ARID domain-containing protein

Overview
NameARID domain-containing protein
Smed IDSMED30011440
Length (bp)6261
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ARID domain-containing protein (SMED30011440) t-SNE clustered cells

Violin plots show distribution of expression levels for ARID domain-containing protein (SMED30011440) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ARID domain-containing protein (SMED30011440) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ARID domain-containing protein (SMED30011440) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011440

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 32

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30011440h1SMcG0007864 dd_Smed_v4_6219_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30011440h1SMcG0007864 dd_Smed_v4_6219_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011440h1SMcG0007864 dd_Smed_v4_6219_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30011440h1SMcG0007865 dd_Smed_v4_6219_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30011440h1SMcG0007865 dd_Smed_v4_6219_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011440h1SMcG0007865 dd_Smed_v4_6219_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30011440h1SMcG0007864 dd_Smed_v4_6219_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30011440h1SMcG0007864 dd_Smed_v4_6219_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011440h1SMcG0007864 dd_Smed_v4_6219_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30011440h1SMcG0007865 dd_Smed_v4_6219_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30011440h1SMcG0007865 dd_Smed_v4_6219_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011440h1SMcG0007865 dd_Smed_v4_6219_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30011440h1SMcG0007864 SMU15033702dd_Smed_v4PMID:30237141
Trost et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30011440h1SMcG0007864 SMU15033702dd_Smed_v4PMID:30237141
Trost et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30011440h1SMcG0007865 SMU15017366dd_Smed_v4PMID:30237141
Trost et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30011440h1SMcG0007865 SMU15017366dd_Smed_v4PMID:30237141
Trost et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30011440h1SMcG0007865 SMU15033702dd_Smed_v4PMID:30237141
Trost et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30011440h1SMcG0007865 SMU15033702dd_Smed_v4PMID:30237141
Trost et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30011440h1SMcG0007864 SMU15017366dd_Smed_v4PMID:30237141
Trost et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30011440h1SMcG0007864 SMU15017366dd_Smed_v4PMID:30237141
Trost et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30011440h1SMcG0007864 SMU15033702dd_Smed_v4PMID:30237141
Trost et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30011440h1SMcG0007864 SMU15033702dd_Smed_v4PMID:30237141
Trost et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30011440h1SMcG0007865 SMU15017366dd_Smed_v4PMID:30237141
Trost et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30011440h1SMcG0007865 SMU15017366dd_Smed_v4PMID:30237141
Trost et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30011440h1SMcG0007865 SMU15033702dd_Smed_v4PMID:30237141
Trost et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30011440h1SMcG0007865 SMU15033702dd_Smed_v4PMID:30237141
Trost et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30011440h1SMcG0007864 SMU15017366dd_Smed_v4PMID:30237141
Trost et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30011440h1SMcG0007864 SMU15017366dd_Smed_v4PMID:30237141
Trost et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30011440h1SMcG0007864 dd_Smed_v4_6219_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011440h1SMcG0007865 dd_Smed_v4_6219_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011440h1SMcG0007864 dd_Smed_v4_6219_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011440h1SMcG0007865 dd_Smed_v4_6219_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ARID domain-containing protein vs. Ensembl Human
Match: ARID1B (AT-rich interaction domain 1B [Source:HGNC Symbol;Acc:HGNC:18040])

HSP 1 Score: 135.576 bits (340), Expect = 5.519e-31
Identity = 111/316 (35.13%), Postives = 169/316 (53.48%), Query Frame = 1
Query: 4810 RCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEHSIDEWPPPNQEKE--------C----WWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPS---HRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQ--VVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIE--ITESQIRHVVDN-MGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLL 5697
            RCI VSN +R+LSF+ GND  +  +  +++ILG+L+LL HEH   +  P   EKE        C    WW   ++ +R++  VTL NIS  L+LS + E I  PI+ GLLHW+ C SA A+D  P+   + VL  +RL LE++ +L + + N+D IL+T         QE F      +   D +  V +EMS+A++  L+ G  + +    +A  Q   I  LISF+E  +T +Q +    N M M+     P L   S++ +  +   L  +A  + NR  F   HE R+L++ IS VL+  VA  I  VL+ +
Sbjct: 1190 RCICVSNIVRSLSFVPGNDAEMSKHPGLVLILGKLILLHHEHPERKRAPQTYEKEEDEDKGVACSKDEWWWDCLEVLRDNTLVTLANISGQLDLSAYTESICLPILDGLLHWMVCPSAEAQDPFPTVGPNSVLSPQRLVLETLCKLSIQDNNVDLILATP----PFSRQEKFYATLVRYVG-DRKNPVCREMSMALLSNLAQG--DALAARAIA-VQKGSIGNLISFLEDGVTMAQYQQSQHNLMHMQP----PPLEPPSVDMMCRAAKALLAMARVDENRSEFLL-HEGRLLDISISAVLNSLVASVICDVLFQI 1492          

HSP 2 Score: 121.709 bits (304), Expect = 1.196e-26
Identity = 58/121 (47.93%), Postives = 81/121 (66.94%), Query Frame = 1
Query: 1954 KLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPILQEIQSLSDKKKK 2316
            K+ ELGNEPER  W++RYL FM+E  +P+S++P V K+PLDLFRLY  V+E GGL  V K K+W+E+   +NV  S+S A +L++ YI+ L  +ECK +R    P     E+ S  D KK+
Sbjct:  305 KVYELGNEPERKLWVDRYLTFMEERGSPVSSLPAVGKKPLDLFRLYVCVKEIGGLAQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQYLFAFECKIERGEEPP----PEVFSTGDTKKQ 421          

HSP 3 Score: 76.2554 bits (186), Expect = 7.226e-13
Identity = 44/108 (40.74%), Postives = 61/108 (56.48%), Query Frame = 1
Query: 3706 SQITYSKSSSHFIKRYDSLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFG 4029
            SQ+T        I+R +  FPP SVEA+QP   ++RK +SKDI       V M+LKSGL+ E +WAL+ +NI   DD+     NL  L    + L++ +R  L  IFG
Sbjct:  836 SQVTGPPPQPPPIRR-EITFPPGSVEASQPVLKQRRKITSKDIVTPEAWRVMMSLKSGLLAESTWALDTINILLYDDSTVATFNLSQLSGFLELLVEYFRKCLIDIFG 942          
BLAST of ARID domain-containing protein vs. Ensembl Human
Match: ARID1B (AT-rich interaction domain 1B [Source:HGNC Symbol;Acc:HGNC:18040])

HSP 1 Score: 135.576 bits (340), Expect = 5.618e-31
Identity = 111/316 (35.13%), Postives = 169/316 (53.48%), Query Frame = 1
Query: 4810 RCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEHSIDEWPPPNQEKE--------C----WWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPS---HRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQ--VVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIE--ITESQIRHVVDN-MGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLL 5697
            RCI VSN +R+LSF+ GND  +  +  +++ILG+L+LL HEH   +  P   EKE        C    WW   ++ +R++  VTL NIS  L+LS + E I  PI+ GLLHW+ C SA A+D  P+   + VL  +RL LE++ +L + + N+D IL+T         QE F      +   D +  V +EMS+A++  L+ G  + +    +A  Q   I  LISF+E  +T +Q +    N M M+     P L   S++ +  +   L  +A  + NR  F   HE R+L++ IS VL+  VA  I  VL+ +
Sbjct: 1174 RCICVSNIVRSLSFVPGNDAEMSKHPGLVLILGKLILLHHEHPERKRAPQTYEKEEDEDKGVACSKDEWWWDCLEVLRDNTLVTLANISGQLDLSAYTESICLPILDGLLHWMVCPSAEAQDPFPTVGPNSVLSPQRLVLETLCKLSIQDNNVDLILATP----PFSRQEKFYATLVRYVG-DRKNPVCREMSMALLSNLAQG--DALAARAIA-VQKGSIGNLISFLEDGVTMAQYQQSQHNLMHMQP----PPLEPPSVDMMCRAAKALLAMARVDENRSEFLL-HEGRLLDISISAVLNSLVASVICDVLFQI 1476          

HSP 2 Score: 121.709 bits (304), Expect = 1.039e-26
Identity = 58/121 (47.93%), Postives = 81/121 (66.94%), Query Frame = 1
Query: 1954 KLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPILQEIQSLSDKKKK 2316
            K+ ELGNEPER  W++RYL FM+E  +P+S++P V K+PLDLFRLY  V+E GGL  V K K+W+E+   +NV  S+S A +L++ YI+ L  +ECK +R    P     E+ S  D KK+
Sbjct:  289 KVYELGNEPERKLWVDRYLTFMEERGSPVSSLPAVGKKPLDLFRLYVCVKEIGGLAQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQYLFAFECKIERGEEPP----PEVFSTGDTKKQ 405          

HSP 3 Score: 76.2554 bits (186), Expect = 6.907e-13
Identity = 44/108 (40.74%), Postives = 61/108 (56.48%), Query Frame = 1
Query: 3706 SQITYSKSSSHFIKRYDSLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFG 4029
            SQ+T        I+R +  FPP SVEA+QP   ++RK +SKDI       V M+LKSGL+ E +WAL+ +NI   DD+     NL  L    + L++ +R  L  IFG
Sbjct:  820 SQVTGPPPQPPPIRR-EITFPPGSVEASQPVLKQRRKITSKDIVTPEAWRVMMSLKSGLLAESTWALDTINILLYDDSTVATFNLSQLSGFLELLVEYFRKCLIDIFG 926          
BLAST of ARID domain-containing protein vs. Ensembl Human
Match: ARID1B (AT-rich interaction domain 1B [Source:HGNC Symbol;Acc:HGNC:18040])

HSP 1 Score: 135.576 bits (340), Expect = 6.291e-31
Identity = 111/316 (35.13%), Postives = 169/316 (53.48%), Query Frame = 1
Query: 4810 RCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEHSIDEWPPPNQEKE--------C----WWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPS---HRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQ--VVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIE--ITESQIRHVVDN-MGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLL 5697
            RCI VSN +R+LSF+ GND  +  +  +++ILG+L+LL HEH   +  P   EKE        C    WW   ++ +R++  VTL NIS  L+LS + E I  PI+ GLLHW+ C SA A+D  P+   + VL  +RL LE++ +L + + N+D IL+T         QE F      +   D +  V +EMS+A++  L+ G  + +    +A  Q   I  LISF+E  +T +Q +    N M M+     P L   S++ +  +   L  +A  + NR  F   HE R+L++ IS VL+  VA  I  VL+ +
Sbjct: 1181 RCICVSNIVRSLSFVPGNDAEMSKHPGLVLILGKLILLHHEHPERKRAPQTYEKEEDEDKGVACSKDEWWWDCLEVLRDNTLVTLANISGQLDLSAYTESICLPILDGLLHWMVCPSAEAQDPFPTVGPNSVLSPQRLVLETLCKLSIQDNNVDLILATP----PFSRQEKFYATLVRYVG-DRKNPVCREMSMALLSNLAQG--DALAARAIA-VQKGSIGNLISFLEDGVTMAQYQQSQHNLMHMQP----PPLEPPSVDMMCRAAKALLAMARVDENRSEFLL-HEGRLLDISISAVLNSLVASVICDVLFQI 1483          

HSP 2 Score: 122.479 bits (306), Expect = 6.222e-27
Identity = 58/121 (47.93%), Postives = 81/121 (66.94%), Query Frame = 1
Query: 1954 KLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPILQEIQSLSDKKKK 2316
            K+ ELGNEPER  W++RYL FM+E  +P+S++P V K+PLDLFRLY  V+E GGL  V K K+W+E+   +NV  S+S A +L++ YI+ L  +ECK +R    P     E+ S  D KK+
Sbjct:  296 KVYELGNEPERKLWVDRYLTFMEERGSPVSSLPAVGKKPLDLFRLYVCVKEIGGLAQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQYLFAFECKIERGEEPP----PEVFSTGDTKKQ 412          

HSP 3 Score: 76.2554 bits (186), Expect = 6.575e-13
Identity = 44/108 (40.74%), Postives = 61/108 (56.48%), Query Frame = 1
Query: 3706 SQITYSKSSSHFIKRYDSLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFG 4029
            SQ+T        I+R +  FPP SVEA+QP   ++RK +SKDI       V M+LKSGL+ E +WAL+ +NI   DD+     NL  L    + L++ +R  L  IFG
Sbjct:  827 SQVTGPPPQPPPIRR-EITFPPGSVEASQPVLKQRRKITSKDIVTPEAWRVMMSLKSGLLAESTWALDTINILLYDDSTVATFNLSQLSGFLELLVEYFRKCLIDIFG 933          
BLAST of ARID domain-containing protein vs. Ensembl Human
Match: ARID1B (AT-rich interaction domain 1B [Source:HGNC Symbol;Acc:HGNC:18040])

HSP 1 Score: 135.191 bits (339), Expect = 7.374e-31
Identity = 111/316 (35.13%), Postives = 169/316 (53.48%), Query Frame = 1
Query: 4810 RCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEHSIDEWPPPNQEKE--------C----WWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPS---HRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQ--VVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIE--ITESQIRHVVDN-MGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLL 5697
            RCI VSN +R+LSF+ GND  +  +  +++ILG+L+LL HEH   +  P   EKE        C    WW   ++ +R++  VTL NIS  L+LS + E I  PI+ GLLHW+ C SA A+D  P+   + VL  +RL LE++ +L + + N+D IL+T         QE F      +   D +  V +EMS+A++  L+ G  + +    +A  Q   I  LISF+E  +T +Q +    N M M+     P L   S++ +  +   L  +A  + NR  F   HE R+L++ IS VL+  VA  I  VL+ +
Sbjct: 1234 RCICVSNIVRSLSFVPGNDAEMSKHPGLVLILGKLILLHHEHPERKRAPQTYEKEEDEDKGVACSKDEWWWDCLEVLRDNTLVTLANISGQLDLSAYTESICLPILDGLLHWMVCPSAEAQDPFPTVGPNSVLSPQRLVLETLCKLSIQDNNVDLILATP----PFSRQEKFYATLVRYVG-DRKNPVCREMSMALLSNLAQG--DALAARAIA-VQKGSIGNLISFLEDGVTMAQYQQSQHNLMHMQP----PPLEPPSVDMMCRAAKALLAMARVDENRSEFLL-HEGRLLDISISAVLNSLVASVICDVLFQI 1536          

HSP 2 Score: 122.094 bits (305), Expect = 9.047e-27
Identity = 58/121 (47.93%), Postives = 81/121 (66.94%), Query Frame = 1
Query: 1954 KLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPILQEIQSLSDKKKK 2316
            K+ ELGNEPER  W++RYL FM+E  +P+S++P V K+PLDLFRLY  V+E GGL  V K K+W+E+   +NV  S+S A +L++ YI+ L  +ECK +R    P     E+ S  D KK+
Sbjct:  349 KVYELGNEPERKLWVDRYLTFMEERGSPVSSLPAVGKKPLDLFRLYVCVKEIGGLAQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQYLFAFECKIERGEEPP----PEVFSTGDTKKQ 465          

HSP 3 Score: 76.2554 bits (186), Expect = 7.856e-13
Identity = 44/108 (40.74%), Postives = 61/108 (56.48%), Query Frame = 1
Query: 3706 SQITYSKSSSHFIKRYDSLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFG 4029
            SQ+T        I+R +  FPP SVEA+QP   ++RK +SKDI       V M+LKSGL+ E +WAL+ +NI   DD+     NL  L    + L++ +R  L  IFG
Sbjct:  880 SQVTGPPPQPPPIRR-EITFPPGSVEASQPVLKQRRKITSKDIVTPEAWRVMMSLKSGLLAESTWALDTINILLYDDSTVATFNLSQLSGFLELLVEYFRKCLIDIFG 986          
BLAST of ARID domain-containing protein vs. Ensembl Human
Match: ARID1B (AT-rich interaction domain 1B [Source:HGNC Symbol;Acc:HGNC:18040])

HSP 1 Score: 134.806 bits (338), Expect = 1.062e-30
Identity = 111/316 (35.13%), Postives = 169/316 (53.48%), Query Frame = 1
Query: 4810 RCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEHSIDEWPPPNQEKE--------C----WWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPS---HRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQ--VVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIE--ITESQIRHVVDN-MGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLL 5697
            RCI VSN +R+LSF+ GND  +  +  +++ILG+L+LL HEH   +  P   EKE        C    WW   ++ +R++  VTL NIS  L+LS + E I  PI+ GLLHW+ C SA A+D  P+   + VL  +RL LE++ +L + + N+D IL+T         QE F      +   D +  V +EMS+A++  L+ G  + +    +A  Q   I  LISF+E  +T +Q +    N M M+     P L   S++ +  +   L  +A  + NR  F   HE R+L++ IS VL+  VA  I  VL+ +
Sbjct: 1453 RCICVSNIVRSLSFVPGNDAEMSKHPGLVLILGKLILLHHEHPERKRAPQTYEKEEDEDKGVACSKDEWWWDCLEVLRDNTLVTLANISGQLDLSAYTESICLPILDGLLHWMVCPSAEAQDPFPTVGPNSVLSPQRLVLETLCKLSIQDNNVDLILATP----PFSRQEKFYATLVRYVG-DRKNPVCREMSMALLSNLAQG--DALAARAIA-VQKGSIGNLISFLEDGVTMAQYQQSQHNLMHMQP----PPLEPPSVDMMCRAAKALLAMARVDENRSEFLL-HEGRLLDISISAVLNSLVASVICDVLFQI 1755          

HSP 2 Score: 122.479 bits (306), Expect = 6.129e-27
Identity = 58/121 (47.93%), Postives = 81/121 (66.94%), Query Frame = 1
Query: 1954 KLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPILQEIQSLSDKKKK 2316
            K+ ELGNEPER  W++RYL FM+E  +P+S++P V K+PLDLFRLY  V+E GGL  V K K+W+E+   +NV  S+S A +L++ YI+ L  +ECK +R    P     E+ S  D KK+
Sbjct:  568 KVYELGNEPERKLWVDRYLTFMEERGSPVSSLPAVGKKPLDLFRLYVCVKEIGGLAQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQYLFAFECKIERGEEPP----PEVFSTGDTKKQ 684          

HSP 3 Score: 75.8702 bits (185), Expect = 8.681e-13
Identity = 44/108 (40.74%), Postives = 61/108 (56.48%), Query Frame = 1
Query: 3706 SQITYSKSSSHFIKRYDSLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFG 4029
            SQ+T        I+R +  FPP SVEA+QP   ++RK +SKDI       V M+LKSGL+ E +WAL+ +NI   DD+     NL  L    + L++ +R  L  IFG
Sbjct: 1099 SQVTGPPPQPPPIRR-EITFPPGSVEASQPVLKQRRKITSKDIVTPEAWRVMMSLKSGLLAESTWALDTINILLYDDSTVATFNLSQLSGFLELLVEYFRKCLIDIFG 1205          
BLAST of ARID domain-containing protein vs. Ensembl Celegans
Match: let-526 (pep chromosome:WBcel235:I:5300901:5313926:-1 gene:WBGene00002717.1 transcript:C01G8.9d.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:let-526)

HSP 1 Score: 106.686 bits (265), Expect = 1.790e-22
Identity = 93/331 (28.10%), Postives = 150/331 (45.32%), Query Frame = 1
Query: 4795 EEKMMRCISVSNSIRNLSFLSGNDRIIGSNRTXX-XXXXXXXXXXHEHSIDEWPP------------PNQ-------EKECWWLKWID-----------DIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDS-LPSHRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIEITESQIRHVVDNMGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLY 5691
            EE   R +++SN +R  SF++G+D ++  N  +L +I   L L   EH I    P            P Q        KE   L  +D            +R+  FV L ++S  L L    + I  PI  GLL W       A DS +P    +  R  +LE M ++ V E+N+D  LST   GS   +++  + L       +    +E ++ +++ L +  E      Y+   + + I+ LI FI+  +  +  V+   GM AL+  PELMGTS+  LR + ++L  L       K + + H+ R+L   +S ++D  VA  I+  LY
Sbjct: 1236 EELAHRALALSNILRGFSFVAGSDVLMARNEALLFIIGRLLKLNVKEHKISSKRPGIVMSAEELKTAPKQLSADEKRAKEKSVLDEVDATTAQMVETANQLRDDAFVMLTHMSVSLNLVDLPDAIAYPIYDGLLRWSVSRVPEATDSSIPC--PVSPRDYSLEIMCKMVVIERNVDMFLST---GSWSRVEQFVHILTRLLTMNEETHYREFAIVILNALCIASE---AVCYICAMETSAIAHLILFIDSADQNMHQVMQAHGMAALRDNPELMGTSVGMLRRAASMLRLLVKVPKAYKIYMK-HQTRLLQFTMSQLMDSRVAGMIADTLY 1557          

HSP 2 Score: 80.8777 bits (198), Expect = 1.072e-14
Identity = 46/120 (38.33%), Postives = 64/120 (53.33%), Query Frame = 1
Query: 1981 ERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVN--VNASASGAYTLRRNYIKCLLDYECK-FDRNSADPGPILQEIQSLSDKKKKSTSRN 2331
            ER  + ER + F + N  PL+ VP V KQ +DL RLY  VR +GG   V K K WK +C   N  +  S++  Y LR++Y + LL  EC+   RN  D      E+ + +DK K+   R 
Sbjct:  318 ERRGFFERLIEFCEHNGEPLTMVPQVSKQSIDLHRLYIGVRAKGGFQQVTKDKYWKNLCTEANPDLAESSAAGYQLRKHYQRHLLMLECRETGRNPED------EV-AFADKMKRQRKRE 430          

HSP 3 Score: 54.6842 bits (130), Expect = 9.561e-7
Identity = 36/143 (25.17%), Postives = 67/143 (46.85%), Query Frame = 1
Query: 3736 HFIKRYDSLFPPNSVEATQPDYG--KKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFGRDLFIKDLELPVIIDES---------VSNKTDIKTLLSKIETV 4131
            H I +    +PP  +EAT       K+RK  ++++    P  + M+L+SGL  E  WA+N LN+   DDT      L+ +  +   +++    +L  ++  +  + +   P+I+DES               IK+++ K+  V
Sbjct:  931 HVISQQQHQYPPGCIEATATSQNQVKRRKVYARELINATPRRLIMSLRSGLDAEAIWAINALNVLLYDDTNPHP-TLQQMPGLVNVIVEHLYATLSIMYPAEFQLTEPGKPIIMDESKETVEKMMKAEKDGGIKSIIEKMPVV 1072          
BLAST of ARID domain-containing protein vs. Ensembl Celegans
Match: let-526 (pep chromosome:WBcel235:I:5300901:5310726:-1 gene:WBGene00002717.1 transcript:C01G8.9a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:let-526)

HSP 1 Score: 106.301 bits (264), Expect = 1.893e-22
Identity = 93/331 (28.10%), Postives = 150/331 (45.32%), Query Frame = 1
Query: 4795 EEKMMRCISVSNSIRNLSFLSGNDRIIGSNRTXX-XXXXXXXXXXHEHSIDEWPP------------PNQ-------EKECWWLKWID-----------DIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDS-LPSHRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIEITESQIRHVVDNMGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLY 5691
            EE   R +++SN +R  SF++G+D ++  N  +L +I   L L   EH I    P            P Q        KE   L  +D            +R+  FV L ++S  L L    + I  PI  GLL W       A DS +P    +  R  +LE M ++ V E+N+D  LST   GS   +++  + L       +    +E ++ +++ L +  E      Y+   + + I+ LI FI+  +  +  V+   GM AL+  PELMGTS+  LR + ++L  L       K + + H+ R+L   +S ++D  VA  I+  LY
Sbjct: 1182 EELAHRALALSNILRGFSFVAGSDVLMARNEALLFIIGRLLKLNVKEHKISSKRPGIVMSAEELKTAPKQLSADEKRAKEKSVLDEVDATTAQMVETANQLRDDAFVMLTHMSVSLNLVDLPDAIAYPIYDGLLRWSVSRVPEATDSSIPC--PVSPRDYSLEIMCKMVVIERNVDMFLST---GSWSRVEQFVHILTRLLTMNEETHYREFAIVILNALCIASE---AVCYICAMETSAIAHLILFIDSADQNMHQVMQAHGMAALRDNPELMGTSVGMLRRAASMLRLLVKVPKAYKIYMK-HQTRLLQFTMSQLMDSRVAGMIADTLY 1503          

