N +E Y P    W S+  + T ++  GVA+L+ +IYV+GGFDG   L  V+V+N +T  W++VA+M   R  +GAT++  ++Y   GYDG   L S E Y P ++ W V+  M   R   GV  L +K
Sbjct:  408 GLIYCLGG-YDGLNILNSVERYDPHTGHWTSVTPMATKRSGAGVALLNDHIYVVGGFDGISHLDSVEVYNIRTDYWTTVASMTTPRCYVGATVLRGRLYAIAGYDGNSLLSSIECYDPVVDSWEVVTSMATQRCDAGVCVLREK 550          

HSP 5 Score: 54.6842 bits (130), Expect = 2.515e-7
Identity = 42/136 (30.88%), Postives = 64/136 (47.06%), Query Frame = 2
Query: 1466 FNPVMKCWDL-----ITPMLN-----RRCRHGVAV-LNQSIYAAGGYDGVNFLSSVEVFSVTTSQ---WTYIASMKVPRSRMSLISTFGE-IFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIVA 1828
            +NP   CW L     + P L      R+ R+   V L+  +Y  GGYDG + LSSVE    T  +   W  +A+M V R  ++  +T G+ I+  GGFDGS    + E ++    QW  +  +     G G  + +
Sbjct:  275 WNP--SCWLLGGLRNMIPKLKNGNIARKRRYVATVSLHDRVYVIGGYDGRSRLSSVECLDYTADEDGVWYTVATMNVRRG-LAGATTLGDMIYVAGGFDGSRRHTSMERYDPNIDQWSMLGDMQTAREGAGLVVAS 407          
BLAST of Kelch-like protein diablo vs. Ensembl Medaka
Match: klhl17 (kelch like family member 17 [Source:NCBI gene;Acc:101175399])

HSP 1 Score: 268.085 bits (684), Expect = 4.943e-81
Identity = 139/444 (31.31%), Postives = 235/444 (52.93%), Query Frame = 2
Query:  500 CPSFYRRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIVAF 1831
            C     ++     L +R FA +  C DLL +A  Y+  +F+ +    EF  L  + +L++I  D L V +EE V+ AV+ W+++ I  R+ ++  LMK +R P +  ++L+  V +  ++++  +C+++L     + ++P+Q   L     RPR  + +    +F +GG        + E Y     +W  +  + T + RVGVA + + +Y +GG+DG+  L+ V+ ++  T  W    +M   RS LG  +++  +Y  GGYDG   L S E Y P  + W  +  M   R    V  L   LYA+GG++  +   +VE ++P    W  I  ML+RR   GVAVL+  +Y AGG DG + L+SVE F+  T+ W  +A+M + RS   L++  G ++A+GG DGS +L + E +N RS +W+  S +      VG A++  
Sbjct:  131 CKFLLSQLDPSNCLGIRGFADTHSCSDLLKSAHKYVLQHFVEVSKTEEFMLLPLKQVLDLISSDNLNVPSEEEVYRAVLNWVKHDIDSRRQHVPWLMKCVRLPLLRRDFLMSNVDTELLVRHHSECKDLLIEALKYHLMPEQRGVLSNSRTRPRRCEGA-SPVLFAVGGGSLFAIHGDCEAYDTRTDRWHMVASMSTRRARVGVAAIGNRLYAVGGYDGTSDLATVESYDPITNSWQPEVSMGTRRSCLGVAVLHGLLYAAGGYDGASCLNSAERYDPLTSTWTSVAAMSTRRRYVRVATLDGSLYAVGGYDSSSHLATVEKYDPQSNTWTTIANMLSRRSSAGVAVLDGMLYVAGGNDGTSCLNSVERFNPKTNTWEGVAAMNIRRSTHDLVAMDGWLYAVGGNDGSSSLNSIEKYNPRSNKWVAASCMFTRRSSVGVAVLEL 573          
BLAST of Kelch-like protein diablo vs. Planmine SMEST
Match: SMESG000077860.1 (SMESG000077860.1)

HSP 1 Score: 946.806 bits (2446), Expect = 0.000e+0
Identity = 452/460 (98.26%), Postives = 454/460 (98.70%), Query Frame = 2
Query:  491 ISYCPSFYRRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIVAFSDAHLNILSMFKT 1870
            ++ C     RISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIVAFSDAHLNILSMFKT
Sbjct:   60 VACCEFMKNRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIVAFSDAHLNILSMFKT 519          
BLAST of Kelch-like protein diablo vs. Planmine SMEST
Match: SMESG000077860.1 (SMESG000077860.1)