HSP 2 Score: 80.8777 bits (198), Expect = 1.045e-14
Identity = 46/120 (38.33%), Postives = 64/120 (53.33%), Query Frame = 1
Query: 1981 ERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVN--VNASASGAYTLRRNYIKCLLDYECK-FDRNSADPGPILQEIQSLSDKKKKSTSRN 2331
            ER  + ER + F + N  PL+ VP V KQ +DL RLY  VR +GG   V K K WK +C   N  +  S++  Y LR++Y + LL  EC+   RN  D      E+ + +DK K+   R 
Sbjct:  264 ERRGFFERLIEFCEHNGEPLTMVPQVSKQSIDLHRLYIGVRAKGGFQQVTKDKYWKNLCTEANPDLAESSAAGYQLRKHYQRHLLMLECRETGRNPED------EV-AFADKMKRQRKRE 376          

HSP 3 Score: 54.6842 bits (130), Expect = 9.202e-7
Identity = 36/143 (25.17%), Postives = 67/143 (46.85%), Query Frame = 1
Query: 3736 HFIKRYDSLFPPNSVEATQPDYG--KKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFGRDLFIKDLELPVIIDES---------VSNKTDIKTLLSKIETV 4131
            H I +    +PP  +EAT       K+RK  ++++    P  + M+L+SGL  E  WA+N LN+   DDT      L+ +  +   +++    +L  ++  +  + +   P+I+DES               IK+++ K+  V
Sbjct:  877 HVISQQQHQYPPGCIEATATSQNQVKRRKVYARELINATPRRLIMSLRSGLDAEAIWAINALNVLLYDDTNPHP-TLQQMPGLVNVIVEHLYATLSIMYPAEFQLTEPGKPIIMDESKETVEKMMKAEKDGGIKSIIEKMPVV 1018          
BLAST of ARID domain-containing protein vs. Ensembl Celegans
Match: let-526 (pep chromosome:WBcel235:I:5300901:5313926:-1 gene:WBGene00002717.1 transcript:C01G8.9c.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:let-526)

HSP 1 Score: 106.301 bits (264), Expect = 1.910e-22
Identity = 93/331 (28.10%), Postives = 150/331 (45.32%), Query Frame = 1
Query: 4795 EEKMMRCISVSNSIRNLSFLSGNDRIIGSNRTXX-XXXXXXXXXXHEHSIDEWPP------------PNQ-------EKECWWLKWID-----------DIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDS-LPSHRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIEITESQIRHVVDNMGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLY 5691
            EE   R +++SN +R  SF++G+D ++  N  +L +I   L L   EH I    P            P Q        KE   L  +D            +R+  FV L ++S  L L    + I  PI  GLL W       A DS +P    +  R  +LE M ++ V E+N+D  LST   GS   +++  + L       +    +E ++ +++ L +  E      Y+   + + I+ LI FI+  +  +  V+   GM AL+  PELMGTS+  LR + ++L  L       K + + H+ R+L   +S ++D  VA  I+  LY
Sbjct: 1263 EELAHRALALSNILRGFSFVAGSDVLMARNEALLFIIGRLLKLNVKEHKISSKRPGIVMSAEELKTAPKQLSADEKRAKEKSVLDEVDATTAQMVETANQLRDDAFVMLTHMSVSLNLVDLPDAIAYPIYDGLLRWSVSRVPEATDSSIPC--PVSPRDYSLEIMCKMVVIERNVDMFLST---GSWSRVEQFVHILTRLLTMNEETHYREFAIVILNALCIASE---AVCYICAMETSAIAHLILFIDSADQNMHQVMQAHGMAALRDNPELMGTSVGMLRRAASMLRLLVKVPKAYKIYMK-HQTRLLQFTMSQLMDSRVAGMIADTLY 1584          

HSP 2 Score: 80.8777 bits (198), Expect = 9.888e-15
Identity = 46/120 (38.33%), Postives = 64/120 (53.33%), Query Frame = 1
Query: 1981 ERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVN--VNASASGAYTLRRNYIKCLLDYECK-FDRNSADPGPILQEIQSLSDKKKKSTSRN 2331
            ER  + ER + F + N  PL+ VP V KQ +DL RLY  VR +GG   V K K WK +C   N  +  S++  Y LR++Y + LL  EC+   RN  D      E+ + +DK K+   R 
Sbjct:  345 ERRGFFERLIEFCEHNGEPLTMVPQVSKQSIDLHRLYIGVRAKGGFQQVTKDKYWKNLCTEANPDLAESSAAGYQLRKHYQRHLLMLECRETGRNPED------EV-AFADKMKRQRKRE 457          

HSP 3 Score: 54.6842 bits (130), Expect = 1.042e-6
Identity = 36/143 (25.17%), Postives = 67/143 (46.85%), Query Frame = 1
Query: 3736 HFIKRYDSLFPPNSVEATQPDYG--KKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFGRDLFIKDLELPVIIDES---------VSNKTDIKTLLSKIETV 4131
            H I +    +PP  +EAT       K+RK  ++++    P  + M+L+SGL  E  WA+N LN+   DDT      L+ +  +   +++    +L  ++  +  + +   P+I+DES               IK+++ K+  V
Sbjct:  958 HVISQQQHQYPPGCIEATATSQNQVKRRKVYARELINATPRRLIMSLRSGLDAEAIWAINALNVLLYDDTNPHP-TLQQMPGLVNVIVEHLYATLSIMYPAEFQLTEPGKPIIMDESKETVEKMMKAEKDGGIKSIIEKMPVV 1099          
BLAST of ARID domain-containing protein vs. Ensembl Celegans
Match: let-526 (pep chromosome:WBcel235:I:5300901:5317392:-1 gene:WBGene00002717.1 transcript:C01G8.9c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:let-526)

HSP 1 Score: 106.301 bits (264), Expect = 1.910e-22
Identity = 93/331 (28.10%), Postives = 150/331 (45.32%), Query Frame = 1
Query: 4795 EEKMMRCISVSNSIRNLSFLSGNDRIIGSNRTXX-XXXXXXXXXXHEHSIDEWPP------------PNQ-------EKECWWLKWID-----------DIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDS-LPSHRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIEITESQIRHVVDNMGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLY 5691
            EE   R +++SN +R  SF++G+D ++  N  +L +I   L L   EH I    P            P Q        KE   L  +D            +R+  FV L ++S  L L    + I  PI  GLL W       A DS +P    +  R  +LE M ++ V E+N+D  LST   GS   +++  + L       +    +E ++ +++ L +  E      Y+   + + I+ LI FI+  +  +  V+   GM AL+  PELMGTS+  LR + ++L  L       K + + H+ R+L   +S ++D  VA  I+  LY
Sbjct: 1263 EELAHRALALSNILRGFSFVAGSDVLMARNEALLFIIGRLLKLNVKEHKISSKRPGIVMSAEELKTAPKQLSADEKRAKEKSVLDEVDATTAQMVETANQLRDDAFVMLTHMSVSLNLVDLPDAIAYPIYDGLLRWSVSRVPEATDSSIPC--PVSPRDYSLEIMCKMVVIERNVDMFLST---GSWSRVEQFVHILTRLLTMNEETHYREFAIVILNALCIASE---AVCYICAMETSAIAHLILFIDSADQNMHQVMQAHGMAALRDNPELMGTSVGMLRRAASMLRLLVKVPKAYKIYMK-HQTRLLQFTMSQLMDSRVAGMIADTLY 1584          

HSP 2 Score: 80.8777 bits (198), Expect = 9.888e-15
Identity = 46/120 (38.33%), Postives = 64/120 (53.33%), Query Frame = 1
Query: 1981 ERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVN--VNASASGAYTLRRNYIKCLLDYECK-FDRNSADPGPILQEIQSLSDKKKKSTSRN 2331
            ER  + ER + F + N  PL+ VP V KQ +DL RLY  VR +GG   V K K WK +C   N  +  S++  Y LR++Y + LL  EC+   RN  D      E+ + +DK K+   R 
Sbjct:  345 ERRGFFERLIEFCEHNGEPLTMVPQVSKQSIDLHRLYIGVRAKGGFQQVTKDKYWKNLCTEANPDLAESSAAGYQLRKHYQRHLLMLECRETGRNPED------EV-AFADKMKRQRKRE 457          

HSP 3 Score: 54.6842 bits (130), Expect = 1.042e-6
Identity = 36/143 (25.17%), Postives = 67/143 (46.85%), Query Frame = 1
Query: 3736 HFIKRYDSLFPPNSVEATQPDYG--KKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFGRDLFIKDLELPVIIDES---------VSNKTDIKTLLSKIETV 4131
            H I +    +PP  +EAT       K+RK  ++++    P  + M+L+SGL  E  WA+N LN+   DDT      L+ +  +   +++    +L  ++  +  + +   P+I+DES               IK+++ K+  V
Sbjct:  958 HVISQQQHQYPPGCIEATATSQNQVKRRKVYARELINATPRRLIMSLRSGLDAEAIWAINALNVLLYDDTNPHP-TLQQMPGLVNVIVEHLYATLSIMYPAEFQLTEPGKPIIMDESKETVEKMMKAEKDGGIKSIIEKMPVV 1099          
BLAST of ARID domain-containing protein vs. Ensembl Celegans
Match: let-526 (pep chromosome:WBcel235:I:5301002:5304785:-1 gene:WBGene00002717.1 transcript:C01G8.9b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:let-526)

HSP 1 Score: 98.2117 bits (243), Expect = 2.916e-20
Identity = 93/331 (28.10%), Postives = 150/331 (45.32%), Query Frame = 1
Query: 4795 EEKMMRCISVSNSIRNLSFLSGNDRIIGSNRTXX-XXXXXXXXXXHEHSIDEWPP------------PNQ-------EKECWWLKWID-----------DIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDS-LPSHRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIEITESQIRHVVDNMGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLY 5691
            EE   R +++SN +R  SF++G+D ++  N  +L +I   L L   EH I    P            P Q        KE   L  +D            +R+  FV L ++S  L L    + I  PI  GLL W       A DS +P    +  R  +LE M ++ V E+N+D  LST   GS   +++  + L       +    +E ++ +++ L +  E      Y+   + + I+ LI FI+  +  +  V+   GM AL+  PELMGTS+  LR + ++L  L       K + + H+ R+L   +S ++D  VA  I+  LY
Sbjct:  156 EELAHRALALSNILRGFSFVAGSDVLMARNEALLFIIGRLLKLNVKEHKISSKRPGIVMSAEELKTAPKQLSADEKRAKEKSVLDEVDATTAQMVETANQLRDDAFVMLTHMSVSLNLVDLPDAIAYPIYDGLLRWSVSRVPEATDSSIPCP--VSPRDYSLEIMCKMVVIERNVDMFLST---GSWSRVEQFVHILTRLLTMNEETHYREFAIVILNALCIASE---AVCYICAMETSAIAHLILFIDSADQNMHQVMQAHGMAALRDNPELMGTSVGMLRRAASMLRLLVKVPKAYKIYMK-HQTRLLQFTMSQLMDSRVAGMIADTLY 477          
BLAST of ARID domain-containing protein vs. Ensembl Fly
Match: osa (gene:FBgn0261885 transcript:FBtr0335025)

HSP 1 Score: 177.948 bits (450), Expect = 5.716e-44
Identity = 119/325 (36.62%), Postives = 180/325 (55.38%), Query Frame = 1
Query: 4780 IIESDEEKMMRCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEHSIDEWPPPNQEKE--------C--------WWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPS---HRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIEITESQIRHVVDNMGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLL 5697
            + ES +    RCI++SN  RNL+F+ GN+ ++  +   L +LGRLLLL HEH        N ++E        C        WW  ++  IRE++ V + NI+ +LELS++ E+I RP++ GLLHW  C SA  +D  PS   + VL  +RLALE++ +LCV + N+D +++T        +++L   L    C  + QV++E S+ ++HYL+         + L   Q   IS L++FIE  E     V +  G+  L+  P+ MGTSL+ LR +   L  LA +  NR  F +  E R+L LV+S +LDQ VA  IS VLY +
Sbjct: 2028 VSESQDSLARRCIALSNIFRNLTFVPGNETVLAKSTRFLAVLGRLLLLNHEHLRRTPKTRNYDREEDTDFSDSCSSLQGEREWWWDYLITIRENMLVAMANIAGHLELSRYDELIARPLIDGLLHWAVCPSAHGQDPFPSCGPNSVLSPQRLALEALCKLCVTDANVDLVIATPPFSR---LEKLCAVLTRHLCRNEDQVLREFSVNLLHYLAAADSAMARTVAL---QSPCISYLVAFIEQAEQTALGVANQHGINYLRENPDSMGTSLDMLRRAAGTLLHLAKHPDNRSLFMQ-QEQRLLGLVMSHILDQQVALIISRVLYQV 2345          

HSP 2 Score: 144.05 bits (362), Expect = 1.077e-33
Identity = 87/245 (35.51%), Postives = 130/245 (53.06%), Query Frame = 1
Query: 1591 HPATPVSNTVPSPSQTSMSSMVDENEDSVSSLGPNETNMLHHPSISNQSQFNQHQITPPMSQNHSII-YPQPYPNNQVPHTMMSSFPSHLPPQQRPFTPNPNMIPNRQYHHNESQTNNS-CYQKLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVV---KTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPILQEIQSLSDKK 2310
            H  T V  T   P  TSM  +  ++  S +S    E      P       ++Q  + PP +  H ++ +P   P  +     MSS P+   P   P   N   +P   +    + T  S    KL E+ + P+R  W+++   FM+E  TP++A PT+ KQPLDL+RLY  V+ERGG + V    K+K WK+I  ++ + AS+S AYTLR++Y K LL +EC FDR   DP PI+Q++++ S KK
Sbjct:  875 HAVTSVVTT--GPDGTSMDEVSQQSTLSNASAASGEDPQCTTPKSRKNDPYSQSHLAPPSTSPHPVVMHPGGGPGEEY---DMSSPPNWPRPAGSPQVFNHVPVPQEPFRSTITTTKKSDSLCKLYEMDDNPDRRGWLDKLRAFMEERRTPITACPTISKQPLDLYRLYIYVKERGGFVEVCKVTKSKTWKDIAGLLGIGASSSAAYTLRKHYTKNLLTFECHFDRGDIDPLPIIQQVEAGSKKK 1114          
BLAST of ARID domain-containing protein vs. Ensembl Fly
Match: osa (gene:FBgn0261885 transcript:FBtr0089583)

HSP 1 Score: 177.948 bits (450), Expect = 5.959e-44
Identity = 119/325 (36.62%), Postives = 180/325 (55.38%), Query Frame = 1
Query: 4780 IIESDEEKMMRCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEHSIDEWPPPNQEKE--------C--------WWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPS---HRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIEITESQIRHVVDNMGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLL 5697
            + ES +    RCI++SN  RNL+F+ GN+ ++  +   L +LGRLLLL HEH        N ++E        C        WW  ++  IRE++ V + NI+ +LELS++ E+I RP++ GLLHW  C SA  +D  PS   + VL  +RLALE++ +LCV + N+D +++T        +++L   L    C  + QV++E S+ ++HYL+         + L   Q   IS L++FIE  E     V +  G+  L+  P+ MGTSL+ LR +   L  LA +  NR  F +  E R+L LV+S +LDQ VA  IS VLY +
Sbjct: 2025 VSESQDSLARRCIALSNIFRNLTFVPGNETVLAKSTRFLAVLGRLLLLNHEHLRRTPKTRNYDREEDTDFSDSCSSLQGEREWWWDYLITIRENMLVAMANIAGHLELSRYDELIARPLIDGLLHWAVCPSAHGQDPFPSCGPNSVLSPQRLALEALCKLCVTDANVDLVIATPPFSR---LEKLCAVLTRHLCRNEDQVLREFSVNLLHYLAAADSAMARTVAL---QSPCISYLVAFIEQAEQTALGVANQHGINYLRENPDSMGTSLDMLRRAAGTLLHLAKHPDNRSLFMQ-QEQRLLGLVMSHILDQQVALIISRVLYQV 2342          

HSP 2 Score: 149.443 bits (376), Expect = 2.675e-35
Identity = 87/242 (35.95%), Postives = 130/242 (53.72%), Query Frame = 1
Query: 1591 HPATPVSNTVPSPSQTSMSSMVDENEDSVSSLGPNETNMLHHPSISNQSQFNQHQITPPMSQNHSII-YPQPYPNNQVPHTMMSSFPSHLPPQQRPFTPNPNMIPNRQYHHNESQTNNS-CYQKLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPILQEIQSLSDKK 2310
            H  T V  T   P  TSM  +  ++  S +S    E      P       ++Q  + PP +  H ++ +P   P  +     MSS P+   P   P   N   +P   +    + T  S    KL E+ + P+R  W+++   FM+E  TP++A PT+ KQPLDL+RLY  V+ERGG + V K+K WK+I  ++ + AS+S AYTLR++Y K LL +EC FDR   DP PI+Q++++ S KK
Sbjct:  875 HAVTSVVTT--GPDGTSMDEVSQQSTLSNASAASGEDPQCTTPKSRKNDPYSQSHLAPPSTSPHPVVMHPGGGPGEEY---DMSSPPNWPRPAGSPQVFNHVPVPQEPFRSTITTTKKSDSLCKLYEMDDNPDRRGWLDKLRAFMEERRTPITACPTISKQPLDLYRLYIYVKERGGFVEVTKSKTWKDIAGLLGIGASSSAAYTLRKHYTKNLLTFECHFDRGDIDPLPIIQQVEAGSKKK 1111          
BLAST of ARID domain-containing protein vs. Ensembl Fly
Match: osa (gene:FBgn0261885 transcript:FBtr0335024)

HSP 1 Score: 177.563 bits (449), Expect = 6.008e-44
Identity = 119/325 (36.62%), Postives = 180/325 (55.38%), Query Frame = 1
Query: 4780 IIESDEEKMMRCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEHSIDEWPPPNQEKE--------C--------WWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPS---HRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIEITESQIRHVVDNMGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLL 5697
            + ES +    RCI++SN  RNL+F+ GN+ ++  +   L +LGRLLLL HEH        N ++E        C        WW  ++  IRE++ V + NI+ +LELS++ E+I RP++ GLLHW  C SA  +D  PS   + VL  +RLALE++ +LCV + N+D +++T        +++L   L    C  + QV++E S+ ++HYL+         + L   Q   IS L++FIE  E     V +  G+  L+  P+ MGTSL+ LR +   L  LA +  NR  F +  E R+L LV+S +LDQ VA  IS VLY +
Sbjct: 2024 VSESQDSLARRCIALSNIFRNLTFVPGNETVLAKSTRFLAVLGRLLLLNHEHLRRTPKTRNYDREEDTDFSDSCSSLQGEREWWWDYLITIRENMLVAMANIAGHLELSRYDELIARPLIDGLLHWAVCPSAHGQDPFPSCGPNSVLSPQRLALEALCKLCVTDANVDLVIATPPFSR---LEKLCAVLTRHLCRNEDQVLREFSVNLLHYLAAADSAMARTVAL---QSPCISYLVAFIEQAEQTALGVANQHGINYLRENPDSMGTSLDMLRRAAGTLLHLAKHPDNRSLFMQ-QEQRLLGLVMSHILDQQVALIISRVLYQV 2341          

HSP 2 Score: 149.443 bits (376), Expect = 2.338e-35
Identity = 86/249 (34.54%), Postives = 131/249 (52.61%), Query Frame = 1
Query: 1591 HPATPVSNTVPSPSQTSMSSMVDENEDSVSSLGPNETNMLHHPSISNQSQFNQHQITPPMSQNHSII-YPQPYPNNQV--------PHTMMSSFPSHLPPQQRPFTPNPNMIPNRQYHHNESQTNNSCYQKLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPILQEIQSLSDKK 2310
            H  T V  T   P  TSM  +  ++  S +S    E      P       ++Q  + PP +  H ++ +P   P  +         P    S   +H+P  Q PF         R       ++++ C  KL E+ + P+R  W+++   FM+E  TP++A PT+ KQPLDL+RLY  V+ERGG + V K+K WK+I  ++ + AS+S AYTLR++Y K LL +EC FDR   DP PI+Q++++ S KK
Sbjct:  875 HAVTSVVTT--GPDGTSMDEVSQQSTLSNASAASGEDPQCTTPKSRKNDPYSQSHLAPPSTSPHPVVMHPGGGPGEEYDMSSPPNWPRPAGSPVFNHVPVPQEPF---------RSTITTTKKSDSLC--KLYEMDDNPDRRGWLDKLRAFMEERRTPITACPTISKQPLDLYRLYIYVKERGGFVEVTKSKTWKDIAGLLGIGASSSAAYTLRKHYTKNLLTFECHFDRGDIDPLPIIQQVEAGSKKK 1110          
BLAST of ARID domain-containing protein vs. Ensembl Fly
Match: osa (gene:FBgn0261885 transcript:FBtr0089582)

HSP 1 Score: 177.563 bits (449), Expect = 7.478e-44
Identity = 119/325 (36.62%), Postives = 180/325 (55.38%), Query Frame = 1
Query: 4780 IIESDEEKMMRCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEHSIDEWPPPNQEKE--------C--------WWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPS---HRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIEITESQIRHVVDNMGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLL 5697
            + ES +    RCI++SN  RNL+F+ GN+ ++  +   L +LGRLLLL HEH        N ++E        C        WW  ++  IRE++ V + NI+ +LELS++ E+I RP++ GLLHW  C SA  +D  PS   + VL  +RLALE++ +LCV + N+D +++T        +++L   L    C  + QV++E S+ ++HYL+         + L   Q   IS L++FIE  E     V +  G+  L+  P+ MGTSL+ LR +   L  LA +  NR  F +  E R+L LV+S +LDQ VA  IS VLY +
Sbjct: 2172 VSESQDSLARRCIALSNIFRNLTFVPGNETVLAKSTRFLAVLGRLLLLNHEHLRRTPKTRNYDREEDTDFSDSCSSLQGEREWWWDYLITIRENMLVAMANIAGHLELSRYDELIARPLIDGLLHWAVCPSAHGQDPFPSCGPNSVLSPQRLALEALCKLCVTDANVDLVIATPPFSR---LEKLCAVLTRHLCRNEDQVLREFSVNLLHYLAAADSAMARTVAL---QSPCISYLVAFIEQAEQTALGVANQHGINYLRENPDSMGTSLDMLRRAAGTLLHLAKHPDNRSLFMQ-QEQRLLGLVMSHILDQQVALIISRVLYQV 2489          

HSP 2 Score: 149.058 bits (375), Expect = 3.147e-35
Identity = 87/242 (35.95%), Postives = 130/242 (53.72%), Query Frame = 1
Query: 1591 HPATPVSNTVPSPSQTSMSSMVDENEDSVSSLGPNETNMLHHPSISNQSQFNQHQITPPMSQNHSII-YPQPYPNNQVPHTMMSSFPSHLPPQQRPFTPNPNMIPNRQYHHNESQTNNS-CYQKLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPILQEIQSLSDKK 2310
            H  T V  T   P  TSM  +  ++  S +S    E      P       ++Q  + PP +  H ++ +P   P  +     MSS P+   P   P   N   +P   +    + T  S    KL E+ + P+R  W+++   FM+E  TP++A PT+ KQPLDL+RLY  V+ERGG + V K+K WK+I  ++ + AS+S AYTLR++Y K LL +EC FDR   DP PI+Q++++ S KK
Sbjct:  875 HAVTSVVTT--GPDGTSMDEVSQQSTLSNASAASGEDPQCTTPKSRKNDPYSQSHLAPPSTSPHPVVMHPGGGPGEEY---DMSSPPNWPRPAGSPQVFNHVPVPQEPFRSTITTTKKSDSLCKLYEMDDNPDRRGWLDKLRAFMEERRTPITACPTISKQPLDLYRLYIYVKERGGFVEVTKSKTWKDIAGLLGIGASSSAAYTLRKHYTKNLLTFECHFDRGDIDPLPIIQQVEAGSKKK 1111          
BLAST of ARID domain-containing protein vs. Ensembl Fly
Match: osa (gene:FBgn0261885 transcript:FBtr0089581)

HSP 1 Score: 177.563 bits (449), Expect = 7.948e-44
Identity = 119/325 (36.62%), Postives = 180/325 (55.38%), Query Frame = 1
Query: 4780 IIESDEEKMMRCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEHSIDEWPPPNQEKE--------C--------WWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPS---HRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIEITESQIRHVVDNMGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLL 5697
            + ES +    RCI++SN  RNL+F+ GN+ ++  +   L +LGRLLLL HEH        N ++E        C        WW  ++  IRE++ V + NI+ +LELS++ E+I RP++ GLLHW  C SA  +D  PS   + VL  +RLALE++ +LCV + N+D +++T        +++L   L    C  + QV++E S+ ++HYL+         + L   Q   IS L++FIE  E     V +  G+  L+  P+ MGTSL+ LR +   L  LA +  NR  F +  E R+L LV+S +LDQ VA  IS VLY +
Sbjct: 2185 VSESQDSLARRCIALSNIFRNLTFVPGNETVLAKSTRFLAVLGRLLLLNHEHLRRTPKTRNYDREEDTDFSDSCSSLQGEREWWWDYLITIRENMLVAMANIAGHLELSRYDELIARPLIDGLLHWAVCPSAHGQDPFPSCGPNSVLSPQRLALEALCKLCVTDANVDLVIATPPFSR---LEKLCAVLTRHLCRNEDQVLREFSVNLLHYLAAADSAMARTVAL---QSPCISYLVAFIEQAEQTALGVANQHGINYLRENPDSMGTSLDMLRRAAGTLLHLAKHPDNRSLFMQ-QEQRLLGLVMSHILDQQVALIISRVLYQV 2502          

HSP 2 Score: 149.443 bits (376), Expect = 2.664e-35
Identity = 87/242 (35.95%), Postives = 130/242 (53.72%), Query Frame = 1
Query: 1591 HPATPVSNTVPSPSQTSMSSMVDENEDSVSSLGPNETNMLHHPSISNQSQFNQHQITPPMSQNHSII-YPQPYPNNQVPHTMMSSFPSHLPPQQRPFTPNPNMIPNRQYHHNESQTNNS-CYQKLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPILQEIQSLSDKK 2310
            H  T V  T   P  TSM  +  ++  S +S    E      P       ++Q  + PP +  H ++ +P   P  +     MSS P+   P   P   N   +P   +    + T  S    KL E+ + P+R  W+++   FM+E  TP++A PT+ KQPLDL+RLY  V+ERGG + V K+K WK+I  ++ + AS+S AYTLR++Y K LL +EC FDR   DP PI+Q++++ S KK
Sbjct:  875 HAVTSVVTT--GPDGTSMDEVSQQSTLSNASAASGEDPQCTTPKSRKNDPYSQSHLAPPSTSPHPVVMHPGGGPGEEY---DMSSPPNWPRPAGSPQVFNHVPVPQEPFRSTITTTKKSDSLCKLYEMDDNPDRRGWLDKLRAFMEERRTPITACPTISKQPLDLYRLYIYVKERGGFVEVTKSKTWKDIAGLLGIGASSSAAYTLRKHYTKNLLTFECHFDRGDIDPLPIIQQVEAGSKKK 1111          
BLAST of ARID domain-containing protein vs. Ensembl Zebrafish
Match: arid1aa (AT rich interactive domain 1Aa (SWI-like) [Source:ZFIN;Acc:ZDB-GENE-080220-35])

HSP 1 Score: 125.561 bits (314), Expect = 5.809e-28
Identity = 98/348 (28.16%), Postives = 162/348 (46.55%), Query Frame = 1
Query: 4729 LQAKSEIVND-----GEGLFFKIIESDEEKMMRCISVSNSIRNLSFLSGNDRIIG--------------SNRTXXXXXXXXXXXXHEHSIDEWPPPNQEKECWWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPS---HRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIE--ITESQIRHVVDN-MGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLL 5697
            LQ +  ++ D      E     + E  +    RCI VSN +R+LSF+ GND  +                +          L    E  +DE      +K+ WW   ++ +RE+  VTL NIS  L+ S + E I  P++ GLLHW  C SA A+D  PS   +  L  +RL LE++ +L V + N+D IL+T        +++LF  L        V V +EM++ ++  L+ G       I +  A    +  L+ F+E  +  +Q +    + + M+     P    TS++ +R +   L  LA  E N   F+  +E R+L+L +S +++  V+  I  VL+L+
Sbjct: 1948 LQGRRSVLEDEPHSKDEAPLVTLSEWQDSLARRCICVSNIVRSLSFVPGNDTEMSKHPGLLLLLGRLLLLHHRHPERKQAPLTYEKEEEVDESL--GSKKDEWWWDCLELLRENCLVTLSNISGQLDFSVYTESICLPLLDGLLHWAVCPSAEAQDPFPSLGLNGALSPQRLVLETLCKLSVQDNNVDLILATAPFSR---LEKLFGNLVRLVGERKVPVCREMAVVLLANLAQGDSMAARAIAVQKAS---VGNLLGFLEDSLAATQFQQSQGSLLHMQGSHFEP----TSVDMMRRAARALLALAKVEENHSEFTL-YESRLLDLSVSPLMNSMVSHVICDVLFLI 2282          

HSP 2 Score: 111.309 bits (277), Expect = 1.234e-23
Identity = 55/121 (45.45%), Postives = 81/121 (66.94%), Query Frame = 1
Query: 1954 KLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPILQEIQSLSDKKKK 2316
            +L ELG EPER  W++RYL F++E    ++ +P V ++PLDLFRLY +V+E GGL  V K K+W+E+   +NV  S+S A +L++ YI+CL  +ECK +R   DP P   +I S  +KK +
Sbjct:  981 RLYELGPEPERKMWVDRYLAFIEEKAMGMTNLPAVGRKPLDLFRLYMSVKEIGGLTQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQCLYAFECKIERGE-DPPP---DIMSGDNKKNQ 1097          

HSP 3 Score: 73.559 bits (179), Expect = 3.043e-12
Identity = 40/116 (34.48%), Postives = 61/116 (52.59%), Query Frame = 1
Query: 3742 IKRYDSLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFG--RDLFIKDLELPVIIDESV 4083
            + R D  FPP S+EAT P    +R+ + K+I       V M+LKSGL+ E +WAL+ +NI   DD      NL  L    + +++ +R  L  IFG  R+  + D     ++D +V
Sbjct: 1574 MMRRDLSFPPGSIEATPPVLKSRRRLTMKEIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSISNFNLMQLPGFLELIVEYFRRCLIEIFGILREYEVGDPGQRALLDPNV 1689          
BLAST of ARID domain-containing protein vs. Ensembl Zebrafish
Match: arid1aa (AT rich interactive domain 1Aa (SWI-like) [Source:ZFIN;Acc:ZDB-GENE-080220-35])

HSP 1 Score: 125.561 bits (314), Expect = 5.909e-28
Identity = 98/348 (28.16%), Postives = 162/348 (46.55%), Query Frame = 1
Query: 4729 LQAKSEIVND-----GEGLFFKIIESDEEKMMRCISVSNSIRNLSFLSGNDRIIG--------------SNRTXXXXXXXXXXXXHEHSIDEWPPPNQEKECWWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPS---HRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIE--ITESQIRHVVDN-MGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLL 5697
            LQ +  ++ D      E     + E  +    RCI VSN +R+LSF+ GND  +                +          L    E  +DE      +K+ WW   ++ +RE+  VTL NIS  L+ S + E I  P++ GLLHW  C SA A+D  PS   +  L  +RL LE++ +L V + N+D IL+T        +++LF  L        V V +EM++ ++  L+ G       I +  A    +  L+ F+E  +  +Q +    + + M+     P    TS++ +R +   L  LA  E N   F+  +E R+L+L +S +++  V+  I  VL+L+
Sbjct: 1949 LQGRRSVLEDEPHSKDEAPLVTLSEWQDSLARRCICVSNIVRSLSFVPGNDTEMSKHPGLLLLLGRLLLLHHRHPERKQAPLTYEKEEEVDESL--GSKKDEWWWDCLELLRENCLVTLSNISGQLDFSVYTESICLPLLDGLLHWAVCPSAEAQDPFPSLGLNGALSPQRLVLETLCKLSVQDNNVDLILATAPFSR---LEKLFGNLVRLVGERKVPVCREMAVVLLANLAQGDSMAARAIAVQKAS---VGNLLGFLEDSLAATQFQQSQGSLLHMQGSHFEP----TSVDMMRRAARALLALAKVEENHSEFTL-YESRLLDLSVSPLMNSMVSHVICDVLFLI 2283          

HSP 2 Score: 111.309 bits (277), Expect = 1.244e-23
Identity = 55/121 (45.45%), Postives = 81/121 (66.94%), Query Frame = 1
Query: 1954 KLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPILQEIQSLSDKKKK 2316
            +L ELG EPER  W++RYL F++E    ++ +P V ++PLDLFRLY +V+E GGL  V K K+W+E+   +NV  S+S A +L++ YI+CL  +ECK +R   DP P   +I S  +KK +
Sbjct:  981 RLYELGPEPERKMWVDRYLAFIEEKAMGMTNLPAVGRKPLDLFRLYMSVKEIGGLTQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQCLYAFECKIERGE-DPPP---DIMSGDNKKNQ 1097          

HSP 3 Score: 73.559 bits (179), Expect = 3.121e-12
Identity = 40/116 (34.48%), Postives = 61/116 (52.59%), Query Frame = 1
Query: 3742 IKRYDSLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFG--RDLFIKDLELPVIIDESV 4083
            + R D  FPP S+EAT P    +R+ + K+I       V M+LKSGL+ E +WAL+ +NI   DD      NL  L    + +++ +R  L  IFG  R+  + D     ++D +V
Sbjct: 1575 MMRRDLSFPPGSIEATPPVLKSRRRLTMKEIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSISNFNLMQLPGFLELIVEYFRRCLIEIFGILREYEVGDPGQRALLDPNV 1690          
BLAST of ARID domain-containing protein vs. Ensembl Zebrafish
Match: arid1b (AT rich interactive domain 1B (SWI1-like) [Source:ZFIN;Acc:ZDB-GENE-030131-4459])

HSP 1 Score: 119.013 bits (297), Expect = 4.598e-26
Identity = 108/327 (33.03%), Postives = 163/327 (49.85%), Query Frame = 1
Query: 4774 FKIIES-DEEKMMRCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEHSIDEWPPPNQEKE------C----WWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPSH---RVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIEITES-----QIRHVVDNMGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLL 5697
              + ES  +E   RCI VSN IR LSF+ GND  +  +  +++ILG+L+LL HEH   +  P   ++E      C    WW   +  +RE+  VTL NIS  L+LS + E I  PI+ GLLHW+ C SA A+D   +      L  +RL LE + +L + + N+D +L+T   G     + LF  L         QV +EM++AV+  L+ G       + L   Q   +  LISF+E + +     Q  H + +MG       P     S+  +  +   L  +A  E NR  F    E R+L++ +S+VL+  VA  +  VL+ L
Sbjct: 1764 LSVAESWQDELAKRCICVSNIIRGLSFVPGNDNELARHPGLVLILGKLVLLHHEHPKRKRMPATYQREEERGLACSKDEWWWDCLGALRENTLVTLANISGQLDLSVYPESICLPILDGLLHWMVCPSAEAQDPFCTANGFSSLTPQRLVLECLCKLSIQDSNVDLLLATPPFGRQ---ERLFATLVRHVGDRKSQVCREMAVAVLSNLAQGDPTAARAVAL---QKGSVGALISFLEDSVAMAQYQQSPHSLLHMGHSTQHEPP-----SINMMCRAAKALLAMAKVEENRPEFVL-FESRLLDISLSSVLNSGVAAILCEVLFKL 2078          

HSP 2 Score: 112.849 bits (281), Expect = 3.454e-24
Identity = 52/117 (44.44%), Postives = 74/117 (63.25%), Query Frame = 1
Query: 1918 HNESQTNNSCYQKLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADP 2268
            H+     N    +L ++G EPER  W++RY+ FM+E  TP+  +P+V K+PLDL RLY  VRE GGL  V K K+W+E+   +NV  S+S A +L++ YI+ L  YECK +R    P
Sbjct:  890 HSTVNMTNEKITRLYDMGCEPERRAWVDRYIAFMEERGTPVPNLPSVGKKPLDLCRLYLCVREIGGLAMVNKNKKWRELSTHLNVGTSSSSASSLKKQYIQYLFAYECKVERGEEPP 1006          

HSP 3 Score: 65.4698 bits (158), Expect = 8.176e-10
Identity = 42/128 (32.81%), Postives = 61/128 (47.66%), Query Frame = 1
Query: 3763 FPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFGRDLFIKDLELPVIIDESVSNKTDIKTLLSKIETVLKNRQ 4146
            +P +SVEATQP    +R+ +SKDI       V M+LKSGL+ E +WAL+ +NI   DD       L  L    + +++ +R  L  IFG            I++E        KTLL       + +Q
Sbjct: 1429 YPLDSVEATQPQLKPRRRLTSKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNTVSSFGLSQLPGFLELIVEFFRRCLIEIFG------------ILEEYEVGTEGQKTLLGSCSEPTEKQQ 1544          
BLAST of ARID domain-containing protein vs. Ensembl Zebrafish
Match: arid1b (AT rich interactive domain 1B (SWI1-like) [Source:ZFIN;Acc:ZDB-GENE-030131-4459])

HSP 1 Score: 119.013 bits (297), Expect = 4.786e-26
Identity = 108/327 (33.03%), Postives = 163/327 (49.85%), Query Frame = 1
Query: 4774 FKIIES-DEEKMMRCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEHSIDEWPPPNQEKE------C----WWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPSH---RVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIEITES-----QIRHVVDNMGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLL 5697
              + ES  +E   RCI VSN IR LSF+ GND  +  +  +++ILG+L+LL HEH   +  P   ++E      C    WW   +  +RE+  VTL NIS  L+LS + E I  PI+ GLLHW+ C SA A+D   +      L  +RL LE + +L + + N+D +L+T   G     + LF  L         QV +EM++AV+  L+ G       + L   Q   +  LISF+E + +     Q  H + +MG       P     S+  +  +   L  +A  E NR  F    E R+L++ +S+VL+  VA  +  VL+ L
Sbjct: 1804 LSVAESWQDELAKRCICVSNIIRGLSFVPGNDNELARHPGLVLILGKLVLLHHEHPKRKRMPATYQREEERGLACSKDEWWWDCLGALRENTLVTLANISGQLDLSVYPESICLPILDGLLHWMVCPSAEAQDPFCTANGFSSLTPQRLVLECLCKLSIQDSNVDLLLATPPFGRQ---ERLFATLVRHVGDRKSQVCREMAVAVLSNLAQGDPTAARAVAL---QKGSVGALISFLEDSVAMAQYQQSPHSLLHMGHSTQHEPP-----SINMMCRAAKALLAMAKVEENRPEFVL-FESRLLDISLSSVLNSGVAAILCEVLFKL 2118          

HSP 2 Score: 113.235 bits (282), Expect = 2.961e-24
Identity = 52/117 (44.44%), Postives = 74/117 (63.25%), Query Frame = 1
Query: 1918 HNESQTNNSCYQKLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADP 2268
            H+     N    +L ++G EPER  W++RY+ FM+E  TP+  +P+V K+PLDL RLY  VRE GGL  V K K+W+E+   +NV  S+S A +L++ YI+ L  YECK +R    P
Sbjct:  890 HSTVNMTNEKITRLYDMGCEPERRAWVDRYIAFMEERGTPVPNLPSVGKKPLDLCRLYLCVREIGGLAMVNKNKKWRELSTHLNVGTSSSSASSLKKQYIQYLFAYECKVERGEEPP 1006          

HSP 3 Score: 65.4698 bits (158), Expect = 8.551e-10
Identity = 42/128 (32.81%), Postives = 61/128 (47.66%), Query Frame = 1
Query: 3763 FPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFGRDLFIKDLELPVIIDESVSNKTDIKTLLSKIETVLKNRQ 4146
            +P +SVEATQP    +R+ +SKDI       V M+LKSGL+ E +WAL+ +NI   DD       L  L    + +++ +R  L  IFG            I++E        KTLL       + +Q
Sbjct: 1469 YPLDSVEATQPQLKPRRRLTSKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNTVSSFGLSQLPGFLELIVEFFRRCLIEIFG------------ILEEYEVGTEGQKTLLGSCSEPTEKQQ 1584          
BLAST of ARID domain-containing protein vs. Ensembl Zebrafish
Match: arid1b (AT rich interactive domain 1B (SWI1-like) [Source:ZFIN;Acc:ZDB-GENE-030131-4459])

HSP 1 Score: 119.013 bits (297), Expect = 4.828e-26
Identity = 108/327 (33.03%), Postives = 163/327 (49.85%), Query Frame = 1
Query: 4774 FKIIES-DEEKMMRCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEHSIDEWPPPNQEKE------C----WWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPSH---RVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIEITES-----QIRHVVDNMGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLL 5697
              + ES  +E   RCI VSN IR LSF+ GND  +  +  +++ILG+L+LL HEH   +  P   ++E      C    WW   +  +RE+  VTL NIS  L+LS + E I  PI+ GLLHW+ C SA A+D   +      L  +RL LE + +L + + N+D +L+T   G     + LF  L         QV +EM++AV+  L+ G       + L   Q   +  LISF+E + +     Q  H + +MG       P     S+  +  +   L  +A  E NR  F    E R+L++ +S+VL+  VA  +  VL+ L
Sbjct: 1805 LSVAESWQDELAKRCICVSNIIRGLSFVPGNDNELARHPGLVLILGKLVLLHHEHPKRKRMPATYQREEERGLACSKDEWWWDCLGALRENTLVTLANISGQLDLSVYPESICLPILDGLLHWMVCPSAEAQDPFCTANGFSSLTPQRLVLECLCKLSIQDSNVDLLLATPPFGRQ---ERLFATLVRHVGDRKSQVCREMAVAVLSNLAQGDPTAARAVAL---QKGSVGALISFLEDSVAMAQYQQSPHSLLHMGHSTQHEPP-----SINMMCRAAKALLAMAKVEENRPEFVL-FESRLLDISLSSVLNSGVAAILCEVLFKL 2119          

HSP 2 Score: 113.235 bits (282), Expect = 2.961e-24
Identity = 52/117 (44.44%), Postives = 74/117 (63.25%), Query Frame = 1
Query: 1918 HNESQTNNSCYQKLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADP 2268
            H+     N    +L ++G EPER  W++RY+ FM+E  TP+  +P+V K+PLDL RLY  VRE GGL  V K K+W+E+   +NV  S+S A +L++ YI+ L  YECK +R    P
Sbjct:  891 HSTVNMTNEKITRLYDMGCEPERRAWVDRYIAFMEERGTPVPNLPSVGKKPLDLCRLYLCVREIGGLAMVNKNKKWRELSTHLNVGTSSSSASSLKKQYIQYLFAYECKVERGEEPP 1007          

HSP 3 Score: 65.4698 bits (158), Expect = 8.552e-10
Identity = 42/128 (32.81%), Postives = 61/128 (47.66%), Query Frame = 1
Query: 3763 FPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFGRDLFIKDLELPVIIDESVSNKTDIKTLLSKIETVLKNRQ 4146
            +P +SVEATQP    +R+ +SKDI       V M+LKSGL+ E +WAL+ +NI   DD       L  L    + +++ +R  L  IFG            I++E        KTLL       + +Q
Sbjct: 1470 YPLDSVEATQPQLKPRRRLTSKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNTVSSFGLSQLPGFLELIVEFFRRCLIEIFG------------ILEEYEVGTEGQKTLLGSCSEPTEKQQ 1585          
BLAST of ARID domain-containing protein vs. Ensembl Xenopus
Match: ARID1B (AT-rich interaction domain 1B [Source:NCBI gene;Acc:100493908])

HSP 1 Score: 121.324 bits (303), Expect = 1.507e-26
Identity = 109/316 (34.49%), Postives = 161/316 (50.95%), Query Frame = 1
Query: 4810 RCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEHSIDEWPPPNQEKEC-------------WWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPSH---RVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQE-LFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIE--ITESQIRHVVDN-MGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLL 5697
            RCI VSN IR+LSF+ GND  +  +  +++ILG+L+LL HEH   +  P   EK+              WW   ++ +RE+  VTL NIS  L+LS + E I  PI+ G+LHWL C SA A+D  P+      L  +RL LE++ +L + + N+D IL+T         QE L+  L          V +EMS+A++  L+ G       I +   Q   I  LISF+E  +T +Q +    N M M+     P L   S + +  +   L  +A  E N+  F    E R+L++ IS VL+  VA  I  VL+ +
Sbjct: 1430 RCICVSNIIRSLSFVPGNDTEMSKHPGLVLILGKLILLHHEHPERKRAPQTYEKDGEDNNKGVLCTKDEWWWDCLEVLRENTLVTLANISGQLDLSAYTESICLPILDGMLHWLVCPSAEAQDPFPTVGPISFLSPQRLVLETLCKLSIQDNNVDLILATP----PFSRQEKLYATLVRYVGDRKNPVCREMSVALLSNLAQGDTLVARAIAV---QKGSIGNLISFLEDGVTMAQYQQSQHNLMHMQP----PHLEPPSADMMCRAAKALLAMAKVEENQSEFLL-QEGRLLDISISAVLNTVVASVICDVLFQI 1733          

HSP 2 Score: 118.627 bits (296), Expect = 9.230e-26
Identity = 56/118 (47.46%), Postives = 75/118 (63.56%), Query Frame = 1
Query: 1927 SQTNNSCYQKLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPIL 2280
            S T      KL ELGNEPER  W++RYL FM+E  TP++ +P V K+PLDL RLY  V+E GGL  V K K+W+E+   +NV  S+S A +L++ YI+ L  +ECK +R    P  I 
Sbjct:  538 STTTGEKITKLYELGNEPERKMWVDRYLTFMEERGTPVANLPAVGKKPLDLVRLYFCVKEIGGLAQVNKNKKWRELSSNLNVGTSSSAASSLKKQYIQYLFAFECKIERGEEPPPEIF 655          

HSP 3 Score: 77.411 bits (189), Expect = 2.694e-13
Identity = 44/117 (37.61%), Postives = 66/117 (56.41%), Query Frame = 1
Query: 3748 RYDSLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFGRDLFIKDLELPVIIDESVSNKTD 4098
            R +  FPP SVEATQP    +RK ++KDI       V M+LKSGL+ E +WAL+ +NI   DD+     NL  L    + L++ +R  L  IFG    +K+ E+   + +++S  T+
Sbjct: 1092 RREITFPPGSVEATQPILKPRRKLTAKDIVTPEAWRVMMSLKSGLLAESTWALDTINILLYDDSTVATFNLSQLPGFLELLVEYFRKCLIDIFG---ILKEYEVGEAVQKALSPTTE 1205          
BLAST of ARID domain-containing protein vs. Ensembl Xenopus
Match: ARID1B (AT-rich interaction domain 1B [Source:NCBI gene;Acc:100493908])

HSP 1 Score: 120.939 bits (302), Expect = 1.750e-26
Identity = 109/316 (34.49%), Postives = 161/316 (50.95%), Query Frame = 1
Query: 4810 RCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEHSIDEWPPPNQEKEC-------------WWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPSH---RVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQE-LFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIE--ITESQIRHVVDN-MGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLL 5697
            RCI VSN IR+LSF+ GND  +  +  +++ILG+L+LL HEH   +  P   EK+              WW   ++ +RE+  VTL NIS  L+LS + E I  PI+ G+LHWL C SA A+D  P+      L  +RL LE++ +L + + N+D IL+T         QE L+  L          V +EMS+A++  L+ G       I +   Q   I  LISF+E  +T +Q +    N M M+     P L   S + +  +   L  +A  E N+  F    E R+L++ IS VL+  VA  I  VL+ +
Sbjct: 1455 RCICVSNIIRSLSFVPGNDTEMSKHPGLVLILGKLILLHHEHPERKRAPQTYEKDGEDNNKGVLCTKDEWWWDCLEVLRENTLVTLANISGQLDLSAYTESICLPILDGMLHWLVCPSAEAQDPFPTVGPISFLSPQRLVLETLCKLSIQDNNVDLILATP----PFSRQEKLYATLVRYVGDRKNPVCREMSVALLSNLAQGDTLVARAIAV---QKGSIGNLISFLEDGVTMAQYQQSQHNLMHMQP----PHLEPPSADMMCRAAKALLAMAKVEENQSEFLL-QEGRLLDISISAVLNTVVASVICDVLFQI 1758          