HSP 1 Score: 946.421 bits (2445), Expect = 0.000e+0
Identity = 452/460 (98.26%), Postives = 454/460 (98.70%), Query Frame = 2
Query:  491 ISYCPSFYRRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIVAFSDAHLNILSMFKT 1870
            ++ C     RISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIVAFSDAHLNILSMFKT
Sbjct:  147 VACCEFMKNRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIVAFSDAHLNILSMFKT 606          
BLAST of Kelch-like protein diablo vs. Planmine SMEST
Match: SMESG000077860.1 (SMESG000077860.1)

HSP 1 Score: 946.036 bits (2444), Expect = 0.000e+0
Identity = 452/460 (98.26%), Postives = 454/460 (98.70%), Query Frame = 2
Query:  491 ISYCPSFYRRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIVAFSDAHLNILSMFKT 1870
            ++ C     RISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIVAFSDAHLNILSMFKT
Sbjct:   55 VACCEFMKNRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIVAFSDAHLNILSMFKT 514          
BLAST of Kelch-like protein diablo vs. Planmine SMEST
Match: SMESG000077860.1 (SMESG000077860.1)

HSP 1 Score: 946.036 bits (2444), Expect = 0.000e+0
Identity = 452/460 (98.26%), Postives = 454/460 (98.70%), Query Frame = 2
Query:  491 ISYCPSFYRRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIVAFSDAHLNILSMFKT 1870
            ++ C     RISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIVAFSDAHLNILSMFKT
Sbjct:   58 VACCEFMKNRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIVAFSDAHLNILSMFKT 517          
BLAST of Kelch-like protein diablo vs. Planmine SMEST
Match: SMESG000012968.1 (SMESG000012968.1)