HSP 2 Score: 118.627 bits (296), Expect = 9.209e-26
Identity = 56/118 (47.46%), Postives = 75/118 (63.56%), Query Frame = 1
Query: 1927 SQTNNSCYQKLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPIL 2280
            S T      KL ELGNEPER  W++RYL FM+E  TP++ +P V K+PLDL RLY  V+E GGL  V K K+W+E+   +NV  S+S A +L++ YI+ L  +ECK +R    P  I 
Sbjct:  563 STTTGEKITKLYELGNEPERKMWVDRYLTFMEERGTPVANLPAVGKKPLDLVRLYFCVKEIGGLAQVNKNKKWRELSSNLNVGTSSSAASSLKKQYIQYLFAFECKIERGEEPPPEIF 680          

HSP 3 Score: 77.411 bits (189), Expect = 3.041e-13
Identity = 44/117 (37.61%), Postives = 66/117 (56.41%), Query Frame = 1
Query: 3748 RYDSLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFGRDLFIKDLELPVIIDESVSNKTD 4098
            R +  FPP SVEATQP    +RK ++KDI       V M+LKSGL+ E +WAL+ +NI   DD+     NL  L    + L++ +R  L  IFG    +K+ E+   + +++S  T+
Sbjct: 1117 RREITFPPGSVEATQPILKPRRKLTAKDIVTPEAWRVMMSLKSGLLAESTWALDTINILLYDDSTVATFNLSQLPGFLELLVEYFRKCLIDIFG---ILKEYEVGEAVQKALSPTTE 1230          
BLAST of ARID domain-containing protein vs. Ensembl Xenopus
Match: ARID1B (AT-rich interaction domain 1B [Source:NCBI gene;Acc:100493908])

HSP 1 Score: 119.783 bits (299), Expect = 4.235e-26
Identity = 110/319 (34.48%), Postives = 162/319 (50.78%), Query Frame = 1
Query: 4810 RCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEHSIDEWPPPNQEKEC-------------WWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPSH---RVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQE-LFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANA---QPNIISGLISFIE--ITESQIRHVVDN-MGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLL 5697
            RCI VSN IR+LSF+ GND  +  +  +++ILG+L+LL HEH   +  P   EK+              WW   ++ +RE+  VTL NIS  L+LS + E I  PI+ G+LHWL C SA A+D  P+      L  +RL LE++ +L + + N+D IL+T         QE L+  L          V +EMS+A++  L+       G   +A A   Q   I  LISF+E  +T +Q +    N M M+     P L   S + +  +   L  +A  E N+  F    E R+L++ IS VL+  VA  I  VL+ +
Sbjct: 1952 RCICVSNIIRSLSFVPGNDTEMSKHPGLVLILGKLILLHHEHPERKRAPQTYEKDGEDNNKGVLCTKDEWWWDCLEVLRENTLVTLANISGQLDLSAYTESICLPILDGMLHWLVCPSAEAQDPFPTVGPISFLSPQRLVLETLCKLSIQDNNVDLILATP----PFSRQEKLYATLVRYVGDRKNPVCREMSVALLSNLAQ------GDTLVARAIAVQKGSIGNLISFLEDGVTMAQYQQSQHNLMHMQP----PHLEPPSADMMCRAAKALLAMAKVEENQSEFLL-QEGRLLDISISAVLNTVVASVICDVLFQI 2255          

HSP 2 Score: 119.013 bits (297), Expect = 7.197e-26
Identity = 55/114 (48.25%), Postives = 74/114 (64.91%), Query Frame = 1
Query: 1927 SQTNNSCYQKLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADP 2268
            S T      KL ELGNEPER  W++RYL FM+E  TP++ +P V K+PLDL RLY  V+E GGL  V K K+W+E+   +NV  S+S A +L++ YI+ L  +ECK +R    P
Sbjct: 1060 STTTGEKITKLYELGNEPERKMWVDRYLTFMEERGTPVANLPAVGKKPLDLVRLYFCVKEIGGLAQVNKNKKWRELSSNLNVGTSSSAASSLKKQYIQYLFAFECKIERGEEPP 1173          

HSP 3 Score: 77.411 bits (189), Expect = 3.359e-13
Identity = 44/117 (37.61%), Postives = 66/117 (56.41%), Query Frame = 1
Query: 3748 RYDSLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFGRDLFIKDLELPVIIDESVSNKTD 4098
            R +  FPP SVEATQP    +RK ++KDI       V M+LKSGL+ E +WAL+ +NI   DD+     NL  L    + L++ +R  L  IFG    +K+ E+   + +++S  T+
Sbjct: 1614 RREITFPPGSVEATQPILKPRRKLTAKDIVTPEAWRVMMSLKSGLLAESTWALDTINILLYDDSTVATFNLSQLPGFLELLVEYFRKCLIDIFG---ILKEYEVGEAVQKALSPTTE 1727          
BLAST of ARID domain-containing protein vs. Ensembl Xenopus
Match: ARID1B (AT-rich interaction domain 1B [Source:NCBI gene;Acc:100493908])

HSP 1 Score: 119.783 bits (299), Expect = 4.516e-26
Identity = 56/118 (47.46%), Postives = 75/118 (63.56%), Query Frame = 1
Query: 1927 SQTNNSCYQKLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPIL 2280
            S T      KL ELGNEPER  W++RYL FM+E  TP++ +P V K+PLDL RLY  V+E GGL  V K K+W+E+   +NV  S+S A +L++ YI+ L  +ECK +R    P  I 
Sbjct: 1127 STTTGEKITKLYELGNEPERKMWVDRYLTFMEERGTPVANLPAVGKKPLDLVRLYFCVKEIGGLAQVNKNKKWRELSSNLNVGTSSSAASSLKKQYIQYLFAFECKIERGEEPPPEIF 1244          

HSP 2 Score: 119.783 bits (299), Expect = 4.996e-26
Identity = 110/319 (34.48%), Postives = 162/319 (50.78%), Query Frame = 1
Query: 4810 RCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEHSIDEWPPPNQEKEC-------------WWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPSH---RVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQE-LFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANA---QPNIISGLISFIE--ITESQIRHVVDN-MGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLL 5697
            RCI VSN IR+LSF+ GND  +  +  +++ILG+L+LL HEH   +  P   EK+              WW   ++ +RE+  VTL NIS  L+LS + E I  PI+ G+LHWL C SA A+D  P+      L  +RL LE++ +L + + N+D IL+T         QE L+  L          V +EMS+A++  L+       G   +A A   Q   I  LISF+E  +T +Q +    N M M+     P L   S + +  +   L  +A  E N+  F    E R+L++ IS VL+  VA  I  VL+ +
Sbjct: 2058 RCICVSNIIRSLSFVPGNDTEMSKHPGLVLILGKLILLHHEHPERKRAPQTYEKDGEDNNKGVLCTKDEWWWDCLEVLRENTLVTLANISGQLDLSAYTESICLPILDGMLHWLVCPSAEAQDPFPTVGPISFLSPQRLVLETLCKLSIQDNNVDLILATP----PFSRQEKLYATLVRYVGDRKNPVCREMSVALLSNLAQ------GDTLVARAIAVQKGSIGNLISFLEDGVTMAQYQQSQHNLMHMQP----PHLEPPSADMMCRAAKALLAMAKVEENQSEFLL-QEGRLLDISISAVLNTVVASVICDVLFQI 2361          

HSP 3 Score: 77.0258 bits (188), Expect = 3.971e-13
Identity = 44/117 (37.61%), Postives = 66/117 (56.41%), Query Frame = 1
Query: 3748 RYDSLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFGRDLFIKDLELPVIIDESVSNKTD 4098
            R +  FPP SVEATQP    +RK ++KDI       V M+LKSGL+ E +WAL+ +NI   DD+     NL  L    + L++ +R  L  IFG    +K+ E+   + +++S  T+
Sbjct: 1720 RREITFPPGSVEATQPILKPRRKLTAKDIVTPEAWRVMMSLKSGLLAESTWALDTINILLYDDSTVATFNLSQLPGFLELLVEYFRKCLIDIFG---ILKEYEVGEAVQKALSPTTE 1833          
BLAST of ARID domain-containing protein vs. Ensembl Xenopus
Match: ARID1B (AT-rich interaction domain 1B [Source:NCBI gene;Acc:100493908])

HSP 1 Score: 119.783 bits (299), Expect = 4.637e-26
Identity = 56/118 (47.46%), Postives = 75/118 (63.56%), Query Frame = 1
Query: 1927 SQTNNSCYQKLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPIL 2280
            S T      KL ELGNEPER  W++RYL FM+E  TP++ +P V K+PLDL RLY  V+E GGL  V K K+W+E+   +NV  S+S A +L++ YI+ L  +ECK +R    P  I 
Sbjct: 1176 STTTGEKITKLYELGNEPERKMWVDRYLTFMEERGTPVANLPAVGKKPLDLVRLYFCVKEIGGLAQVNKNKKWRELSSNLNVGTSSSAASSLKKQYIQYLFAFECKIERGEEPPPEIF 1293          

HSP 2 Score: 119.398 bits (298), Expect = 5.130e-26
Identity = 110/319 (34.48%), Postives = 162/319 (50.78%), Query Frame = 1
Query: 4810 RCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEHSIDEWPPPNQEKEC-------------WWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPSH---RVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQE-LFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANA---QPNIISGLISFIE--ITESQIRHVVDN-MGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLL 5697
            RCI VSN IR+LSF+ GND  +  +  +++ILG+L+LL HEH   +  P   EK+              WW   ++ +RE+  VTL NIS  L+LS + E I  PI+ G+LHWL C SA A+D  P+      L  +RL LE++ +L + + N+D IL+T         QE L+  L          V +EMS+A++  L+       G   +A A   Q   I  LISF+E  +T +Q +    N M M+     P L   S + +  +   L  +A  E N+  F    E R+L++ IS VL+  VA  I  VL+ +
Sbjct: 2068 RCICVSNIIRSLSFVPGNDTEMSKHPGLVLILGKLILLHHEHPERKRAPQTYEKDGEDNNKGVLCTKDEWWWDCLEVLRENTLVTLANISGQLDLSAYTESICLPILDGMLHWLVCPSAEAQDPFPTVGPISFLSPQRLVLETLCKLSIQDNNVDLILATP----PFSRQEKLYATLVRYVGDRKNPVCREMSVALLSNLAQ------GDTLVARAIAVQKGSIGNLISFLEDGVTMAQYQQSQHNLMHMQP----PHLEPPSADMMCRAAKALLAMAKVEENQSEFLL-QEGRLLDISISAVLNTVVASVICDVLFQI 2371          

HSP 3 Score: 77.0258 bits (188), Expect = 3.875e-13
Identity = 44/117 (37.61%), Postives = 66/117 (56.41%), Query Frame = 1
Query: 3748 RYDSLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFGRDLFIKDLELPVIIDESVSNKTD 4098
            R +  FPP SVEATQP    +RK ++KDI       V M+LKSGL+ E +WAL+ +NI   DD+     NL  L    + L++ +R  L  IFG    +K+ E+   + +++S  T+
Sbjct: 1730 RREITFPPGSVEATQPILKPRRKLTAKDIVTPEAWRVMMSLKSGLLAESTWALDTINILLYDDSTVATFNLSQLPGFLELLVEYFRKCLIDIFG---ILKEYEVGEAVQKALSPTTE 1843          
BLAST of ARID domain-containing protein vs. Ensembl Mouse
Match: Arid1b (AT rich interactive domain 1B (SWI-like) [Source:MGI Symbol;Acc:MGI:1926129])

HSP 1 Score: 134.42 bits (337), Expect = 1.211e-30
Identity = 111/316 (35.13%), Postives = 167/316 (52.85%), Query Frame = 1
Query: 4810 RCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEHSIDEWPPPNQEKE--------C----WWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPS---HRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQ--VVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIE--ITESQIRHVVDN-MGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLL 5697
            RCI VSN +R+LSF+ GND  +  +  +++ILG+L+LL HEH   +  P   EKE        C    WW   ++ +R++  VTL NIS  L+LS + E I  PI+ GLLHW+ C SA A+D  P+   + VL  +RL LE++ +L + + N+D IL+T         QE F      +   D +  V +EMS+A++  L+ G       I +   Q   I  LISF+E  +T +Q +    N M M+     P L   S++ +  +   L  +A  + NR  F   HE R+L++ IS VL+  VA  I  VL+ +
Sbjct: 1457 RCICVSNIVRSLSFVPGNDAEMSKHPGLVLILGKLILLHHEHPERKRAPQTYEKEEDEDKGVACSKDEWWWDCLEVLRDNTLVTLANISGQLDLSAYTESICLPILDGLLHWMVCPSAEAQDPFPTVGPNSVLSPQRLVLETLCKLSIQDNNVDLILATP----PFSRQEKFYATLVRYVG-DRKNPVCREMSMALLSNLAQGDTLAARAIAV---QKGSIGNLISFLEDGVTMAQYQQSQHNLMHMQP----PPLEPPSVDMMCRAAKALLAMARVDENRSEFLL-HEGRLLDISISAVLNSLVASVICDVLFQI 1759          

HSP 2 Score: 121.709 bits (304), Expect = 8.409e-27
Identity = 58/121 (47.93%), Postives = 81/121 (66.94%), Query Frame = 1
Query: 1954 KLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPILQEIQSLSDKKKK 2316
            K+ ELGNEPER  W++RYL FM+E  +P+S++P V K+PLDLFRLY  V+E GGL  V K K+W+E+   +NV  S+S A +L++ YI+ L  +ECK +R    P     E+ S  D KK+
Sbjct:  572 KVYELGNEPERKLWVDRYLTFMEERGSPVSSLPAVGKKPLDLFRLYVCVKEIGGLAQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQYLFAFECKTERGEEPP----PEVFSTGDSKKQ 688          

HSP 3 Score: 75.8702 bits (185), Expect = 6.652e-13
Identity = 44/108 (40.74%), Postives = 61/108 (56.48%), Query Frame = 1
Query: 3706 SQITYSKSSSHFIKRYDSLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFG 4029
            SQ+T        I+R +  FPP SVEA+QP   ++RK +SKDI       V M+LKSGL+ E +WAL+ +NI   DD+     NL  L    + L++ +R  L  IFG
Sbjct: 1103 SQVTGPPPQPPPIRR-EITFPPGSVEASQPILKQRRKITSKDIVTPEAWRVMMSLKSGLLAESTWALDTINILLYDDSTVATFNLSQLSGFLELLVEYFRKCLIDIFG 1209          
BLAST of ARID domain-containing protein vs. Ensembl Mouse
Match: Arid1b (AT rich interactive domain 1B (SWI-like) [Source:MGI Symbol;Acc:MGI:1926129])

HSP 1 Score: 134.035 bits (336), Expect = 1.621e-30
Identity = 111/316 (35.13%), Postives = 167/316 (52.85%), Query Frame = 1
Query: 4810 RCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEHSIDEWPPPNQEKE--------C----WWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPS---HRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQ--VVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIE--ITESQIRHVVDN-MGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLL 5697
            RCI VSN +R+LSF+ GND  +  +  +++ILG+L+LL HEH   +  P   EKE        C    WW   ++ +R++  VTL NIS  L+LS + E I  PI+ GLLHW+ C SA A+D  P+   + VL  +RL LE++ +L + + N+D IL+T         QE F      +   D +  V +EMS+A++  L+ G       I +   Q   I  LISF+E  +T +Q +    N M M+     P L   S++ +  +   L  +A  + NR  F   HE R+L++ IS VL+  VA  I  VL+ +
Sbjct: 1939 RCICVSNIVRSLSFVPGNDAEMSKHPGLVLILGKLILLHHEHPERKRAPQTYEKEEDEDKGVACSKDEWWWDCLEVLRDNTLVTLANISGQLDLSAYTESICLPILDGLLHWMVCPSAEAQDPFPTVGPNSVLSPQRLVLETLCKLSIQDNNVDLILATP----PFSRQEKFYATLVRYVG-DRKNPVCREMSMALLSNLAQGDTLAARAIAV---QKGSIGNLISFLEDGVTMAQYQQSQHNLMHMQP----PPLEPPSVDMMCRAAKALLAMARVDENRSEFLL-HEGRLLDISISAVLNSLVASVICDVLFQI 2241          

HSP 2 Score: 122.479 bits (306), Expect = 5.607e-27
Identity = 58/121 (47.93%), Postives = 81/121 (66.94%), Query Frame = 1
Query: 1954 KLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPILQEIQSLSDKKKK 2316
            K+ ELGNEPER  W++RYL FM+E  +P+S++P V K+PLDLFRLY  V+E GGL  V K K+W+E+   +NV  S+S A +L++ YI+ L  +ECK +R    P     E+ S  D KK+
Sbjct: 1054 KVYELGNEPERKLWVDRYLTFMEERGSPVSSLPAVGKKPLDLFRLYVCVKEIGGLAQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQYLFAFECKTERGEEPP----PEVFSTGDSKKQ 1170          

HSP 3 Score: 75.8702 bits (185), Expect = 7.907e-13
Identity = 44/108 (40.74%), Postives = 61/108 (56.48%), Query Frame = 1
Query: 3706 SQITYSKSSSHFIKRYDSLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFG 4029
            SQ+T        I+R +  FPP SVEA+QP   ++RK +SKDI       V M+LKSGL+ E +WAL+ +NI   DD+     NL  L    + L++ +R  L  IFG
Sbjct: 1585 SQVTGPPPQPPPIRR-EITFPPGSVEASQPILKQRRKITSKDIVTPEAWRVMMSLKSGLLAESTWALDTINILLYDDSTVATFNLSQLSGFLELLVEYFRKCLIDIFG 1691          
BLAST of ARID domain-containing protein vs. Ensembl Mouse
Match: Arid1b (AT rich interactive domain 1B (SWI-like) [Source:MGI Symbol;Acc:MGI:1926129])

HSP 1 Score: 134.035 bits (336), Expect = 1.719e-30
Identity = 111/316 (35.13%), Postives = 167/316 (52.85%), Query Frame = 1
Query: 4810 RCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEHSIDEWPPPNQEKE--------C----WWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPS---HRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQ--VVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIE--ITESQIRHVVDN-MGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLL 5697
            RCI VSN +R+LSF+ GND  +  +  +++ILG+L+LL HEH   +  P   EKE        C    WW   ++ +R++  VTL NIS  L+LS + E I  PI+ GLLHW+ C SA A+D  P+   + VL  +RL LE++ +L + + N+D IL+T         QE F      +   D +  V +EMS+A++  L+ G       I +   Q   I  LISF+E  +T +Q +    N M M+     P L   S++ +  +   L  +A  + NR  F   HE R+L++ IS VL+  VA  I  VL+ +
Sbjct: 1991 RCICVSNIVRSLSFVPGNDAEMSKHPGLVLILGKLILLHHEHPERKRAPQTYEKEEDEDKGVACSKDEWWWDCLEVLRDNTLVTLANISGQLDLSAYTESICLPILDGLLHWMVCPSAEAQDPFPTVGPNSVLSPQRLVLETLCKLSIQDNNVDLILATP----PFSRQEKFYATLVRYVG-DRKNPVCREMSMALLSNLAQGDTLAARAIAV---QKGSIGNLISFLEDGVTMAQYQQSQHNLMHMQP----PPLEPPSVDMMCRAAKALLAMARVDENRSEFLL-HEGRLLDISISAVLNSLVASVICDVLFQI 2293          

HSP 2 Score: 122.094 bits (305), Expect = 5.841e-27
Identity = 58/121 (47.93%), Postives = 81/121 (66.94%), Query Frame = 1
Query: 1954 KLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPILQEIQSLSDKKKK 2316
            K+ ELGNEPER  W++RYL FM+E  +P+S++P V K+PLDLFRLY  V+E GGL  V K K+W+E+   +NV  S+S A +L++ YI+ L  +ECK +R    P     E+ S  D KK+
Sbjct: 1106 KVYELGNEPERKLWVDRYLTFMEERGSPVSSLPAVGKKPLDLFRLYVCVKEIGGLAQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQYLFAFECKTERGEEPP----PEVFSTGDSKKQ 1222          

HSP 3 Score: 75.8702 bits (185), Expect = 8.004e-13
Identity = 44/108 (40.74%), Postives = 61/108 (56.48%), Query Frame = 1
Query: 3706 SQITYSKSSSHFIKRYDSLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFG 4029
            SQ+T        I+R +  FPP SVEA+QP   ++RK +SKDI       V M+LKSGL+ E +WAL+ +NI   DD+     NL  L    + L++ +R  L  IFG
Sbjct: 1637 SQVTGPPPQPPPIRR-EITFPPGSVEASQPILKQRRKITSKDIVTPEAWRVMMSLKSGLLAESTWALDTINILLYDDSTVATFNLSQLSGFLELLVEYFRKCLIDIFG 1743          
BLAST of ARID domain-containing protein vs. Ensembl Mouse
Match: Arid1b (AT rich interactive domain 1B (SWI-like) [Source:MGI Symbol;Acc:MGI:1926129])

HSP 1 Score: 133.65 bits (335), Expect = 1.984e-30
Identity = 111/316 (35.13%), Postives = 167/316 (52.85%), Query Frame = 1
Query: 4810 RCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEHSIDEWPPPNQEKE--------C----WWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPS---HRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQ--VVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIE--ITESQIRHVVDN-MGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLL 5697
            RCI VSN +R+LSF+ GND  +  +  +++ILG+L+LL HEH   +  P   EKE        C    WW   ++ +R++  VTL NIS  L+LS + E I  PI+ GLLHW+ C SA A+D  P+   + VL  +RL LE++ +L + + N+D IL+T         QE F      +   D +  V +EMS+A++  L+ G       I +   Q   I  LISF+E  +T +Q +    N M M+     P L   S++ +  +   L  +A  + NR  F   HE R+L++ IS VL+  VA  I  VL+ +
Sbjct: 1938 RCICVSNIVRSLSFVPGNDAEMSKHPGLVLILGKLILLHHEHPERKRAPQTYEKEEDEDKGVACSKDEWWWDCLEVLRDNTLVTLANISGQLDLSAYTESICLPILDGLLHWMVCPSAEAQDPFPTVGPNSVLSPQRLVLETLCKLSIQDNNVDLILATP----PFSRQEKFYATLVRYVG-DRKNPVCREMSMALLSNLAQGDTLAARAIAV---QKGSIGNLISFLEDGVTMAQYQQSQHNLMHMQP----PPLEPPSVDMMCRAAKALLAMARVDENRSEFLL-HEGRLLDISISAVLNSLVASVICDVLFQI 2240          

HSP 2 Score: 123.25 bits (308), Expect = 3.007e-27
Identity = 59/128 (46.09%), Postives = 82/128 (64.06%), Query Frame = 1
Query: 1933 TNNSCYQKLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPILQEIQSLSDKKKK 2316
            T      K+ ELGNEPER  W++RYL FM+E  +P+S++P V K+PLDLFRLY  V+E GGL  V K K+W+E+   +NV  S+S A +L++ YI+ L  +ECK +R    P     E+ S  D KK+
Sbjct: 1046 TTGEKITKVYELGNEPERKLWVDRYLTFMEERGSPVSSLPAVGKKPLDLFRLYVCVKEIGGLAQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQYLFAFECKTERGEEPP----PEVFSTGDSKKQ 1169          

HSP 3 Score: 75.8702 bits (185), Expect = 7.455e-13
Identity = 44/108 (40.74%), Postives = 61/108 (56.48%), Query Frame = 1
Query: 3706 SQITYSKSSSHFIKRYDSLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFG 4029
            SQ+T        I+R +  FPP SVEA+QP   ++RK +SKDI       V M+LKSGL+ E +WAL+ +NI   DD+     NL  L    + L++ +R  L  IFG
Sbjct: 1584 SQVTGPPPQPPPIRR-EITFPPGSVEASQPILKQRRKITSKDIVTPEAWRVMMSLKSGLLAESTWALDTINILLYDDSTVATFNLSQLSGFLELLVEYFRKCLIDIFG 1690          
BLAST of ARID domain-containing protein vs. Ensembl Mouse
Match: Arid1a (AT rich interactive domain 1A (SWI-like) [Source:MGI Symbol;Acc:MGI:1935147])

HSP 1 Score: 119.013 bits (297), Expect = 5.358e-26
Identity = 98/311 (31.51%), Postives = 166/311 (53.38%), Query Frame = 1
Query: 4810 RCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEHSIDEWPPPNQEKE--------C----WWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAED---SLPSHRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIEITESQIRHVVDNMGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLL 5697
            RC+ VSN+IR+LSF+ GND  +  +  +L+ILG+L+LL H+H   +  P   EKE        C    WW   ++ +RE+  VTL NIS  L+LS + E I  P++ GLLHW  C SA A+D   +L  + VL  +RL LE++ +L + + N+D IL+T        +++L++ +          V +EM++ ++  L+ G       I +   Q   I  L+ F+E + +  +       +  +Q  P    TS++ +R +   L  LA  + N   F+  +E R+L++ +S +++  V+Q I  VL+L+
Sbjct: 1597 RCVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQGVSCDKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQDPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSR---LEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAV---QKGSIGNLLGFLEDSLAATQFQQSQASLLHMQ-NPPFEPTSVDMMRRAARALLALAKVDENHSEFTL-YESRLLDISVSPLMNSLVSQVICDVLFLI 1899          

HSP 2 Score: 115.931 bits (289), Expect = 4.221e-25
Identity = 56/125 (44.80%), Postives = 81/125 (64.80%), Query Frame = 1
Query: 1939 NSCYQKLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPILQEIQSLSDKKK 2313
            N    KL ELG EPER  W++RYL F +E    ++ +P V ++PLDL+RLY +V+E GGL  V K K+W+E+   +NV  S+S A +L++ YI+CL  +ECK +R   DP P   +I + +D KK
Sbjct:  621 NEKITKLYELGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQCLYAFECKIERGE-DPPP---DIFAAADSKK 741          

HSP 3 Score: 73.1738 bits (178), Expect = 4.378e-12
Identity = 42/104 (40.38%), Postives = 59/104 (56.73%), Query Frame = 1
Query: 3748 RYDSLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFGRDLFIKDLEL 4059
            R D  FPP SVEATQP   ++R+ + KDI       V M+LKSGL+ E +WAL+ +NI   DD      NL  L  + + L++ +R  L  IFG    +K+ E+
Sbjct: 1256 RRDITFPPGSVEATQPVLKQRRRLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQLPGLLELLVEYFRRCLIEIFG---ILKEYEV 1356          
BLAST of ARID domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8IN94|OSA_DROME (Trithorax group protein osa OS=Drosophila melanogaster OX=7227 GN=osa PE=1 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 7.968e-43
Identity = 119/325 (36.62%), Postives = 180/325 (55.38%), Query Frame = 1
Query: 4780 IIESDEEKMMRCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEHSIDEWPPPNQEKE--------C--------WWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPS---HRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIEITESQIRHVVDNMGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLL 5697
            + ES +    RCI++SN  RNL+F+ GN+ ++  +   L +LGRLLLL HEH        N ++E        C        WW  ++  IRE++ V + NI+ +LELS++ E+I RP++ GLLHW  C SA  +D  PS   + VL  +RLALE++ +LCV + N+D +++T        +++L   L    C  + QV++E S+ ++HYL+         + L   Q   IS L++FIE  E     V +  G+  L+  P+ MGTSL+ LR +   L  LA +  NR  F +  E R+L LV+S +LDQ VA  IS VLY +
Sbjct: 2185 VSESQDSLARRCIALSNIFRNLTFVPGNETVLAKSTRFLAVLGRLLLLNHEHLRRTPKTRNYDREEDTDFSDSCSSLQGEREWWWDYLITIRENMLVAMANIAGHLELSRYDELIARPLIDGLLHWAVCPSAHGQDPFPSCGPNSVLSPQRLALEALCKLCVTDANVDLVIATPPFSR---LEKLCAVLTRHLCRNEDQVLREFSVNLLHYLAAADSAMARTVAL---QSPCISYLVAFIEQAEQTALGVANQHGINYLRENPDSMGTSLDMLRRAAGTLLHLAKHPDNRSLFMQ-QEQRLLGLVMSHILDQQVALIISRVLYQV 2502          

HSP 2 Score: 149.443 bits (376), Expect = 2.670e-34
Identity = 87/242 (35.95%), Postives = 130/242 (53.72%), Query Frame = 1
Query: 1591 HPATPVSNTVPSPSQTSMSSMVDENEDSVSSLGPNETNMLHHPSISNQSQFNQHQITPPMSQNHSII-YPQPYPNNQVPHTMMSSFPSHLPPQQRPFTPNPNMIPNRQYHHNESQTNNS-CYQKLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPILQEIQSLSDKK 2310
            H  T V  T   P  TSM  +  ++  S +S    E      P       ++Q  + PP +  H ++ +P   P  +     MSS P+   P   P   N   +P   +    + T  S    KL E+ + P+R  W+++   FM+E  TP++A PT+ KQPLDL+RLY  V+ERGG + V K+K WK+I  ++ + AS+S AYTLR++Y K LL +EC FDR   DP PI+Q++++ S KK
Sbjct:  875 HAVTSVVTT--GPDGTSMDEVSQQSTLSNASAASGEDPQCTTPKSRKNDPYSQSHLAPPSTSPHPVVMHPGGGPGEEY---DMSSPPNWPRPAGSPQVFNHVPVPQEPFRSTITTTKKSDSLCKLYEMDDNPDRRGWLDKLRAFMEERRTPITACPTISKQPLDLYRLYIYVKERGGFVEVTKSKTWKDIAGLLGIGASSSAAYTLRKHYTKNLLTFECHFDRGDIDPLPIIQQVEAGSKKK 1111          
BLAST of ARID domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8NFD5|ARI1B_HUMAN (AT-rich interactive domain-containing protein 1B OS=Homo sapiens OX=9606 GN=ARID1B PE=1 SV=2)

HSP 1 Score: 134.42 bits (337), Expect = 8.796e-30
Identity = 111/316 (35.13%), Postives = 169/316 (53.48%), Query Frame = 1
Query: 4810 RCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEHSIDEWPPPNQEKE--------C----WWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPS---HRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQ--VVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIE--ITESQIRHVVDN-MGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLL 5697
            RCI VSN +R+LSF+ GND  +  +  +++ILG+L+LL HEH   +  P   EKE        C    WW   ++ +R++  VTL NIS  L+LS + E I  PI+ GLLHW+ C SA A+D  P+   + VL  +RL LE++ +L + + N+D IL+T         QE F      +   D +  V +EMS+A++  L+ G  + +    +A  Q   I  LISF+E  +T +Q +    N M M+     P L   S++ +  +   L  +A  + NR  F   HE R+L++ IS VL+  VA  I  VL+ +
Sbjct: 1931 RCICVSNIVRSLSFVPGNDAEMSKHPGLVLILGKLILLHHEHPERKRAPQTYEKEEDEDKGVACSKDEWWWDCLEVLRDNTLVTLANISGQLDLSAYTESICLPILDGLLHWMVCPSAEAQDPFPTVGPNSVLSPQRLVLETLCKLSIQDNNVDLILATP----PFSRQEKFYATLVRYVG-DRKNPVCREMSMALLSNLAQG--DALAARAIA-VQKGSIGNLISFLEDGVTMAQYQQSQHNLMHMQP----PPLEPPSVDMMCRAAKALLAMARVDENRSEFLL-HEGRLLDISISAVLNSLVASVICDVLFQI 2233          

HSP 2 Score: 123.635 bits (309), Expect = 1.391e-26
Identity = 58/121 (47.93%), Postives = 81/121 (66.94%), Query Frame = 1
Query: 1954 KLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPILQEIQSLSDKKKK 2316
            K+ ELGNEPER  W++RYL FM+E  +P+S++P V K+PLDLFRLY  V+E GGL  V K K+W+E+   +NV  S+S A +L++ YI+ L  +ECK +R    P     E+ S  D KK+
Sbjct: 1046 KVYELGNEPERKLWVDRYLTFMEERGSPVSSLPAVGKKPLDLFRLYVCVKEIGGLAQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQYLFAFECKIERGEEPP----PEVFSTGDTKKQ 1162          

HSP 3 Score: 75.8702 bits (185), Expect = 4.712e-12
Identity = 44/108 (40.74%), Postives = 61/108 (56.48%), Query Frame = 1
Query: 3706 SQITYSKSSSHFIKRYDSLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFG 4029
            SQ+T        I+R +  FPP SVEA+QP   ++RK +SKDI       V M+LKSGL+ E +WAL+ +NI   DD+     NL  L    + L++ +R  L  IFG
Sbjct: 1577 SQVTGPPPQPPPIRR-EITFPPGSVEASQPVLKQRRKITSKDIVTPEAWRVMMSLKSGLLAESTWALDTINILLYDDSTVATFNLSQLSGFLELLVEYFRKCLIDIFG 1683          
BLAST of ARID domain-containing protein vs. UniProt/SwissProt
Match: sp|E9Q4N7|ARI1B_MOUSE (AT-rich interactive domain-containing protein 1B OS=Mus musculus OX=10090 GN=Arid1b PE=1 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 1.134e-29
Identity = 111/316 (35.13%), Postives = 167/316 (52.85%), Query Frame = 1
Query: 4810 RCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEHSIDEWPPPNQEKE--------C----WWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPS---HRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQ--VVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIE--ITESQIRHVVDN-MGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLL 5697
            RCI VSN +R+LSF+ GND  +  +  +++ILG+L+LL HEH   +  P   EKE        C    WW   ++ +R++  VTL NIS  L+LS + E I  PI+ GLLHW+ C SA A+D  P+   + VL  +RL LE++ +L + + N+D IL+T         QE F      +   D +  V +EMS+A++  L+ G       I +   Q   I  LISF+E  +T +Q +    N M M+     P L   S++ +  +   L  +A  + NR  F   HE R+L++ IS VL+  VA  I  VL+ +
Sbjct: 1939 RCICVSNIVRSLSFVPGNDAEMSKHPGLVLILGKLILLHHEHPERKRAPQTYEKEEDEDKGVACSKDEWWWDCLEVLRDNTLVTLANISGQLDLSAYTESICLPILDGLLHWMVCPSAEAQDPFPTVGPNSVLSPQRLVLETLCKLSIQDNNVDLILATP----PFSRQEKFYATLVRYVG-DRKNPVCREMSMALLSNLAQGDTLAARAIAV---QKGSIGNLISFLEDGVTMAQYQQSQHNLMHMQP----PPLEPPSVDMMCRAAKALLAMARVDENRSEFLL-HEGRLLDISISAVLNSLVASVICDVLFQI 2241          

HSP 2 Score: 122.479 bits (306), Expect = 3.922e-26
Identity = 58/121 (47.93%), Postives = 81/121 (66.94%), Query Frame = 1
Query: 1954 KLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPILQEIQSLSDKKKK 2316
            K+ ELGNEPER  W++RYL FM+E  +P+S++P V K+PLDLFRLY  V+E GGL  V K K+W+E+   +NV  S+S A +L++ YI+ L  +ECK +R    P     E+ S  D KK+
Sbjct: 1054 KVYELGNEPERKLWVDRYLTFMEERGSPVSSLPAVGKKPLDLFRLYVCVKEIGGLAQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQYLFAFECKTERGEEPP----PEVFSTGDSKKQ 1170          

HSP 3 Score: 75.8702 bits (185), Expect = 5.531e-12
Identity = 44/108 (40.74%), Postives = 61/108 (56.48%), Query Frame = 1
Query: 3706 SQITYSKSSSHFIKRYDSLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFG 4029
            SQ+T        I+R +  FPP SVEA+QP   ++RK +SKDI       V M+LKSGL+ E +WAL+ +NI   DD+     NL  L    + L++ +R  L  IFG
Sbjct: 1585 SQVTGPPPQPPPIRR-EITFPPGSVEASQPILKQRRKITSKDIVTPEAWRVMMSLKSGLLAESTWALDTINILLYDDSTVATFNLSQLSGFLELLVEYFRKCLIDIFG 1691          
BLAST of ARID domain-containing protein vs. UniProt/SwissProt
Match: sp|A2BH40|ARI1A_MOUSE (AT-rich interactive domain-containing protein 1A OS=Mus musculus OX=10090 GN=Arid1a PE=1 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 5.223e-25
Identity = 98/311 (31.51%), Postives = 166/311 (53.38%), Query Frame = 1
Query: 4810 RCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEHSIDEWPPPNQEKE--------C----WWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAED---SLPSHRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIEITESQIRHVVDNMGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLL 5697
            RC+ VSN+IR+LSF+ GND  +  +  +L+ILG+L+LL H+H   +  P   EKE        C    WW   ++ +RE+  VTL NIS  L+LS + E I  P++ GLLHW  C SA A+D   +L  + VL  +RL LE++ +L + + N+D IL+T        +++L++ +          V +EM++ ++  L+ G       I +   Q   I  L+ F+E + +  +       +  +Q  P    TS++ +R +   L  LA  + N   F+  +E R+L++ +S +++  V+Q I  VL+L+
Sbjct: 1978 RCVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQGVSCDKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQDPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSR---LEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAV---QKGSIGNLLGFLEDSLAATQFQQSQASLLHMQ-NPPFEPTSVDMMRRAARALLALAKVDENHSEFTL-YESRLLDISVSPLMNSLVSQVICDVLFLI 2280          

HSP 2 Score: 116.316 bits (290), Expect = 2.436e-24
Identity = 56/125 (44.80%), Postives = 81/125 (64.80%), Query Frame = 1
Query: 1939 NSCYQKLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPILQEIQSLSDKKK 2313
            N    KL ELG EPER  W++RYL F +E    ++ +P V ++PLDL+RLY +V+E GGL  V K K+W+E+   +NV  S+S A +L++ YI+CL  +ECK +R   DP P   +I + +D KK
Sbjct: 1006 NEKITKLYELGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQCLYAFECKIERGE-DPPP---DIFAAADSKK 1126          

HSP 3 Score: 72.7886 bits (177), Expect = 4.000e-11
Identity = 42/104 (40.38%), Postives = 59/104 (56.73%), Query Frame = 1
Query: 3748 RYDSLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFGRDLFIKDLEL 4059
            R D  FPP SVEATQP   ++R+ + KDI       V M+LKSGL+ E +WAL+ +NI   DD      NL  L  + + L++ +R  L  IFG    +K+ E+
Sbjct: 1637 RRDITFPPGSVEATQPVLKQRRRLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQLPGLLELLVEYFRRCLIEIFG---ILKEYEV 1737          
BLAST of ARID domain-containing protein vs. UniProt/SwissProt
Match: sp|O14497|ARI1A_HUMAN (AT-rich interactive domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ARID1A PE=1 SV=3)

HSP 1 Score: 118.627 bits (296), Expect = 5.313e-25
Identity = 98/311 (31.51%), Postives = 166/311 (53.38%), Query Frame = 1
Query: 4810 RCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEHSIDEWPPPNQEKE--------C----WWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAED---SLPSHRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIEITESQIRHVVDNMGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLL 5697
            RC+ VSN+IR+LSF+ GND  +  +  +L+ILG+L+LL H+H   +  P   EKE        C    WW   ++ +RE+  VTL NIS  L+LS + E I  P++ GLLHW  C SA A+D   +L  + VL  +RL LE++ +L + + N+D IL+T        +++L++ +          V +EM++ ++  L+ G       I +   Q   I  L+ F+E + +  +       +  +Q  P    TS++ +R +   L  LA  + N   F+  +E R+L++ +S +++  V+Q I  VL+L+
Sbjct: 1980 RCVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQGVSCNKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQDPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSR---LEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAV---QKGSIGNLLGFLEDSLAATQFQQSQASLLHMQ-NPPFEPTSVDMMRRAARALLALAKVDENHSEFTL-YESRLLDISVSPLMNSLVSQVICDVLFLI 2282          

HSP 2 Score: 115.931 bits (289), Expect = 3.355e-24
Identity = 56/125 (44.80%), Postives = 81/125 (64.80%), Query Frame = 1
Query: 1939 NSCYQKLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPILQEIQSLSDKKK 2313
            N    KL ELG EPER  W++RYL F +E    ++ +P V ++PLDL+RLY +V+E GGL  V K K+W+E+   +NV  S+S A +L++ YI+CL  +ECK +R   DP P   +I + +D KK
Sbjct: 1005 NEKITKLYELGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQCLYAFECKIERGE-DPPP---DIFAAADSKK 1125          

HSP 3 Score: 73.1738 bits (178), Expect = 3.381e-11
Identity = 42/104 (40.38%), Postives = 59/104 (56.73%), Query Frame = 1
Query: 3748 RYDSLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFGRDLFIKDLEL 4059
            R D  FPP SVEATQP   ++R+ + KDI       V M+LKSGL+ E +WAL+ +NI   DD      NL  L  + + L++ +R  L  IFG    +K+ E+
Sbjct: 1636 RRDITFPPGSVEATQPVLKQRRRLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQLPGLLELLVEYFRRCLIEIFG---ILKEYEV 1736          
BLAST of ARID domain-containing protein vs. TrEMBL
Match: G4VMH9 (ARID domain-containing protein OS=Schistosoma mansoni OX=6183 GN=Smp_156170 PE=4 SV=1)

HSP 1 Score: 270.396 bits (690), Expect = 1.218e-68
Identity = 155/351 (44.16%), Postives = 223/351 (63.53%), Query Frame = 1
Query: 4684 DLKFEETNEEIDFFRLQAKSEIVNDGEGLFFK---IIESDEEKMMRCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEH--SIDEWPPPNQEKE-------CWWLK-WIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPSHRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIEITESQIRHVVDNMGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLL 5697
            +L+F +  +E     L+A+ E+V+ G    +      +S E + +RC+ VS  +RNLSF++  +R +   + +L ++GRLLL GHEH    D W    ++          WW   W++D+RE+  V LVN++ YLEL +  E IVRPI+ GLLHW+TC+++A+ D  P HR L  RRLALE++ RLCVHE N+D +LST +   + V+  LF+ LA     P+ QV +E++L+ MHYL+ GG   IG   LA+A+P  ISGL+SFIE  E+  R V+D  G++ALQ RPELMGTSLE +R +GALL+RLA     R  F+ D E+R+++LV S VLD TVA  + G L+ L
Sbjct: 1991 ELEFSQLIDENGRCPLRAREELVHHGSVCLWPNHNETDSYEARAVRCLCVSTVLRNLSFMNTVERQLSKQKGVLALIGRLLLFGHEHVGENDTWQVVEEKAHSLESSFCAWWTPTWLEDMRENAMVLLVNVAGYLELIQFDESIVRPILEGLLHWITCSTSASVDPFPGHRTLSPRRLALEALNRLCVHETNVDLLLSTPSD--EKVLSRLFDRLATWLAVPEDQVTRELALSTMHYLA-GGGTYIGTTMLADAKPCPISGLLSFIEAAEATTRRVIDQYGVQALQERPELMGTSLEMVRRAGALLDRLAIDSKGRLAFTPDLELRLMDLVTSRVLDATVAHLLCGALHRL 2338          

HSP 2 Score: 164.466 bits (415), Expect = 1.903e-36
Identity = 77/139 (55.40%), Postives = 102/139 (73.38%), Query Frame = 1
Query: 1909 QYHHNESQTNNSCYQKLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPILQEIQSLSDKKKKSTS 2325
            Q  +N S  + S + KL+E+G E ER PW+E Y+RFM     P++ +P VVKQPLDL+RLY AVRERGG+  V+K +RWKEI  ++N++ASAS AY LR+NY K LL+YEC+FDR   DP P+L  I+SLS KK+K +S
Sbjct:  894 QLLNNISSQSLSGFHKLIEMGTESERRPWLEHYIRFMDGIGKPVAGLPQVVKQPLDLYRLYVAVRERGGVAEVIKGRRWKEISQVINISASASAAYALRKNYCKFLLEYECRFDRGGTDPRPLLAHIESLSGKKRKCSS 1032          

HSP 3 Score: 100.138 bits (248), Expect = 6.506e-17
Identity = 49/110 (44.55%), Postives = 68/110 (61.82%), Query Frame = 1
Query: 3739 FIKRYD-SLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFGRDLFIKDLELPV 4065
             +KR D   FPP SVEAT  D  ++R+Y +KD+    P  + MAL+SGL  E+SWALN LNI  RD+   + +    L  +  +L+D+WR++LG +F   LFI  LELP 
Sbjct: 1402 ILKRLDHCAFPPGSVEATPVDSSRRRRYRAKDLGSIAPFKLLMALRSGLTAEVSWALNCLNILLRDENGMDFIIPSALPGLITSLVDLWRHTLGELFDHKLFITSLELPT 1511          
BLAST of ARID domain-containing protein vs. TrEMBL
Match: A0A183KPQ2 (ARID domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS17034 PE=4 SV=1)

HSP 1 Score: 268.855 bits (686), Expect = 1.310e-68
Identity = 154/351 (43.87%), Postives = 221/351 (62.96%), Query Frame = 1
Query: 4684 DLKFEETNEEIDFFRLQAKSEIVNDGEGLFFK---IIESDEEKMMRCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEH--SIDEWPPPNQEKEC-------WWLK-WIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPSHRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIEITESQIRHVVDNMGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLL 5697
            +L+F +  +E     L+A+ E+V+ G    +       S E + +RC+ VS  +RNLSF++  +R +   + +L ++GRL+L GHEH    D W    ++          WW   W++D+RE+  V LVN++ YLEL +  E IVRPI+ GLLHW+TC+++A+ D  P HR L  RRLALE++ RLCVHE N+D +LST +   + V+  LF+ LA     P+ QV +E++L+ MHYL+ GG   IG   LA+A+P  ISGL+SFIE  E+  R V+D  G++ALQ RPELMGTSLE +R +GALL RLA     R  F+ D E+R+++LV S VLD TVA  + G L+ L
Sbjct: 1040 ELEFSQLIDENGRCPLRAREELVHHGSVCLWPNHNEANSYEARAVRCLCVSTVLRNLSFMNTVERQLSKQKGVLALIGRLILFGHEHVGENDTWKVVEEKAHALESSFCAWWTPTWLEDMRENAMVLLVNVAGYLELIQFDESIVRPILEGLLHWITCSTSASVDPFPGHRTLSPRRLALEALNRLCVHETNVDLLLSTPSD--EKVLSRLFDRLATWLAVPEDQVTRELALSTMHYLA-GGGTFIGTTMLADAKPCPISGLLSFIEAAEATTRRVIDQYGVQALQERPELMGTSLEMVRRAGALLGRLAVDSKGRLAFTPDLELRLMDLVTSRVLDATVAHLLCGALHRL 1387          

HSP 2 Score: 153.295 bits (386), Expect = 4.005e-33
Identity = 70/120 (58.33%), Postives = 92/120 (76.67%), Query Frame = 1
Query: 1966 LGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPILQEIQSLSDKKKKSTS 2325
            +G EPER PW+E Y+RFM     P++ +P VVKQPLDL+RLY AVRERGG+  V+K +RWKEI  ++N++ASAS AY LR+NY K LL+YEC+FDR   DP P+L  I++LS KK+K +S
Sbjct:    1 MGTEPERRPWLEHYIRFMDGIGKPVAGLPQVVKQPLDLYRLYVAVRERGGVAEVIKGRRWKEISQVINISASASAAYALRKNYCKFLLEYECRFDRGGIDPRPLLAHIENLSGKKRKCSS 120          

HSP 3 Score: 70.4774 bits (171), Expect = 5.259e-8
Identity = 33/73 (45.21%), Postives = 46/73 (63.01%), Query Frame = 1
Query: 3847 PTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFGRDLFIKDLELPV 4065
            P  + MAL+SGL  E+SWALN LNI  RD+   + +    L  +  +L+D+WR++LG +F   LFI  LELP 
Sbjct:  488 PFKLLMALRSGLTAEVSWALNCLNILLRDENGIDFIVPSALPGLLTSLVDLWRHTLGELFDHKLFITSLELPT 560          
BLAST of ARID domain-containing protein vs. TrEMBL
Match: A0A183NEL5 (ARID domain-containing protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS551 PE=4 SV=1)