HSP 1 Score: 233.032 bits (593), Expect = 1.168e-67
Identity = 141/446 (31.61%), Postives = 228/446 (51.12%), Query Frame = 2
Query:  500 CPSFYRRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILPQQMRNL-EPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAID--NSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCAIVA 1828
            C     ++     L +  FA    C +LL  +  Y   +F  I+N +EF +L  + L  +I  + L    EE VFEAV +WI++ ++ R  Y   L   +RFP +S E+L++    ++ I+ +  C++ L     F +L  + +N  E  +  PR +       + VIGG      + ++E Y     QW  + +L + + R G  +    IY+IGGF+GS R+  V+ ++    KW SV+ M   RS LG  +++  +Y  GG+DG   L S E Y P  + WR I  M   RS+ GV  L+  LY +GG++G+  +  +SVEC++P    W  IT M  +R    V  L+  +YA GG+DG N  ++VE +S  T +W+ +A M   R    +++  G ++ +GG DGS NL + E +N  +  W     LLN +  +G +  A
Sbjct:  188 CEFLQYQLHPSNCLGIHRFADLHSCKELLLYSKQYSETHFCEILNQDEFVNLPVDHLESLISSNNLSAKEEE-VFEAVRKWIKHNLNNRLQYTQKLFAHVRFPLLSKEFLVKLSKDDEFIKTNEACKDFLIYGLRFHLLSSEEKNRNESLHTTPR-IPAINPKILMVIGGQAPKAVK-SVEEYDFKTEQWRQVTELPSRRCRCGAVLNKGLIYIIGGFNGSLRVRTVETYDPIKDKWESVSQMEARRSTLGVAVLDGLVYAVGGFDGAQGLSSAEVYDPNTDTWRNIASMSLRRSSVGVAVLNGLLYVVGGYDGMDRECLSSVECYSPKKDTWTSITNMSCKRSGAAVGTLDGYLYAIGGHDGPNIRNTVERYSPETDKWSLVAKMNYNRRNAGVVTHNGTLYVVGGDDGSSNLSSIEYYNPLTNTWT----LLNSNMMIGRSYAA 626          
The following BLAST results are available for this feature:
BLAST of Kelch-like protein diablo vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KLHL183.816e-11438.34kelch like family member 18 [Source:HGNC Symbol;Ac... [more]
KLHL121.244e-8735.05kelch like family member 12 [Source:HGNC Symbol;Ac... [more]
KLHL202.145e-8734.73kelch like family member 20 [Source:HGNC Symbol;Ac... [more]
KLHL37.681e-8134.43kelch like family member 3 [Source:HGNC Symbol;Acc... [more]
KLHL177.954e-8131.67kelch like family member 17 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Kelch-like protein diablo vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kel-31.761e-9836.24KELch-repeat containing protein [Source:UniProtKB... [more]
kel-32.131e-9836.24KELch-repeat containing protein [Source:UniProtKB... [more]
kel-32.131e-9836.24KELch-repeat containing protein [Source:UniProtKB... [more]
kel-207.328e-7731.95KELch-repeat containing protein [Source:UniProtKB... [more]
kel-14.298e-6931.13KELch-repeat containing protein; Kel-1 protein [S... [more]
back to top
BLAST of Kelch-like protein diablo vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KLHL188.106e-12541.35gene:FBgn0037978 transcript:FBtr0082557[more]
KLHL183.650e-12441.35gene:FBgn0037978 transcript:FBtr0082556[more]
KLHL183.650e-12441.35gene:FBgn0037978 transcript:FBtr0335434[more]
dbo1.350e-8534.39gene:FBgn0040230 transcript:FBtr0332133[more]
dbo1.544e-8534.39gene:FBgn0040230 transcript:FBtr0075505[more]
back to top
BLAST of Kelch-like protein diablo vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
klhl187.127e-11737.50kelch-like family member 18 [Source:ZFIN;Acc:ZDB-G... [more]
klhl201.189e-8634.07kelch-like family member 20 [Source:ZFIN;Acc:ZDB-G... [more]
klhl177.706e-8131.31kelch-like family member 17 [Source:ZFIN;Acc:ZDB-G... [more]
klhl171.465e-8031.31kelch-like family member 17 [Source:ZFIN;Acc:ZDB-G... [more]
klhl171.465e-8031.31kelch-like family member 17 [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Kelch-like protein diablo vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
klhl185.846e-11637.56kelch like family member 18 [Source:NCBI gene;Acc:... [more]
klhl186.006e-11637.56kelch like family member 18 [Source:NCBI gene;Acc:... [more]
usb11.063e-8734.73U6 snRNA biogenesis phosphodiesterase 1 [Source:Xe... [more]
usb11.259e-8734.73U6 snRNA biogenesis phosphodiesterase 1 [Source:Xe... [more]
usb11.428e-8734.73U6 snRNA biogenesis phosphodiesterase 1 [Source:Xe... [more]
back to top
BLAST of Kelch-like protein diablo vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Klhl182.499e-11638.34kelch-like 18 [Source:MGI Symbol;Acc:MGI:2143315][more]
Klhl181.842e-11538.34kelch-like 18 [Source:MGI Symbol;Acc:MGI:2143315][more]
Klhl181.119e-11438.14kelch-like 18 [Source:MGI Symbol;Acc:MGI:2143315][more]
Klhl121.546e-8835.28kelch-like 12 [Source:MGI Symbol;Acc:MGI:2385619][more]
Klhl121.546e-8835.28kelch-like 12 [Source:MGI Symbol;Acc:MGI:2385619][more]
back to top
BLAST of Kelch-like protein diablo vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|E9Q4F2|KLH18_MOUSE1.289e-11438.34Kelch-like protein 18 OS=Mus musculus OX=10090 GN=... [more]
sp|O94889|KLH18_HUMAN1.833e-11338.34Kelch-like protein 18 OS=Homo sapiens OX=9606 GN=K... [more]
sp|Q5U374|KLH12_DANRE2.153e-8934.54Kelch-like protein 12 OS=Danio rerio OX=7955 GN=kl... [more]
sp|Q8R2H4|KLH12_RAT7.798e-8835.28Kelch-like protein 12 OS=Rattus norvegicus OX=1011... [more]
sp|Q8BZM0|KLH12_MOUSE1.082e-8735.28Kelch-like protein 12 OS=Mus musculus OX=10090 GN=... [more]
back to top
BLAST of Kelch-like protein diablo vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0L8FL822.893e-12942.66BTB domain-containing protein OS=Octopus bimaculoi... [more]
T1PJ055.173e-12942.12Kelch motif protein OS=Musca domestica OX=7370 GN=... [more]
A0A1I8PHH25.613e-12842.34BTB domain-containing protein OS=Stomoxys calcitra... [more]
A0A2B4RP721.223e-12643.69Kelch-like protein 20 OS=Stylophora pistillata OX=... [more]
A0A444SVL91.469e-12540.58Kelch-like protein 18 OS=Armadillidium vulgare OX=... [more]
back to top
BLAST of Kelch-like protein diablo vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
klhl189.032e-11637.50kelch like family member 18 [Source:NCBI gene;Acc:... [more]
klhl182.071e-11137.78kelch like family member 18 [Source:NCBI gene;Acc:... [more]
KLHL122.521e-8833.86kelch like family member 12 [Source:NCBI gene;Acc:... [more]
klhl208.785e-8734.07kelch like family member 20 [Source:NCBI gene;Acc:... [more]
klhl179.420e-8131.31kelch like family member 17 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Kelch-like protein diablo vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
klhl181.703e-11539.10kelch-like family member 18 [Source:ZFIN;Acc:ZDB-G... [more]
klhl53.724e-7630.96kelch-like family member 5 [Source:ZFIN;Acc:ZDB-GE... [more]
klhl81.502e-6828.41kelch-like family member 8 [Source:ZFIN;Acc:ZDB-GE... [more]
klhl208.122e-6829.83kelch-like family member 20 [Source:ZFIN;Acc:ZDB-G... [more]
klhl28.946e-6833.84kelch-like family member 2 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Kelch-like protein diablo vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Kelch-like protein diablo vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO493742.763e-12341.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471701.875e-9134.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO465427.084e-9037.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO496284.476e-8133.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380653.603e-7830.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Kelch-like protein diablo vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
klhl181.339e-11939.73kelch like family member 18 [Source:NCBI gene;Acc:... [more]
KLHL123.743e-8733.63kelch like family member 12 [Source:NCBI gene;Acc:... [more]
klhl207.312e-8734.07kelch like family member 20 [Source:NCBI gene;Acc:... [more]
KLHL123.984e-8132.81kelch like family member 12 [Source:NCBI gene;Acc:... [more]
klhl174.943e-8131.31kelch like family member 17 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Kelch-like protein diablo vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000077860.10.000e+098.26SMESG000077860.1[more]
SMESG000077860.10.000e+098.26SMESG000077860.1[more]
SMESG000077860.10.000e+098.26SMESG000077860.1[more]
SMESG000077860.10.000e+098.26SMESG000077860.1[more]
SMESG000012968.11.168e-6731.61SMESG000012968.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011469 ID=SMED30011469|Name=Kelch-like protein diablo|organism=Schmidtea mediterranea sexual|type=transcript|length=1906bp
ATAACAGTGAGTCTGCTGAAATATATTATAGTACAATATGTTTAAATATT
ATATCTATCTTATATTTAAATCAGTGACATTGCTCTTAGCTTTTTCAAGT
CAAACTCAATACTTATATTTGCACATCATAATTAATGTTGCAGGTTGTAC
TCTCTATTGCACCGCAATAAAGTCAACAATATCACAAAAACGTTTTGTTA
TTTGGCATTGAAAAGTATACGCGACATGGAACATGCAGCCCGTGGTCCAC
CGATTGACCATCCCTGAATTAGGATATATATTTGTAGATATTTATTGTTC
GATAGAATGATAACCAATAAAAATTTATATATCAATACAACAATAAATTC
TGTATTTCTAATCCAATAGAAACTCATAGATTAATCAATAGTCATTTTAG
TGAATGCTACATTAATACAAGTGTTTATTTTGAACAATTTATTTCCAAGT
TGATTGATATTTATTTAAATTAGTTGAAATGTAGTTTTAAATTTCATATT
GTCCATCATTTTATCGCAGAATATCAAGTCAAACGGTTTTGCCTTTAAGA
ACATTTGCAAAGAGCCTATTTTGTCATGATCTGTTGCACGCAGCGGATAT
TTACATTTACAATAATTTTATGTCAATTATCAATTTGAATGAATTTTTCG
ATTTATCTTTTGAAGACCTTTTGGAAATCATTTGCAAAGATGAGTTGCAA
GTGATTACCGAAGAAATCGTTTTCGAGGCTGTCATCAGATGGATCGAATA
CGCTATCAGTGAAAGAAAGCATTACTTAGCAGATCTCATGAAGCAAATCA
GATTTCCTCAGATCTCCCCCGAGTATTTGTTAGAGACCGTCTGCAGTAAT
CAAATCATTCAAAACAGTTTGCAATGTCGTAATGTGTTGGACGCAACAAA
AGATTTTCTTATCTTACCACAACAAATGAGAAACTTGGAACCTCATAATT
TCAGACCTCGTTATCTACAAAATTCACTTTATGGCTTCATTTTTGTTATT
GGTGGATCGTTTCAAAACGGCAACCAAGTAAATATGGAAGTCTATCATCC
GATTTTACGCCAATGGTGTTCTTTGGATCAGCTTGGAACGAATAAAACTC
GAGTTGGTGTGGCAGTTTTAGACCATTATATCTATGTGATTGGAGGTTTT
GATGGTTCTAGACGTTTGTCTCATGTCGATGTATTTAATACCAAAACAAT
GAAATGGAGCTCTGTGGCTAACATGAATTGCAATCGCAGTGCACTTGGAG
CAACCATGATGAATGATAAGATTTATGTTTGTGGAGGTTATGACGGAACT
ATTGCTCTTAAGAGTTGTGAAGAGTATTGTCCAAAATTAAATAGATGGAG
AGTTATTCCGCCAATGTTGGAGTGTAGATCAGCAACTGGTGTGGTTCATT
TGTCTCAAAAGCTATATGCAATTGGAGGTCATAATGGATTGGCGATTGAT
AATTCCGTGGAGTGTTTTAATCCAGTTATGAAATGCTGGGATTTGATCAC
GCCAATGTTAAATAGACGCTGTCGACACGGAGTAGCCGTTCTAAATCAGA
GTATTTACGCAGCCGGTGGTTATGATGGTGTTAATTTTCTGTCTTCGGTT
GAGGTTTTCAGTGTTACAACGAGTCAATGGACTTACATTGCATCAATGAA
AGTTCCCAGGTCGAGAATGTCACTAATCAGTACATTCGGGGAGATTTTTG
CCATCGGAGGCTTCGATGGATCTGGAAATTTGAAAACCACAGAATGCTTT
AATGCAAGATCTCAGCAATGGCTGGAAATGAGTCGTCTTCTGAATCATGA
TGGAGGGGTCGGCTGTGCAATTGTTGCTTTTTCTGATGCACACTTGAATA
TTTTGTCTATGTTTAAGACATAAATGATCTCATTTGTTTGAAGGAAATAA
ATTCAT
back to top