HSP 1 Score: 269.24 bits (687), Expect = 1.458e-68
Identity = 153/351 (43.59%), Postives = 221/351 (62.96%), Query Frame = 1
Query: 4684 DLKFEETNEEIDFFRLQAKSEIVNDGEGLFFK---IIESDEEKMMRCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEH--SIDEWPPPNQEKEC-------WWLK-WIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPSHRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIEITESQIRHVVDNMGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLL 5697
            +L+F +  +E     L+A+ E+V+ G    +       S E + +RC+ VS  +RNLSF++  +R +   + +L ++GRL+L GHEH    D W    ++          WW   W++D+RE+  V LVN++ YLEL +  E IVRPI+ GLLHW+TC+++A+ D  P HR L  RRLALE++ RLCVHE N+D +LST +   + V+  LF+ LA     P+ QV +E++L+ MHYL+ GG   +G   LA+A+P  ISGL+SFIE  E+  R V+D  G++ALQ RPELMGTSLE +R +GALL RLA     R  F+ D E+R+++LV S VLD TVA  + G L+ L
Sbjct: 1173 ELEFSQLIDENGRCPLRAREELVHHGSVCLWPNHNEANSYEARAVRCLCVSTVLRNLSFMNTVERQLSKQKGVLALIGRLILFGHEHVGEKDTWKVVEEKAHALEPSFCAWWTPTWLEDMRENAMVLLVNVAGYLELIQFDESIVRPILEGLLHWITCSTSASVDPFPGHRTLSPRRLALEALNRLCVHETNVDLLLSTPSD--EKVLSRLFDRLATWLAVPEDQVTRELALSTMHYLA-GGGTFVGTTMLADAKPCPISGLLSFIEAAEATTRRVIDQYGVQALQERPELMGTSLEMVRRAGALLGRLAVDSKGRLAFTPDLELRLMDLVTSRVLDATVAHLLCGALHRL 1520          

HSP 2 Score: 165.236 bits (417), Expect = 8.140e-37
Identity = 78/146 (53.42%), Postives = 107/146 (73.29%), Query Frame = 1
Query: 1897 IPNRQYHHNESQTNNSCYQKLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPILQEIQSLSDKKKKSTSRNA 2334
            + + Q  +N S  + S + KL+E+G EPER PW+E Y+RFM     P++ +P VVKQPLDL+RLY AVRERGG+  V+K +RWKEI  ++N++ASAS AY LR+NY K LL+YEC+FDR   DP P+L  I++LS KKKK +S ++
Sbjct:  111 VGSNQLLNNISSQSLSGFHKLIEMGTEPERRPWLEHYIRFMDGIGKPVAGLPQVVKQPLDLYRLYVAVRERGGVAEVIKGRRWKEISQVINISASASAAYALRKNYCKFLLEYECRFDRGGIDPRPLLAHIENLSGKKKKCSSVDS 256          

HSP 3 Score: 71.2478 bits (173), Expect = 3.876e-8
Identity = 37/88 (42.05%), Postives = 54/88 (61.36%), Query Frame = 1
Query: 3847 PTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFGRDLFIKDLELPVIID--ESVSNKTDIK 4104
            P  + MAL+SGL  E+SWALN LNI  RD+   + +    L  +  +L+D+WR++LG +F   LFI  LELP  +    S+S+ T+ K
Sbjct:  621 PFKLLMALRSGLTAEVSWALNCLNILLRDENGIDFIVPSALPGLLTSLVDLWRHTLGELFDHKLFITSLELPTDLSFISSLSSCTEAK 708          
BLAST of ARID domain-containing protein vs. TrEMBL
Match: A0A0R3SQA7 (BAF250_C domain-containing protein OS=Hymenolepis diminuta OX=6216 PE=4 SV=1)

HSP 1 Score: 256.914 bits (655), Expect = 7.903e-67
Identity = 167/473 (35.31%), Postives = 252/473 (53.28%), Query Frame = 1
Query: 4441 LNDLWLIGGSDSTYHILP-PILSQNKNTNNEWYLRLRSIDSHSQESADNSFGPPEIKRSRC-------------------TXXXXXXXXXXXXXXXXXHIGDLKFEETN------EEIDFFRLQAKSEIVNDGEGLFFKI---IESDEEKMMRCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEH---------SIDEWPPPNQEKECWWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPSHRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLS----------LGGENGIGC--IYLANAQPNIISGLISFIEITESQIRHVVDNMGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLLCNHD 5709
            + +++L GGSDST +ILP P   ++ + +     R R + S+   S   S      KR+R                    T     ++S          + D +  E N      +   +  L+A+SEI+  G+   + +    E  E   +RC+ VS  +RNLSFL   +R++ +++ +L + GRLL + H H          +++          WW+ W+D++ E++ V LVNIS +L+ +  HE IVRP++ GLLHW+TC +AAA D LP HR++   RLALE++ RL V E N+  +L+T +  S      LF+ LA+    P+ QV +E++L+ MHYLS          + G N   C    +A A+P  ++GLI+FIE+ ES+ R V+D  G++ LQ  PELMGTSLE LR +GA+L RLA+    R  F+ D E+R+L L  S VLD TVAQ +SG L  L   D
Sbjct:  346 MREIFLRGGSDSTAYILPHPSGCRSSDADAPTTRRKRVLLSNEAPSEKKS------KRTRSLSSSSLPVLSPQKVEEKNETDAVPNAASAAGAEPMNVDVEDDQDSELNSHRLMTDSRGYCPLRARSEIIRRGDSALWPVDSTAERAEGFALRCLCVSTVLRNLSFLPSCERVLANHKALLALAGRLLTVAHTHFDNPDVDWACVEDHTARYDSNSAWWMPWLDELCENILVLLVNISGHLQCAPLHETIVRPLLEGLLHWVTCQTAAATDPLPGHRIISPCRLALEALNRLSVSESNVAMLLATMDAVS---AHRLFDRLASWLSLPEDQVTRELALSTMHYLSEPPANICQQQVDGNNASTCGLSMIAEAKPCPVAGLIAFIEVMESKTRRVIDQYGVQMLQDTPELMGTSLELLRRAGAMLERLAANSFGRSRFTPDLELRILGLATSRVLDATVAQLLSGCLLNLPQRD 809          

HSP 2 Score: 70.4774 bits (171), Expect = 4.917e-8
Identity = 42/130 (32.31%), Postives = 65/130 (50.00%), Query Frame = 1
Query: 3760 LFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRD-----DTFFEKLNLKNLMPM----------FQALIDVWRNSLGSIFGRDLFIKDLELPVIIDESVSNKTDIK 4104
            +FPP  VEATQ D  ++++Y  KD+     + + MALKSGL  E +WALN LN+  RD     + +F     ++L  +            +L D  R++   +F     I +LELP+ +D       D+K
Sbjct:    6 IFPPGCVEATQVDTSRRKRYRIKDLGNLTASKLVMALKSGLPVETTWALNALNVILRDEPNVLEAYFAPPTQQSLFAINANAPTLTTLVTSLTDHLRHAANELFPGHHLISELELPLHLDSETDKPIDLK 135          
BLAST of ARID domain-containing protein vs. TrEMBL
Match: A0A0R3T1R1 (ARID domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS826 PE=4 SV=1)

HSP 1 Score: 263.848 bits (673), Expect = 7.969e-67
Identity = 175/488 (35.86%), Postives = 259/488 (53.07%), Query Frame = 1
Query: 4441 LNDLWLIGGSDSTYHILP-PILSQNKNTNNEWYLRLRSIDSHSQESADNSFGPPEIKRSRCTXXXXXXXXXXXXXXXXXHIGDLKFEETNE--------------------------EIDFFRL----------QAKSEIVNDGEGLFFKI---IESDEEKMMRCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEHSIDEWPPPNQEKEC-------------WWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPSHRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLS----------LGGENG--IGCIYLANAQPNIISGLISFIEITESQIRHVVDNMGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLLCNHD 5709
            + +++L GGSDST +ILP PI  ++   +     R R + S+   S  NS      KR+R  S  S    +P            KFEE NE                          E++  RL          +A+SEI+  G+   + +    E  E   +RC+ +S  +RNLSFL   +R++ +++ +L + GRLL + H H  +    PN +  C             WW+ W+D++ E++ V LVNIS +L+ +  HE I+RP++ GLLHW+TC +AAA D LP HR++   RLALE++ RL V E N+  +L+T +    L  Q+LF+ LA+    P+ QV +E++ + MHYLS          + G N    G   +A A+P  ++GL++FIE+ ES+ R V+D  G++ LQ  PELMGTSLE LR +GA+L RLA+    R  F+ D E+R+L L  S VLD TVAQ +SG L  L   D
Sbjct: 1421 MREVFLRGGSDSTAYILPHPIGCRSSAVDAPTIRRKRVLLSNEAPSEKNS------KRARSLSSSSLPVLSPQ-----------KFEEKNETEAILNASSTAGTEPNNVDLEDDQDSELNSHRLMTDSRGYCPLRARSEIIRRGDSALWPVDAVSERAEGFALRCLCISTVLRNLSFLPSCERVLANHKALLALAGRLLTVAHTHFDN----PNVDWACVEDHAIRYESNSAWWMPWLDELCENILVLLVNISGHLQCAPLHETIIRPLLEGLLHWVTCQTAAATDPLPGHRIISPCRLALEALNRLSVSESNVAMLLATMDA---LSAQQLFDRLASWLSLPEDQVTRELAFSTMHYLSEPPANICQQQVDGNNASTYGLSMIAEAKPCPVAGLVAFIEVMESKTRRVIDQYGVQMLQDTPELMGTSLELLRRAGAMLERLAANSFGRSRFTPDLELRILGLATSRVLDATVAQLLSGCLLNLPQRD 1884          

HSP 2 Score: 167.933 bits (424), Expect = 1.493e-37
Identity = 83/157 (52.87%), Postives = 105/157 (66.88%), Query Frame = 1
Query: 1858 PPQQRPFTPNPNMIPNRQYHHNESQTNNSCYQKLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDR--NSADPGPILQEIQSLSDKKKKST 2322
            PP Q+P    P+  P  Q   N S  + SC+ +LME+G E ER  W+E Y  FM+    PL+ +P VVKQPLDL+R Y AVRERGG+L V+KTKRWKEI  + N+NASAS AYTLR+NY K LLDYEC+FD      D   +  +I +LS KKKK++
Sbjct:  538 PPNQQP----PSTHPMAQPPPNLSPQSASCFSRLMEMGFEQERRQWLEHYFFFMESIEKPLTGLPQVVKQPLDLYRFYQAVRERGGVLEVIKTKRWKEISQLFNINASASAAYTLRKNYCKYLLDYECRFDHGPGGVDVRVVSAQIDTLSGKKKKTS 690          

HSP 3 Score: 67.781 bits (164), Expect = 4.093e-7
Identity = 42/119 (35.29%), Postives = 60/119 (50.42%), Query Frame = 1
Query: 3760 LFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDT-FFEKLNLKNLMPMF-------------QALIDVWRNSLGSIFGRDLFIKDLELPVIID 4074
            LFPP  VEATQ D  +++++  KD+     T + MALKSGL  E +WALN LN+  RD+    E        P+F              +L D  R++   +F     I +LELP+ +D
Sbjct: 1087 LFPPGCVEATQIDTSRRKRHRIKDLGNLTATKLVMALKSGLPAETTWALNALNVILRDEPNILEAYFSPPQQPLFAINTNAPTLTTLVTSLTDHLRHAANELFPHHRLISELELPLHLD 1205          
BLAST of ARID domain-containing protein vs. Ensembl Cavefish
Match: ARID1B (AT-rich interactive domain-containing protein 1B [Source:NCBI gene;Acc:103041141])

HSP 1 Score: 127.487 bits (319), Expect = 1.304e-28
Identity = 111/321 (34.58%), Postives = 160/321 (49.84%), Query Frame = 1
Query: 4810 RCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEHSIDEWPPPN------------QEKEC----WWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLP---SHRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQE-LFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIE----ITE-SQIRHVVDNMGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLL 5697
            RCI VSN IR+LSF+ GND  +  +  ++++LGRLLLL HEH   +   P             Q   C    WW   +  +RE+  VTL NI+  L+LS + E I  PI+ GLLHW+ C SA A+D  P   SH  L  RRL LE + +L V + N+D IL+T         QE LF  L         QV +EM++ ++  L+ G  +    I +   Q + I  LI F+E    +T+  Q  H + ++G   +         S+  +  +   L  LA  E NR  F   +E R+L+L +STVL+  V   +  VL+ L
Sbjct: 1929 RCICVSNIIRSLSFIPGNDTEMSRHPGLVLVLGRLLLLHHEHPERKRSVPTYEKEKEEFPKEEQGLACSRDEWWWDCLTALRENAMVTLANIAGQLDLSVYPESICLPILDGLLHWMVCPSAEAQDPFPSAGSHSQLSPRRLVLECLCKLSVQDGNVDLILATP----PFTRQEKLFATLVRQLGERKQQVYREMAVVILSCLARGDCSAARGIAV---QRSSIGNLIGFLEDGIAMTQYHQNPHSLIHIGHSPMDQ------PSVNMMCRAAKALLELAKVEENRPEFVL-YESRLLDLAVSTVLNTNVVALVCEVLFHL 2235          

HSP 2 Score: 110.153 bits (274), Expect = 2.038e-23
Identity = 45/105 (42.86%), Postives = 70/105 (66.67%), Query Frame = 1
Query: 1954 KLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADP 2268
            +L E+G EPER  W++RYL FM+E  TP+  +P V K+ LDL +LY  V++ GGL  V K K+W+E+   +++  S++ A +L+++YI+ L  YECK +R    P
Sbjct: 1009 RLYEMGGEPERKSWVDRYLSFMEERGTPVPHLPAVGKKALDLCKLYMTVKDMGGLAMVNKNKKWRELSSTLSMGTSSTSASSLKKHYIQYLFAYECKVERGEEPP 1113          

HSP 3 Score: 65.0846 bits (157), Expect = 1.022e-9
Identity = 37/94 (39.36%), Postives = 51/94 (54.26%), Query Frame = 1
Query: 3748 RYDSLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFG 4029
            R D  +P  SVE TQP    +RK +SKD        V M+LKSGL+ E +WAL+ +NI   DD+     NL  L  + + +++  R  L  IFG
Sbjct: 1572 RRDLNYPLGSVEGTQPHLKPRRKMTSKDTGTPEVWRVMMSLKSGLLAESTWALDTINILLYDDSTVASFNLAQLPGLLELIVEHLRRCLIEIFG 1665          
BLAST of ARID domain-containing protein vs. Ensembl Cavefish
Match: arid1aa (AT-rich interactive domain-containing protein 1A [Source:NCBI gene;Acc:103021736])

HSP 1 Score: 124.405 bits (311), Expect = 1.106e-27
Identity = 98/314 (31.21%), Postives = 163/314 (51.91%), Query Frame = 1
Query: 4810 RCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEHSIDEWPPPNQEKEC------------WWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPS---HRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIE--ITESQIRHVVDN-MGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLL 5697
            RC+ VSN +R+LSF+ GND  +  +  +L++LGRL+LL H H   +  P   EKE             WW   ++ +RE+  VTL NIS  L+ S + E I  P++ GLLHW  C SA A+D  P+   +  L  +RL LE++ +L + + N+D IL+T        +++LF  L        V V +EM++ ++  L+ G       I +   Q   +  L+ F+E  +  +Q +    + + M+     P    TS++ +R +   L+ LA  E N   F+  +E R+L+L +S +++  V+  I  VL+L+
Sbjct: 1991 RCVCVSNIVRSLSFIPGNDLEMSKHPGLLLLLGRLVLLHHWHPERKQAPLTYEKEDEADEDIGHGKEEWWWDCLELLRENCLVTLANISGQLDFSIYSESICLPLLDGLLHWAVCPSAEAQDPFPTLGLNGALSPQRLVLETLSKLSIQDNNVDLILATP---PFSRLEKLFGNLVRLVGERKVPVCREMAVVLLANLAQGDSMAARAIAV---QKGSVGNLLGFLEDSLAATQFQQSQGSLLHMQGAHFEP----TSVDMMRRAARALHALAKVEENHSEFTL-YESRLLDLSVSPLMNSLVSHVICDVLFLI 2293          

HSP 2 Score: 112.079 bits (279), Expect = 5.164e-24
Identity = 53/120 (44.17%), Postives = 81/120 (67.50%), Query Frame = 1
Query: 1954 KLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPILQEIQSLSDKKK 2313
            +L ELG+EPER  W++RYL F++E    ++ +P V ++PLDLFRLY +V+E GGL  V K K+W+E+   +NV  S+S A +L++ YI+CL  +ECK +R   DP P +   +S  ++ K
Sbjct:  986 RLYELGSEPERKMWVDRYLAFIEEKAMGMTNLPAVGRRPLDLFRLYVSVKEIGGLTQVNKNKKWRELATSLNVGTSSSAASSLKKQYIQCLYAFECKIERGE-DPPPDILSTESKKNQPK 1104          

HSP 3 Score: 75.485 bits (184), Expect = 7.499e-13
Identity = 41/113 (36.28%), Postives = 60/113 (53.10%), Query Frame = 1
Query: 3742 IKRYDSLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFG--RDLFIKDLELPVIID 4074
            + R D  FPP SVEA+QP    +R+ + KDI       V M+LKSGL+ E +WAL+ +NI   DD      NL  L    + +++ +R  L  IFG  R+  + D     ++D
Sbjct: 1581 LMRRDPPFPPGSVEASQPVLKARRRLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSISNFNLIQLPGFLELIVEYFRRCLIEIFGILREYEVGDPGQRTLLD 1693          
BLAST of ARID domain-containing protein vs. Ensembl Cavefish
Match: arid1aa (AT-rich interactive domain-containing protein 1A [Source:NCBI gene;Acc:103021736])

HSP 1 Score: 124.02 bits (310), Expect = 1.346e-27
Identity = 98/314 (31.21%), Postives = 163/314 (51.91%), Query Frame = 1
Query: 4810 RCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEHSIDEWPPPNQEKEC------------WWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPS---HRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIE--ITESQIRHVVDN-MGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLL 5697
            RC+ VSN +R+LSF+ GND  +  +  +L++LGRL+LL H H   +  P   EKE             WW   ++ +RE+  VTL NIS  L+ S + E I  P++ GLLHW  C SA A+D  P+   +  L  +RL LE++ +L + + N+D IL+T        +++LF  L        V V +EM++ ++  L+ G       I +   Q   +  L+ F+E  +  +Q +    + + M+     P    TS++ +R +   L+ LA  E N   F+  +E R+L+L +S +++  V+  I  VL+L+
Sbjct: 1502 RCVCVSNIVRSLSFIPGNDLEMSKHPGLLLLLGRLVLLHHWHPERKQAPLTYEKEDEADEDIGHGKEEWWWDCLELLRENCLVTLANISGQLDFSIYSESICLPLLDGLLHWAVCPSAEAQDPFPTLGLNGALSPQRLVLETLSKLSIQDNNVDLILATPPFSR---LEKLFGNLVRLVGERKVPVCREMAVVLLANLAQGDSMAARAIAV---QKGSVGNLLGFLEDSLAATQFQQSQGSLLHMQGAHFEP----TSVDMMRRAARALHALAKVEENHSEFTL-YESRLLDLSVSPLMNSLVSHVICDVLFLI 1804          

HSP 2 Score: 111.309 bits (277), Expect = 8.690e-24
Identity = 53/120 (44.17%), Postives = 81/120 (67.50%), Query Frame = 1
Query: 1954 KLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPILQEIQSLSDKKK 2313
            +L ELG+EPER  W++RYL F++E    ++ +P V ++PLDLFRLY +V+E GGL  V K K+W+E+   +NV  S+S A +L++ YI+CL  +ECK +R   DP P +   +S  ++ K
Sbjct:  546 RLYELGSEPERKMWVDRYLAFIEEKAMGMTNLPAVGRRPLDLFRLYVSVKEIGGLTQVNKNKKWRELATSLNVGTSSSAASSLKKQYIQCLYAFECKIERGE-DPPPDILSTESKKNQPK 664          

HSP 3 Score: 75.0998 bits (183), Expect = 8.559e-13
Identity = 41/113 (36.28%), Postives = 60/113 (53.10%), Query Frame = 1
Query: 3742 IKRYDSLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFG--RDLFIKDLELPVIID 4074
            + R D  FPP SVEA+QP    +R+ + KDI       V M+LKSGL+ E +WAL+ +NI   DD      NL  L    + +++ +R  L  IFG  R+  + D     ++D
Sbjct: 1139 LMRRDPPFPPGSVEASQPVLKARRRLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSISNFNLIQLPGFLELIVEYFRRCLIEIFGILREYEVGDPGQRTLLD 1251          
BLAST of ARID domain-containing protein vs. Ensembl Cavefish
Match: arid1b (AT rich interactive domain 1B (SWI1-like) [Source:ZFIN;Acc:ZDB-GENE-030131-4459])

HSP 1 Score: 117.857 bits (294), Expect = 1.055e-25
Identity = 55/121 (45.45%), Postives = 78/121 (64.46%), Query Frame = 1
Query: 1954 KLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPILQEIQSLSDKKKK 2316
            +L E+G EPER  W++RYL FM+E  TP+  +P V K+PLDL RLY  VRE GGL  V K K+W+E+  ++NV  S+S A +L++ YI+ L  YECK +R    P     +  ++ D KK+
Sbjct:  597 RLYEMGTEPERRTWVDRYLAFMEERGTPVPNLPAVGKKPLDLCRLYMCVREIGGLAMVNKNKKWRELSTVLNVGTSSSSASSLKKQYIQYLFAYECKVERGEEPP----PDAFAMGDSKKQ 713          

HSP 2 Score: 112.464 bits (280), Expect = 4.192e-24
Identity = 102/317 (32.18%), Postives = 161/317 (50.79%), Query Frame = 1
Query: 4795 EEKMMRCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEHSIDEWPPPNQEKE------C----WWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAED---SLPSHRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQE-LFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIE--ITESQIRHVVDNMGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLL 5697
            +E   RCI +SN +R+LSF+  ND  +  +  +++ILGRL++L HEH   +   P  ++E      C    WW   +  + E+  VTL NIS  L+LS + E I  PI+ GLLHW+ C SA A+D   +      L  +RL LE + +L + + N+D +L+T      L  Q+ L+  L         QV +EM++AV+  L+ G       I L   Q   I  +I F+E  I  +Q +    ++        PE    ++   R + ALL  +A  E NR  F   +E R+L++ +S+VL+ +V   +  VL+ L
Sbjct: 1478 DELAKRCICISNIVRSLSFVPSNDADMARHPGLVLILGRLVMLHHEHPKRKRTSPTYQREEERGLACSKDEWWWDCLCALHENTLVTLANISGQLDLSIYPESICLPILDGLLHWMVCPSAEAQDPFCTAGGFSSLTPQRLVLECLCKLSIQDCNVDLLLATP----PLSRQDRLYATLVRHVGERKSQVCREMAVAVLSNLAQGDSTAARSIAL---QKGSIGTVIGFLEDSIAMAQYQQSPHSLLHAGHPTHPEPPSINM-MCRAAKALLA-MAQVEENRPEFVL-YESRLLDITLSSVLNSSVVAVMCEVLFKL 1784          

HSP 3 Score: 65.855 bits (159), Expect = 5.664e-10
Identity = 42/121 (34.71%), Postives = 60/121 (49.59%), Query Frame = 1
Query: 3763 FPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFGRDLFIKDLELPVIIDESVSNKTDIKTLLSKIE 4125
            FP  SVEATQP    +++ +SKDI       V M+LKSGL+ E +WAL+ +NI   DD       L  L    + +++ +R  L  IFG    +K+ E+              KTLL  I+
Sbjct: 1129 FPLGSVEATQPQLKPRKRLTSKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNTVSSFTLSQLPGFLELIVEYFRRCLIEIFG---ILKEYEV---------GTEGQKTLLGPIQ 1237          
BLAST of ARID domain-containing protein vs. Ensembl Cavefish
Match: arid1b (AT rich interactive domain 1B (SWI1-like) [Source:ZFIN;Acc:ZDB-GENE-030131-4459])

HSP 1 Score: 116.701 bits (291), Expect = 1.967e-25
Identity = 55/121 (45.45%), Postives = 78/121 (64.46%), Query Frame = 1
Query: 1954 KLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPILQEIQSLSDKKKK 2316
            +L E+G EPER  W++RYL FM+E  TP+  +P V K+PLDL RLY  VRE GGL  V K K+W+E+  ++NV  S+S A +L++ YI+ L  YECK +R    P     +  ++ D KK+
Sbjct:  336 RLYEMGTEPERRTWVDRYLAFMEERGTPVPNLPAVGKKPLDLCRLYMCVREIGGLAMVNKNKKWRELSTVLNVGTSSSSASSLKKQYIQYLFAYECKVERGEEPP----PDAFAMGDSKKQ 452          