protein sequence of SMED30011469-orf-1

>SMED30011469-orf-1 ID=SMED30011469-orf-1|Name=SMED30011469-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=418bp
MSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERK
HYLADLMKQIRFPQISPEYLLETVCSNQIIQNSLQCRNVLDATKDFLILP
QQMRNLEPHNFRPRYLQNSLYGFIFVIGGSFQNGNQVNMEVYHPILRQWC
SLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVA
NMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPML
ECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRR
CRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRM
SLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRLLNHDGGVGCA
IVAFSDAHLNILSMFKT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
GO:0003779actin binding
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
GO:0031463Cul3-RING ubiquitin ligase complex
Vocabulary: biological process
TermDefinition
GO:0045886negative regulation of synaptic growth at neuromuscular junction
GO:0016567protein ubiquitination
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000099neuron
PLANA:0002056medial muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR011705BACK
IPR006652Kelch_1
IPR015915Kelch-typ_b-propeller
IPR011043Gal_Oxase/kelch_b-propeller
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006652Kelch repeat type 1SMARTSM00612kelc_smartcoord: 123..169
e-value: 0.2
score: 17.8
coord: 170..216
e-value: 3.2E-13
score: 59.9
coord: 311..357
e-value: 1.1E-9
score: 48.2
coord: 264..310
e-value: 7.1E-13
score: 58.8
coord: 217..263
e-value: 2.0E-12
score: 57.3
coord: 358..404
e-value: 0.0022
score: 27.3
IPR006652Kelch repeat type 1PFAMPF01344Kelch_1coord: 253..296
e-value: 8.0E-10
score: 38.2
coord: 161..203
e-value: 8.2E-14
score: 50.9
coord: 206..249
e-value: 2.4E-11
score: 43.0
coord: 299..343
e-value: 3.1E-16
score: 58.7
coord: 357..388
e-value: 5.1E-6
score: 26.0
IPR011705BTB/Kelch-associatedSMARTSM00875BACK_2coord: 3..75
e-value: 1.7E-10
score: 50.9
IPR011705BTB/Kelch-associatedPFAMPF07707BACKcoord: 3..74
e-value: 2.4E-20
score: 72.5
IPR015915Kelch-type beta propellerGENE3DG3DSA:2.120.10.80coord: 278..413
e-value: 5.4E-36
score: 126.0
IPR015915Kelch-type beta propellerGENE3DG3DSA:2.120.10.80coord: 111..277
e-value: 2.4E-45
score: 156.6
IPR015915Kelch-type beta propellerSUPERFAMILYSSF117281Kelch motifcoord: 122..400
NoneNo IPR availableGENE3DG3DSA:1.25.40.420coord: 1..98
e-value: 2.1E-27
score: 96.7
NoneNo IPR availablePANTHERPTHR24412:SF135KELCH-LIKE PROTEIN 5coord: 218..400
coord: 192..273
coord: 1..222
NoneNo IPR availablePANTHERPTHR24412FAMILY NOT NAMEDcoord: 218..400
coord: 192..273
coord: 1..222
NoneNo IPR availableCDDcd18445BACK_KLHL2_likecoord: 8..81
e-value: 1.07979E-25
score: 98.4593