HSP 2 Score: 112.849 bits (281), Expect = 2.666e-24
Identity = 102/317 (32.18%), Postives = 161/317 (50.79%), Query Frame = 1
Query: 4795 EEKMMRCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEHSIDEWPPPNQEKE------C----WWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAED---SLPSHRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQE-LFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIE--ITESQIRHVVDNMGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLL 5697
            +E   RCI +SN +R+LSF+  ND  +  +  +++ILGRL++L HEH   +   P  ++E      C    WW   +  + E+  VTL NIS  L+LS + E I  PI+ GLLHW+ C SA A+D   +      L  +RL LE + +L + + N+D +L+T      L  Q+ L+  L         QV +EM++AV+  L+ G       I L   Q   I  +I F+E  I  +Q +    ++        PE    ++   R + ALL  +A  E NR  F   +E R+L++ +S+VL+ +V   +  VL+ L
Sbjct: 1257 DELAKRCICISNIVRSLSFVPSNDADMARHPGLVLILGRLVMLHHEHPKRKRTSPTYQREEERGLACSKDEWWWDCLCALHENTLVTLANISGQLDLSIYPESICLPILDGLLHWMVCPSAEAQDPFCTAGGFSSLTPQRLVLECLCKLSIQDCNVDLLLATP----PLSRQDRLYATLVRHVGERKSQVCREMAVAVLSNLAQGDSTAARSIAL---QKGSIGTVIGFLEDSIAMAQYQQSPHSLLHAGHPTHPEPPSINM-MCRAAKALLA-MAQVEENRPEFVL-YESRLLDITLSSVLNSSVVAVMCEVLFKL 1563          

HSP 3 Score: 65.855 bits (159), Expect = 5.031e-10
Identity = 42/121 (34.71%), Postives = 58/121 (47.93%), Query Frame = 1
Query: 3763 FPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFGRDLFIKDLELPVIIDESVSNKTDIKTLLSKIE 4125
            FP  SVEATQP    +++ +SKDI       V M+LKSGL+ E +WAL+ +NI   DD       L  L    + +++ +R  L  IFG            I+ E        KTLL  I+
Sbjct:  908 FPLGSVEATQPQLKPRKRLTSKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNTVSSFTLSQLPGFLELIVEYFRRCLIEIFG------------ILKEYEVGTEGQKTLLGPIQ 1016          
BLAST of ARID domain-containing protein vs. Ensembl Sea Lamprey
Match: arid1b (AT rich interactive domain 1B (SWI1-like) [Source:ZFIN;Acc:ZDB-GENE-030131-4459])

HSP 1 Score: 120.168 bits (300), Expect = 3.359e-27
Identity = 98/305 (32.13%), Postives = 154/305 (50.49%), Query Frame = 1
Query: 4810 RCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEHSIDEWPP-----PNQEKEC---WWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPSH---RVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIEITESQIRHVVDNMGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLY 5691
            RC+ +SN++R+LSF+ GND  +  N  +L ILGRL+LL H H      P     PN  +     WW   +  +RE+ FVTL NI+  L+LS +HE +V P++ GLLHW  C SA A D  PS      L  +RL LE + +L   + N+D +L+T   G    ++ L   L         QV +EM+LA++  L+    +G+    +A  Q   +  ++ F+E     + H      M      P +   S + +R +   L  +A    NR HF    + R+L++ +S++L  ++A  +  VLY
Sbjct: 1367 RCVCISNTLRSLSFVPGNDAEMSRNPALLAILGRLILLHHRHPERRRGPVASGDPNDHESSERRWWWDCLQSLRENAFVTLANIAGQLDLSTYHESLVFPLLDGLLHWAVCPSAEARDPFPSAGPTSTLSPQRLVLECLSKLSTQDGNVDLMLATPPFGR---LRRLCGTLVTLVSERREQVCREMALALLANLAQ--ADGLAARAIA-LQRGSVPTVLGFLEDCLVALIHQQSPAAMLQHAPPPAVQHPSHDMMRRAATALLAMARAPENRPHFLL-QQGRLLDVSMSSMLHPSIAAILGDVLY 1664          

HSP 2 Score: 107.457 bits (267), Expect = 3.026e-23
Identity = 53/131 (40.46%), Postives = 78/131 (59.54%), Query Frame = 1
Query: 1921 NESQTNNSCYQKLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPILQEIQSLSDKKK 2313
              S T      +L ELG EPER  W++RYL FM++  +P++ +P V K PLDL+RLY + +  GG + V K K+W+E+   + V  S+S A +L++ YI+ L  +ECK +R    P     EI + SD KK
Sbjct:  508 GSSTTTGESIMRLYELGPEPERRLWVDRYLGFMEQRGSPVALLPAVGKNPLDLYRLYASAKAYGGFVQVNKKKKWRELSTQLAVGTSSSSASSLKKQYIQFLFAFECKTERGEEPP----PEILNPSDNKK 634          

HSP 3 Score: 63.5438 bits (153), Expect = 5.475e-10
Identity = 32/75 (42.67%), Postives = 45/75 (60.00%), Query Frame = 1
Query: 3748 RYDSLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLM 3972
            R +  FP  SVEATQP Y  +RK +SK++       V M+LKSGL+ E +WA++ +N+   DDT     NL  L+
Sbjct: 1047 RRELCFPARSVEATQPTYKPRRKLTSKEVGSPEAWRVLMSLKSGLLAESAWAVDTVNVLLYDDTSVSSFNLSQLL 1121          
BLAST of ARID domain-containing protein vs. Ensembl Sea Lamprey
Match: arid1b (AT rich interactive domain 1B (SWI1-like) [Source:ZFIN;Acc:ZDB-GENE-030131-4459])

HSP 1 Score: 119.783 bits (299), Expect = 3.664e-27
Identity = 98/305 (32.13%), Postives = 154/305 (50.49%), Query Frame = 1
Query: 4810 RCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEHSIDEWPP-----PNQEKEC---WWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPSH---RVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIEITESQIRHVVDNMGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLY 5691
            RC+ +SN++R+LSF+ GND  +  N  +L ILGRL+LL H H      P     PN  +     WW   +  +RE+ FVTL NI+  L+LS +HE +V P++ GLLHW  C SA A D  PS      L  +RL LE + +L   + N+D +L+T   G    ++ L   L         QV +EM+LA++  L+    +G+    +A  Q   +  ++ F+E     + H      M      P +   S + +R +   L  +A    NR HF    + R+L++ +S++L  ++A  +  VLY
Sbjct:  916 RCVCISNTLRSLSFVPGNDAEMSRNPALLAILGRLILLHHRHPERRRGPVASGDPNDHESSERRWWWDCLQSLRENAFVTLANIAGQLDLSTYHESLVFPLLDGLLHWAVCPSAEARDPFPSAGPTSTLSPQRLVLECLSKLSTQDGNVDLMLATPPFGR---LRRLCGTLVTLVSERREQVCREMALALLANLAQ--ADGLAARAIA-LQRGSVPTVLGFLEDCLVALIHQQSPAAMLQHAPPPAVQHPSHDMMRRAATALLAMARAPENRPHFLL-QQGRLLDVSMSSMLHPSIAAILGDVLY 1213          

HSP 2 Score: 104.76 bits (260), Expect = 1.414e-22
Identity = 53/131 (40.46%), Postives = 78/131 (59.54%), Query Frame = 1
Query: 1921 NESQTNNSCYQKLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPILQEIQSLSDKKK 2313
              S T      +L ELG EPER  W++RYL FM++  +P++ +P V K PLDL+RLY + +  GG + V K K+W+E+   + V  S+S A +L++ YI+ L  +ECK +R    P     EI + SD KK
Sbjct:   53 GSSTTTGESIMRLYELGPEPERRLWVDRYLGFMEQRGSPVALLPAVGKNPLDLYRLYASAKAYGGFVQVNKKKKWRELSTQLAVGTSSSSASSLKKQYIQFLFAFECKTERGEEPP----PEILNPSDNKK 179          

HSP 3 Score: 62.3882 bits (150), Expect = 1.175e-9
Identity = 33/78 (42.31%), Postives = 46/78 (58.97%), Query Frame = 1
Query: 3748 RYDSLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMF 3981
            R +  FP  SVEATQP Y  +RK +SK++       V M+LKSGL+ E +WA++ +N+   DDT     NL   + MF
Sbjct:  601 RRELCFPARSVEATQPTYKPRRKLTSKEVGSPEAWRVLMSLKSGLLAESAWAVDTVNVLLYDDTSVSSFNLSQCV-MF 677          
BLAST of ARID domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010019.1 (pep scaffold:Pmarinus_7.0:GL481681:6200:13508:-1 gene:ENSPMAG00000009067.1 transcript:ENSPMAT00000010019.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 1.339e-7
Identity = 29/85 (34.12%), Postives = 46/85 (54.12%), Query Frame = 1
Query: 1999 ERYLR----FMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVN-ASASGAYTLRRNYIKCLLDYE 2238
            E +LR    FM+   TP+  +P +  + +DL+ ++ AV+E GG   V   + WK+I   +  N  S S A   RR+Y + +L YE
Sbjct:    7 ENFLRELHGFMRTRKTPIGRIPNLGFKQVDLWVMFRAVQELGGYEAVTSQRLWKQIYDTLGGNRGSTSAATCTRRHYERLILPYE 91          
BLAST of ARID domain-containing protein vs. Ensembl Nematostella
Match: EDO45584 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSL0])

HSP 1 Score: 92.4337 bits (228), Expect = 6.968e-22
Identity = 43/99 (43.43%), Postives = 67/99 (67.68%), Query Frame = 1
Query: 1948 YQKLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNAS-ASGAYTLRRNYIKCLLDYEC 2241
            +++L ELG+EP+R  +++    FMQ+  TP++ VP + KQ LDL++L+  V ++GGL+ V+  K W+EI   +N+ AS  S A+TLR  Y+K L  YEC
Sbjct:    7 FKQLYELGDEPDRKTFLDDLFAFMQKRGTPVNRVPIMAKQTLDLYKLFRLVVDKGGLVEVINKKIWREIIKGLNLPASVTSAAFTLRTQYMKYLYPYEC 105          
BLAST of ARID domain-containing protein vs. Ensembl Nematostella
Match: EDO30702 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T009])

HSP 1 Score: 92.0485 bits (227), Expect = 9.985e-19
Identity = 87/290 (30.00%), Postives = 145/290 (50.00%), Query Frame = 1
Query: 4786 ESDEEKMMRCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEHS------------IDEWPPPNQEKECWWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPS---HRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANA--QPNIISGLISFIEITESQIRHVVDNMGM-EALQARPELMGTSLEFLRHSGALLNRLASYEINRKHF 5601
            ESD+    RCI VSN +R LSF+ GND  +  +  +L+ILGRLLLL HEH+             +E   P  +++ WW   ++ +RE+  V L NI+  L+L+ + + I   ++ GLLHWL C SA A D +P+      L  ++L LE++ ++ +   N + I+ST++    ++I +    L  S   P   V +E++L ++  LS            AN   +   I+ L+ FIE   + I        + +      +  GTS++ LR + + L  L+  + N+  F
Sbjct:  282 ESDDAISRRCICVSNILRGLSFVPGNDIEMHRHAGLLLILGRLLLLYHEHAHRVPYKRTYLQVDEEPDVPVDDRDDWWWHCLEVLRENALVILSNIAGQLDLTFYSDTIRASVLEGLLHWLVCESADALDPMPTATPSTSLSAQQLVLEALAKMSILGGNAELIISTSSSPQLVLIHDTLVRLLGSRGNP---VCRELTLVLLSNLSQSDNE------FANLGDKKQCIAMLLQFIEDAANSINAYSSGSSLAQGGYTSEDFCGTSVDMLRRAASTLVCLSRCKSNKAVF 562          

HSP 2 Score: 70.4774 bits (171), Expect = 4.934e-12
Identity = 38/99 (38.38%), Postives = 57/99 (57.58%), Query Frame = 1
Query: 3763 FPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFGRDLFIKDLEL 4059
            FP + VE T+P + KKRK +S+D+       V M+LKSGL+ E +WAL+ LNI   D+       L +L  +   L+D +R  L  IFG+   + D+E+
Sbjct:    7 FPADCVEGTRPVFTKKRKLTSRDLGPVEAWRVMMSLKSGLLAETTWALDTLNILLYDENTVGYFVLSHLPGLLDNLLDHFRCYLAQIFGK---MSDIEV 102          
BLAST of ARID domain-containing protein vs. Ensembl Nematostella
Match: EDO39168 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAR7])

HSP 1 Score: 52.373 bits (124), Expect = 3.937e-7
Identity = 28/89 (31.46%), Postives = 47/89 (52.81%), Query Frame = 1
Query: 1975 EPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNV-NASASGAYTLRRNYIKCLLDYE 2238
            E E   ++ +  +F     TP   +P +  Q LDLF LY  V + GG + V + K+W++I    N+ +   + A+ LR++Y + L  YE
Sbjct:   13 EREYNNFMTKLKKFHDSKGTPFRRLPWLGGQFLDLFLLYKKVTDHGGWVKVTEDKKWRDIAEFFNLPSTCTNAAFALRQHYARYLEAYE 101          
BLAST of ARID domain-containing protein vs. Ensembl Medaka
Match: arid1aa (AT-rich interactive domain-containing protein 1A [Source:NCBI gene;Acc:101173968])

HSP 1 Score: 124.79 bits (312), Expect = 7.476e-28
Identity = 103/329 (31.31%), Postives = 171/329 (51.98%), Query Frame = 1
Query: 4762 EGLFFKIIESDEEKMMRCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEHSIDEWPPPNQEKEC-----------WWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPS---HRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIE--ITESQIRHVVDN-MGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLL 5697
            EG    + +  +    RCI VSN +R+LSF+ GND  +  +  +L+ILGRL+LL H H   +  P   EK+            WW   ++ +RE+  VTL NIS  L+LS + E I  P++ GLLHW  C SA A+D  P+   H  L  +RL LE++ +L + + N+D IL+T        +++LF  L        V V +EM++ ++  L+ G       + +   Q   +  L+ F+E  +  +Q++H   + + ++ +   P    TS + +R +   L+ LA  E N   F+  HE R+L+L +S +++  V+  I  VL+L+
Sbjct: 1928 EGPLIALADWQDSLARRCICVSNIVRSLSFVPGNDHEMSKHPGLLLILGRLILLHHRHPERKQAPLTYEKDEDSDEGVGQRDEWWWDCLELLRENTLVTLANISGQLDLSIYPESICLPLLDGLLHWAVCPSAEAQDPFPTLGPHSALSPQRLVLETLSKLSIQDNNVDLILATP---PFSRLEKLFGNLVRLIGDRKVAVCREMAVVLLANLAQGDTLAARAVAV---QKGSVGNLLGFLEDSLAATQLQHSQSSLLHLQGMHFEP----TSPDMMRRAARALHALAKVEENHSEFTL-HESRLLDLSVSPLMNSLVSHVICDVLFLI 2245          

HSP 2 Score: 112.464 bits (280), Expect = 3.930e-24
Identity = 51/125 (40.80%), Postives = 82/125 (65.60%), Query Frame = 1
Query: 1954 KLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPILQEIQSLSDKKKKSTSR 2328
            +L ELG EP+R  W++RYL F++E    +S +P V ++PLDL+RLY +V+E GG+  V K+K+W+++   +NV  S+S A +L++ YI+CL  +ECK +R   DP P +      +D KK   ++
Sbjct:  957 RLYELGPEPDRKMWVDRYLAFVEEKVMGMSNLPAVGRKPLDLYRLYMSVKEIGGMTQVNKSKKWRDLATSLNVGTSSSAASSLKKQYIQCLYAFECKIERGE-DPPPEI-----FTDTKKSQAAK 1075          

HSP 3 Score: 65.0846 bits (157), Expect = 9.345e-10
Identity = 39/108 (36.11%), Postives = 57/108 (52.78%), Query Frame = 1
Query: 3706 SQITYSKSSSHFIKRYDSLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFG 4029
            S I      S  I+R D  FPP SVEA+ P    +R+ + K+I       V M+LKSGL+ E +WAL+ +NI   DD      +L  L  + + +++ +R  L  IFG
Sbjct: 1552 SHIVPPAVQSPLIRR-DMPFPPGSVEASHPVLKPRRRLTMKEIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSISTFDLNTLPGLLELVVEYYRRCLIEIFG 1658          
BLAST of ARID domain-containing protein vs. Ensembl Medaka
Match: arid1ab (AT-rich interactive domain-containing protein 1A [Source:NCBI gene;Acc:101159069])

HSP 1 Score: 124.405 bits (311), Expect = 1.100e-27
Identity = 98/311 (31.51%), Postives = 166/311 (53.38%), Query Frame = 1
Query: 4810 RCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEHSIDEWPPPNQEKE--------C----WWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPS---HRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIEITESQIRHVVDNMGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLL 5697
            RCI +SN +R+LSF+ GND  +  +  +L++LGRL+LL H H   +  P   EKE        C    WW   ++ +RE+  VTL NIS  L+LS + E I  P++ GLLHW  C SA A D  P+   H  L  +RL LE++ +L + + N+D IL+T        +++L+  L        V V +EM++ ++  L+ G       I +  A    +  L+ F+E + +  ++      +  +Q  P+   TS++ +R +   L+ LA  E N   F+  +E R+L++ +S +++ +V+Q I  +L+L+
Sbjct: 1933 RCICISNIVRSLSFVPGNDLELSKHPGLLLLLGRLVLLHHRHPERKQAPVTYEKEEDEDEGVSCERDEWWWDCLEVLRENCLVTLANISGQLDLSIYPESICLPLLDGLLHWAVCPSAEALDPFPTLGPHSSLSPQRLVLETLSKLSIQDNNVDLILATP---PFSRLEKLYGSLVRLVGERKVAVCREMAVVLLANLAQGDTLAARAIAVQKAS---VGNLLGFLEDSLAATQYSQSQNPLLQMQGGPQFEPTSVDMMRRAARALHALAKVEENHSEFTL-YESRLLDISVSPLMNSSVSQVICDILFLI 2236          

HSP 2 Score: 110.538 bits (275), Expect = 1.496e-23
Identity = 49/110 (44.55%), Postives = 71/110 (64.55%), Query Frame = 1
Query: 1939 NSCYQKLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADP 2268
            N    +L ELG EPER  W++RYL F +E    +  +P V ++PLDLF+LY +V+E GGL  V K K+W+E+   +NV  S+S A +L++ YI+CL  +ECK +R    P
Sbjct:  954 NEKITRLYELGPEPERKMWVDRYLAFAEEKAMGMHNLPAVGRKPLDLFKLYVSVKEIGGLTQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQCLYAFECKIERGEDPP 1063          

HSP 3 Score: 67.781 bits (164), Expect = 1.409e-10
Identity = 40/119 (33.61%), Postives = 63/119 (52.94%), Query Frame = 1
Query: 3748 RYDSLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFG--RDLFIKDLELPVIIDESVSNKTD 4098
            R D  FPP SVEA+QP    +R+ + K+I       V M+LKSGL+ E +WAL+ +NI   DD      NL  L    + +++ +R  L  IFG  ++  + D     +ID + +  ++
Sbjct: 1544 RRDMAFPPGSVEASQPHLKPRRRLTMKEIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDGSISTFNLCQLPGFLELIVEYFRRCLIQIFGILKEYEVGDHGQRTLIDPNAAEDSE 1662          
BLAST of ARID domain-containing protein vs. Ensembl Medaka
Match: arid1ab (AT-rich interactive domain-containing protein 1A [Source:NCBI gene;Acc:101159069])

HSP 1 Score: 124.02 bits (310), Expect = 1.232e-27
Identity = 98/311 (31.51%), Postives = 166/311 (53.38%), Query Frame = 1
Query: 4810 RCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEHSIDEWPPPNQEKE--------C----WWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPS---HRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIEITESQIRHVVDNMGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLL 5697
            RCI +SN +R+LSF+ GND  +  +  +L++LGRL+LL H H   +  P   EKE        C    WW   ++ +RE+  VTL NIS  L+LS + E I  P++ GLLHW  C SA A D  P+   H  L  +RL LE++ +L + + N+D IL+T        +++L+  L        V V +EM++ ++  L+ G       I +  A    +  L+ F+E + +  ++      +  +Q  P+   TS++ +R +   L+ LA  E N   F+  +E R+L++ +S +++ +V+Q I  +L+L+
Sbjct: 1908 RCICISNIVRSLSFVPGNDLELSKHPGLLLLLGRLVLLHHRHPERKQAPVTYEKEEDEDEGVSCERDEWWWDCLEVLRENCLVTLANISGQLDLSIYPESICLPLLDGLLHWAVCPSAEALDPFPTLGPHSSLSPQRLVLETLSKLSIQDNNVDLILATP---PFSRLEKLYGSLVRLVGERKVAVCREMAVVLLANLAQGDTLAARAIAVQKAS---VGNLLGFLEDSLAATQYSQSQNPLLQMQGGPQFEPTSVDMMRRAARALHALAKVEENHSEFTL-YESRLLDISVSPLMNSSVSQVICDILFLI 2211          

HSP 2 Score: 110.538 bits (275), Expect = 1.569e-23
Identity = 49/110 (44.55%), Postives = 71/110 (64.55%), Query Frame = 1
Query: 1939 NSCYQKLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADP 2268
            N    +L ELG EPER  W++RYL F +E    +  +P V ++PLDLF+LY +V+E GGL  V K K+W+E+   +NV  S+S A +L++ YI+CL  +ECK +R    P
Sbjct:  929 NEKITRLYELGPEPERKMWVDRYLAFAEEKAMGMHNLPAVGRKPLDLFKLYVSVKEIGGLTQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQCLYAFECKIERGEDPP 1038          

HSP 3 Score: 67.781 bits (164), Expect = 1.443e-10
Identity = 40/119 (33.61%), Postives = 63/119 (52.94%), Query Frame = 1
Query: 3748 RYDSLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFG--RDLFIKDLELPVIIDESVSNKTD 4098
            R D  FPP SVEA+QP    +R+ + K+I       V M+LKSGL+ E +WAL+ +NI   DD      NL  L    + +++ +R  L  IFG  ++  + D     +ID + +  ++
Sbjct: 1519 RRDMAFPPGSVEASQPHLKPRRRLTMKEIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDGSISTFNLCQLPGFLELIVEYFRRCLIQIFGILKEYEVGDHGQRTLIDPNAAEDSE 1637          
BLAST of ARID domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000021561.2 (AT-rich interactive domain-containing protein 1B [Source:NCBI gene;Acc:101156929])

HSP 1 Score: 118.242 bits (295), Expect = 7.826e-26
Identity = 100/317 (31.55%), Postives = 164/317 (51.74%), Query Frame = 1
Query: 4810 RCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEHSIDEWPPPN------QE------KECWWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPS---HRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQE-LFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIE--ITESQIR---HVVDNMGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLL 5697
            RC+ +SN +R+LSF+ GND  +  +  ++++LG+LLLL H H       P+      QE      KE WW   +  +RE+  VTL N++  L+LS + + I  P++ GLLHW+ C S+ A+D  PS   H  L  +RL LE + +L + + N+D +L+T         QE LF  L         QV +EM++AV+ +L+ G       I +   Q   +  L++F+E  ++ +Q +   H + +MG       P +   S+  +  +   L  +A  E N+  F   +E R+L++ IS+VL+  V   I  VL+ L
Sbjct: 1805 RCLCISNVVRSLSFIPGNDSDMSRHPALVLLLGKLLLLHHLHPERNRSAPSYQKEEQQERGLSNSKEEWWWDCLSLLRENAMVTLANMAGQLDLSTYPDTICLPVLDGLLHWMVCPSSEAQDPFPSAAPHSQLTPQRLVLECLCKLSIQDGNVDLLLATP----PFSRQEKLFAVLVRYVSQRKAQVFREMAVAVLSHLAQGDPTAARAIAM---QKGSVGNLVAFLEDGVSMAQYQQNPHSLLHMG------HPPMDPPSVNMMCRAAKGLLAMAKVEENKTEFVL-YENRLLDISISSVLNTGVVAIICQVLFHL 2107          

HSP 2 Score: 117.472 bits (293), Expect = 1.423e-25
Identity = 60/136 (44.12%), Postives = 83/136 (61.03%), Query Frame = 1
Query: 1861 PQQRPFTPNPNMIPNRQYHHNESQTNNSCYQKLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADP 2268
            P + P +P PN  PN       S   +    +L ELG+EPER  W+ERYL FM+E  TP++ +P V K+ LDL++LY AVRE GGL  V K K+W+E+   ++V  S+S A  L++ YI+ L  YECK +R    P
Sbjct:  878 PLKTPCSPKPN--PN-------SSLGSERITRLYELGSEPERQVWVERYLNFMEERGTPVTQLPVVGKKLLDLWKLYIAVREIGGLAMVNKNKKWRELSTTLSVGTSSSSASALKKQYIQYLFAYECKMERGEEPP 1004          

HSP 3 Score: 69.707 bits (169), Expect = 3.923e-11
Identity = 47/161 (29.19%), Postives = 74/161 (45.96%), Query Frame = 1
Query: 3748 RYDSLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFGRDLFIKDLELPVIIDESVSNKTDIKTLLSKIETV----LKNRQLKQEKEICKNGVIESEDDTKLAQD 4218
            R D  +PP S EAT P    +RK +SKD        V M+LKSGL+ E +WAL+ +NI   DD+     NL  L    + +++ +R  L  IFG    +++ E   +   S  + +D   +L K +      L   +     ++ + G   +E  T    D
Sbjct: 1453 RRDLNYPPGSAEATMPVLRPRRKLTSKDTGTPEAWRVMMSLKSGLLAETTWALDTINILLYDDSTVASFNLSQLPGFLELIVEYFRRCLIEIFG---ILEEFE---VGGASHKHSSDADLILGKEQETDSAPLPETEASLPADVAQTGSTNAEAATAQPPD 1607          
BLAST of ARID domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000034945.1 (AT-rich interactive domain-containing protein 1B [Source:NCBI gene;Acc:101156929])

HSP 1 Score: 117.857 bits (294), Expect = 9.385e-26
Identity = 100/317 (31.55%), Postives = 164/317 (51.74%), Query Frame = 1
Query: 4810 RCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEHSIDEWPPPN------QE------KECWWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPS---HRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQE-LFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIE--ITESQIR---HVVDNMGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLL 5697
            RC+ +SN +R+LSF+ GND  +  +  ++++LG+LLLL H H       P+      QE      KE WW   +  +RE+  VTL N++  L+LS + + I  P++ GLLHW+ C S+ A+D  PS   H  L  +RL LE + +L + + N+D +L+T         QE LF  L         QV +EM++AV+ +L+ G       I +   Q   +  L++F+E  ++ +Q +   H + +MG       P +   S+  +  +   L  +A  E N+  F   +E R+L++ IS+VL+  V   I  VL+ L
Sbjct: 1894 RCLCISNVVRSLSFIPGNDSDMSRHPALVLLLGKLLLLHHLHPERNRSAPSYQKEEQQERGLSNSKEEWWWDCLSLLRENAMVTLANMAGQLDLSTYPDTICLPVLDGLLHWMVCPSSEAQDPFPSAAPHSQLTPQRLVLECLCKLSIQDGNVDLLLATP----PFSRQEKLFAVLVRYVSQRKAQVFREMAVAVLSHLAQGDPTAARAIAM---QKGSVGNLVAFLEDGVSMAQYQQNPHSLLHMG------HPPMDPPSVNMMCRAAKGLLAMAKVEENKTEFVL-YENRLLDISISSVLNTGVVAIICQVLFHL 2196          

HSP 2 Score: 117.472 bits (293), Expect = 1.418e-25
Identity = 60/136 (44.12%), Postives = 83/136 (61.03%), Query Frame = 1
Query: 1861 PQQRPFTPNPNMIPNRQYHHNESQTNNSCYQKLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADP 2268
            P + P +P PN  PN       S   +    +L ELG+EPER  W+ERYL FM+E  TP++ +P V K+ LDL++LY AVRE GGL  V K K+W+E+   ++V  S+S A  L++ YI+ L  YECK +R    P
Sbjct:  967 PLKTPCSPKPN--PN-------SSLGSERITRLYELGSEPERQVWVERYLNFMEERGTPVTQLPVVGKKLLDLWKLYIAVREIGGLAMVNKNKKWRELSTTLSVGTSSSSASALKKQYIQYLFAYECKMERGEEPP 1093          

HSP 3 Score: 69.707 bits (169), Expect = 4.479e-11
Identity = 47/161 (29.19%), Postives = 74/161 (45.96%), Query Frame = 1
Query: 3748 RYDSLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFGRDLFIKDLELPVIIDESVSNKTDIKTLLSKIETV----LKNRQLKQEKEICKNGVIESEDDTKLAQD 4218
            R D  +PP S EAT P    +RK +SKD        V M+LKSGL+ E +WAL+ +NI   DD+     NL  L    + +++ +R  L  IFG    +++ E   +   S  + +D   +L K +      L   +     ++ + G   +E  T    D
Sbjct: 1542 RRDLNYPPGSAEATMPVLRPRRKLTSKDTGTPEAWRVMMSLKSGLLAETTWALDTINILLYDDSTVASFNLSQLPGFLELIVEYFRRCLIEIFG---ILEEFE---VGGASHKHSSDADLILGKEQETDSAPLPETEASLPADVAQTGSTNAEAATAQPPD 1696          
BLAST of ARID domain-containing protein vs. Planmine SMEST
Match: SMESG000074580.1 (SMESG000074580.1)

HSP 1 Score: 1602.42 bits (4148), Expect = 0.000e+0
Identity = 846/848 (99.76%), Postives = 848/848 (100.00%), Query Frame = 1
Query: 3268 IGSIQEHSRRMDWKSNYGGMXXXXXXXXNVQSTSRPNLPNTSQIGPGNHSQYHSTLPHGSNYVNQAPGPFSQQRQINPQLPSNLMPLNRNVLQTTNNNLSDQMNYINKXXXXXXXXXXXXXXXXXXPATCHNRSQIESSRLNTSYPSQITYSKSSSHFIKRYDSLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFGRDLFIKDLELPVIIDESVSNKTDIKTLLSKIETVLKNRQLKQEKEICKNGVIESEDDTKLAQDKILDLLHGVKYSVNRRGLTVKLDYNSKLEFALGGDSELSEFIIKTCXXXXXXXXXXXXXIDYLDDKLSKCKLNNLNDLWLIGGSDSTYHILPPILSQNKNTNNEWYLRLRSIDSHSQESADNSFGPPEIKRSRCTXXXXXXXXXXXXXXXXXHIGDLKFEETNEEIDFFRLQAKSEIVNDGEGLFFKIIESDEEKMMRCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEHSIDEWPPPNQEKECWWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPSHRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIEITESQIRHVVDNMGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLLCNHDENQNKPETCNKFKSFLTFNDLSFCEKDNSVSVLP 5811
            +GSIQEHSRRMDWKSNYGGMPPPPPPPPNVQSTSRPNLPNTSQIGPGNHSQYHSTLPHGSNYVNQAPGPFSQQRQINPQLPSNLMPLNRNVLQTTNNNLSDQMNYINKSMGPSSSSAIPNSIHSMSPATCHNRSQIESSRLNTSYPSQITYSKSSSHFIKRYDSLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFGRDLFIKDLELPVIIDESVSNKTDIKTLLSKIETVLKNRQLKQEKEICKNGVIESEDDTKLAQDKILDLLHGVKYSVNRRGLTVKLDYNSKLEFALGGDSELSEFIIKTCSNSQKNENDSNNNIDYLDDKLSKCKLNNLNDLWLIGGSDSTYHILPPILSQNKNTNNEWYLRLRSIDSHSQESADNSFGPPEIKRSRCTSPHSPSSSNPPNLEHESHIGDLKFEETNEEIDFFRLQAKSEIVNDGEGLFFKIIESDEEKMMRCISVSNSIRNLSFLSGNDRIIGSNRTILVILGRLLLLGHEHSIDEWPPPNQEKECWWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPSHRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIEITESQIRHVVDNMGMEALQARPELMGTSLEFLRHSGALLNR+ASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLLCNHDENQNKPETCNKFKSFLTFNDLSFCEKDNSVSVLP
Sbjct:  835 VGSIQEHSRRMDWKSNYGGMPPPPPPPPNVQSTSRPNLPNTSQIGPGNHSQYHSTLPHGSNYVNQAPGPFSQQRQINPQLPSNLMPLNRNVLQTTNNNLSDQMNYINKSMGPSSSSAIPNSIHSMSPATCHNRSQIESSRLNTSYPSQITYSKSSSHFIKRYDSLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFGRDLFIKDLELPVIIDESVSNKTDIKTLLSKIETVLKNRQLKQEKEICKNGVIESEDDTKLAQDKILDLLHGVKYSVNRRGLTVKLDYNSKLEFALGGDSELSEFIIKTCSNSQKNENDSNNNIDYLDDKLSKCKLNNLNDLWLIGGSDSTYHILPPILSQNKNTNNEWYLRLRSIDSHSQESADNSFGPPEIKRSRCTSPHSPSSSNPPNLEHESHIGDLKFEETNEEIDFFRLQAKSEIVNDGEGLFFKIIESDEEKMMRCISVSNSIRNLSFLSGNDRIIGSNRTILVILGRLLLLGHEHSIDEWPPPNQEKECWWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPSHRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIEITESQIRHVVDNMGMEALQARPELMGTSLEFLRHSGALLNRIASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLLCNHDENQNKPETCNKFKSFLTFNDLSFCEKDNSVSVLP 1682          

HSP 2 Score: 1518.06 bits (3929), Expect = 0.000e+0
Identity = 834/836 (99.76%), Postives = 834/836 (99.76%), Query Frame = 1
Query:  304 MEYSNSGATTNLQSPNHMSVEAVQHFGENSNETGVLSPATFSHYDEKQAXXXXXXXXXXXXXXXXXXXGPYSNIPFRPPPSSNYHANFRNYENNWNLSRSQAESARMYYSQYQETYPQNSNDITYSKIDKMKPSDYVISGDVQGNSNYKNENRSYQNSEIDKSKTNVQEWKTKNEPMSPLDSNNKDCISKVDNEIKSDKQNCIETDCNTSKSDSSVNPGFHINTSCTDSATEKSDNMHNGPNYAFDNKVNPSQIKSQPTTVGYDSSIYSHMMMHPNSPYYSQFRYNNPQQGNNTHNYINQASNAMMTSSIARPPVMNYPNYIQTSSXXXXXXXXXXXAMHQNRPYNVHSSFVSRGGSQSPFSSNSDIYMNGSIPQQNTGSKDLPDRK-DEVNAATSANQDTSSAGSNSNKSVNARSSSASKTKNTPKNESHPATPVSNTVPSPSQTSMSSMVDENEDSVSSLGPNETNMLHHPSISNQSQFNQHQITPPMSQNHSIIYPQPYPNNQVPHTMMSSFPSHLPPQQRPFTPNPNMIPNRQYHHNESQTNNSCYQKLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPILQEIQSLSDKKKKSTSRNAXXXXXXXXXXXXXXXHNSEYGSTSSTPRPAIPHPDFNTPHPFHGHNPYNNVIHNGSMMHRSPIHYPAQXXXXXXXXXXXXXXXXXFNSPVNPMHPHARYDANIPPNWNKSMVLNQQQWXXXXXXXXXXXTHPMQMPMSPGTPTXXXXXXXXXXXPPAG 2808
            MEYSNSGATTNLQSPNHMSVEAVQHFGENSNETGVLSPATFSHYDEKQAYQYQNQNSSLNQLLQNNQYGPYSNIPFRPPPSSNYHANFRNYENNWNLSRSQAESARMYYSQYQETYPQNSNDITYSKIDKMKPSDYVISGDVQGNSNYKNENRSYQNSEIDKSKTNVQEWKTKNEPMSPLDSNNKDCISKVDNEIKSDKQNCIETDCNTSKSDSSVNPGFHINTSCTDSATEKSDNMHNGPNYAFDNKVNPSQIKSQPTTVGYDSSIYSHMMMHPNSPYYSQFRYNNPQQGNNTHNYINQASNAMMTSSIARPPVMNYPNYIQTSSPGPGYGYIPPIAMHQNRPYNVHSSFVSRGGSQSPFSSNSDIYMNGSIPQQNTGSKDLPDRK DEVNAATSANQDTSSAGSNSNKSVNARSSSASKTKNTPKNESHPATPVSNTVPSPSQTSMSSMVDENEDSVSSLGPNETNMLHHPSISNQSQFNQHQITPPMSQNHSIIYPQPYPNNQVPHTMMSSFPSHLPPQQRPFTPNPNMIPNRQYHHNESQTNNSCYQKLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPILQEIQSLSDKKKKSTSRNAGSSPSSTISSGQTSQHNSEYGSTSSTPRPAIPHPDFNTPHPFHGHNPYNNVIHNGSMMHRSPIHYPAQRGHNPYPGPYNGPRMMGFNSPVNPMHPHARYDANIPPNWNKSMVLNQQQWSSPGSSSSSNSTHPMQMPMSPGTPTNSISNISQQSQPP G
Sbjct:    1 MEYSNSGATTNLQSPNHMSVEAVQHFGENSNETGVLSPATFSHYDEKQAYQYQNQNSSLNQLLQNNQYGPYSNIPFRPPPSSNYHANFRNYENNWNLSRSQAESARMYYSQYQETYPQNSNDITYSKIDKMKPSDYVISGDVQGNSNYKNENRSYQNSEIDKSKTNVQEWKTKNEPMSPLDSNNKDCISKVDNEIKSDKQNCIETDCNTSKSDSSVNPGFHINTSCTDSATEKSDNMHNGPNYAFDNKVNPSQIKSQPTTVGYDSSIYSHMMMHPNSPYYSQFRYNNPQQGNNTHNYINQASNAMMTSSIARPPVMNYPNYIQTSSPGPGYGYIPPIAMHQNRPYNVHSSFVSRGGSQSPFSSNSDIYMNGSIPQQNTGSKDLPDRKADEVNAATSANQDTSSAGSNSNKSVNARSSSASKTKNTPKNESHPATPVSNTVPSPSQTSMSSMVDENEDSVSSLGPNETNMLHHPSISNQSQFNQHQITPPMSQNHSIIYPQPYPNNQVPHTMMSSFPSHLPPQQRPFTPNPNMIPNRQYHHNESQTNNSCYQKLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPILQEIQSLSDKKKKSTSRNAGSSPSSTISSGQTSQHNSEYGSTSSTPRPAIPHPDFNTPHPFHGHNPYNNVIHNGSMMHRSPIHYPAQRGHNPYPGPYNGPRMMGFNSPVNPMHPHARYDANIPPNWNKSMVLNQQQWSSPGSSSSSNSTHPMQMPMSPGTPTNSISNISQQSQPPVG 836          
BLAST of ARID domain-containing protein vs. Planmine SMEST
Match: SMESG000074580.1 (SMESG000074580.1)

HSP 1 Score: 1602.42 bits (4148), Expect = 0.000e+0
Identity = 846/848 (99.76%), Postives = 848/848 (100.00%), Query Frame = 1
Query: 3268 IGSIQEHSRRMDWKSNYGGMXXXXXXXXNVQSTSRPNLPNTSQIGPGNHSQYHSTLPHGSNYVNQAPGPFSQQRQINPQLPSNLMPLNRNVLQTTNNNLSDQMNYINKXXXXXXXXXXXXXXXXXXPATCHNRSQIESSRLNTSYPSQITYSKSSSHFIKRYDSLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFGRDLFIKDLELPVIIDESVSNKTDIKTLLSKIETVLKNRQLKQEKEICKNGVIESEDDTKLAQDKILDLLHGVKYSVNRRGLTVKLDYNSKLEFALGGDSELSEFIIKTCXXXXXXXXXXXXXIDYLDDKLSKCKLNNLNDLWLIGGSDSTYHILPPILSQNKNTNNEWYLRLRSIDSHSQESADNSFGPPEIKRSRCTXXXXXXXXXXXXXXXXXHIGDLKFEETNEEIDFFRLQAKSEIVNDGEGLFFKIIESDEEKMMRCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEHSIDEWPPPNQEKECWWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPSHRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIEITESQIRHVVDNMGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLLCNHDENQNKPETCNKFKSFLTFNDLSFCEKDNSVSVLP 5811
            +GSIQEHSRRMDWKSNYGGMPPPPPPPPNVQSTSRPNLPNTSQIGPGNHSQYHSTLPHGSNYVNQAPGPFSQQRQINPQLPSNLMPLNRNVLQTTNNNLSDQMNYINKSMGPSSSSAIPNSIHSMSPATCHNRSQIESSRLNTSYPSQITYSKSSSHFIKRYDSLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFGRDLFIKDLELPVIIDESVSNKTDIKTLLSKIETVLKNRQLKQEKEICKNGVIESEDDTKLAQDKILDLLHGVKYSVNRRGLTVKLDYNSKLEFALGGDSELSEFIIKTCSNSQKNENDSNNNIDYLDDKLSKCKLNNLNDLWLIGGSDSTYHILPPILSQNKNTNNEWYLRLRSIDSHSQESADNSFGPPEIKRSRCTSPHSPSSSNPPNLEHESHIGDLKFEETNEEIDFFRLQAKSEIVNDGEGLFFKIIESDEEKMMRCISVSNSIRNLSFLSGNDRIIGSNRTILVILGRLLLLGHEHSIDEWPPPNQEKECWWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPSHRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIEITESQIRHVVDNMGMEALQARPELMGTSLEFLRHSGALLNR+ASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLLCNHDENQNKPETCNKFKSFLTFNDLSFCEKDNSVSVLP
Sbjct:  831 VGSIQEHSRRMDWKSNYGGMPPPPPPPPNVQSTSRPNLPNTSQIGPGNHSQYHSTLPHGSNYVNQAPGPFSQQRQINPQLPSNLMPLNRNVLQTTNNNLSDQMNYINKSMGPSSSSAIPNSIHSMSPATCHNRSQIESSRLNTSYPSQITYSKSSSHFIKRYDSLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFGRDLFIKDLELPVIIDESVSNKTDIKTLLSKIETVLKNRQLKQEKEICKNGVIESEDDTKLAQDKILDLLHGVKYSVNRRGLTVKLDYNSKLEFALGGDSELSEFIIKTCSNSQKNENDSNNNIDYLDDKLSKCKLNNLNDLWLIGGSDSTYHILPPILSQNKNTNNEWYLRLRSIDSHSQESADNSFGPPEIKRSRCTSPHSPSSSNPPNLEHESHIGDLKFEETNEEIDFFRLQAKSEIVNDGEGLFFKIIESDEEKMMRCISVSNSIRNLSFLSGNDRIIGSNRTILVILGRLLLLGHEHSIDEWPPPNQEKECWWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPSHRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIEITESQIRHVVDNMGMEALQARPELMGTSLEFLRHSGALLNRIASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLLCNHDENQNKPETCNKFKSFLTFNDLSFCEKDNSVSVLP 1678          

HSP 2 Score: 1504.58 bits (3894), Expect = 0.000e+0
Identity = 830/836 (99.28%), Postives = 830/836 (99.28%), Query Frame = 1
Query:  304 MEYSNSGATTNLQSPNHMSVEAVQHFGENSNETGVLSPATFSHYDEKQAXXXXXXXXXXXXXXXXXXXGPYSNIPFRPPPSSNYHANFRNYENNWNLSRSQAESARMYYSQYQETYPQNSNDITYSKIDKMKPSDYVISGDVQGNSNYKNENRSYQNSEIDKSKTNVQEWKTKNEPMSPLDSNNKDCISKVDNEIKSDKQNCIETDCNTSKSDSSVNPGFHINTSCTDSATEKSDNMHNGPNYAFDNKVNPSQIKSQPTTVGYDSSIYSHMMMHPNSPYYSQFRYNNPQQGNNTHNYINQASNAMMTSSIARPPVMNYPNYIQTSSXXXXXXXXXXXAMHQNRPYNVHSSFVSRGGSQSPFSSNSDIYMNGSIPQQNTGSKDLPDRK-DEVNAATSANQDTSSAGSNSNKSVNARSSSASKTKNTPKNESHPATPVSNTVPSPSQTSMSSMVDENEDSVSSLGPNETNMLHHPSISNQSQFNQHQITPPMSQNHSIIYPQPYPNNQVPHTMMSSFPSHLPPQQRPFTPNPNMIPNRQYHHNESQTNNSCYQKLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPILQEIQSLSDKKKKSTSRNAXXXXXXXXXXXXXXXHNSEYGSTSSTPRPAIPHPDFNTPHPFHGHNPYNNVIHNGSMMHRSPIHYPAQXXXXXXXXXXXXXXXXXFNSPVNPMHPHARYDANIPPNWNKSMVLNQQQWXXXXXXXXXXXTHPMQMPMSPGTPTXXXXXXXXXXXPPAG 2808
            MEYSNSGATTNLQSPNHMSVEAVQHFGENSNETGVLSPATFSHYDEKQAYQYQNQNSSLNQLLQNNQYGPYSNIPFRPPPSSNYHANFRNYENNWNLSRSQAESARMYYSQYQETYPQNSNDITYSKIDKMKPSDYVISGDVQGNSNYKNENRSYQNSEIDKSKTNVQEWKTKNEPMSPLDSNNKDCISK    IKSDKQNCIETDCNTSKSDSSVNPGFHINTSCTDSATEKSDNMHNGPNYAFDNKVNPSQIKSQPTTVGYDSSIYSHMMMHPNSPYYSQFRYNNPQQGNNTHNYINQASNAMMTSSIARPPVMNYPNYIQTSSPGPGYGYIPPIAMHQNRPYNVHSSFVSRGGSQSPFSSNSDIYMNGSIPQQNTGSKDLPDRK DEVNAATSANQDTSSAGSNSNKSVNARSSSASKTKNTPKNESHPATPVSNTVPSPSQTSMSSMVDENEDSVSSLGPNETNMLHHPSISNQSQFNQHQITPPMSQNHSIIYPQPYPNNQVPHTMMSSFPSHLPPQQRPFTPNPNMIPNRQYHHNESQTNNSCYQKLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPILQEIQSLSDKKKKSTSRNAGSSPSSTISSGQTSQHNSEYGSTSSTPRPAIPHPDFNTPHPFHGHNPYNNVIHNGSMMHRSPIHYPAQRGHNPYPGPYNGPRMMGFNSPVNPMHPHARYDANIPPNWNKSMVLNQQQWSSPGSSSSSNSTHPMQMPMSPGTPTNSISNISQQSQPP G
Sbjct:    1 MEYSNSGATTNLQSPNHMSVEAVQHFGENSNETGVLSPATFSHYDEKQAYQYQNQNSSLNQLLQNNQYGPYSNIPFRPPPSSNYHANFRNYENNWNLSRSQAESARMYYSQYQETYPQNSNDITYSKIDKMKPSDYVISGDVQGNSNYKNENRSYQNSEIDKSKTNVQEWKTKNEPMSPLDSNNKDCISK----IKSDKQNCIETDCNTSKSDSSVNPGFHINTSCTDSATEKSDNMHNGPNYAFDNKVNPSQIKSQPTTVGYDSSIYSHMMMHPNSPYYSQFRYNNPQQGNNTHNYINQASNAMMTSSIARPPVMNYPNYIQTSSPGPGYGYIPPIAMHQNRPYNVHSSFVSRGGSQSPFSSNSDIYMNGSIPQQNTGSKDLPDRKADEVNAATSANQDTSSAGSNSNKSVNARSSSASKTKNTPKNESHPATPVSNTVPSPSQTSMSSMVDENEDSVSSLGPNETNMLHHPSISNQSQFNQHQITPPMSQNHSIIYPQPYPNNQVPHTMMSSFPSHLPPQQRPFTPNPNMIPNRQYHHNESQTNNSCYQKLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPILQEIQSLSDKKKKSTSRNAGSSPSSTISSGQTSQHNSEYGSTSSTPRPAIPHPDFNTPHPFHGHNPYNNVIHNGSMMHRSPIHYPAQRGHNPYPGPYNGPRMMGFNSPVNPMHPHARYDANIPPNWNKSMVLNQQQWSSPGSSSSSNSTHPMQMPMSPGTPTNSISNISQQSQPPVG 832          
BLAST of ARID domain-containing protein vs. Planmine SMEST
Match: SMESG000074580.1 (SMESG000074580.1)

HSP 1 Score: 1587.78 bits (4110), Expect = 0.000e+0
Identity = 846/848 (99.76%), Postives = 848/848 (100.00%), Query Frame = 1
Query: 3268 IGSIQEHSRRMDWKSNYGGMXXXXXXXXNVQSTSRPNLPNTSQIGPGNHSQYHSTLPHGSNYVNQAPGPFSQQRQINPQLPSNLMPLNRNVLQTTNNNLSDQMNYINKXXXXXXXXXXXXXXXXXXPATCHNRSQIESSRLNTSYPSQITYSKSSSHFIKRYDSLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFGRDLFIKDLELPVIIDESVSNKTDIKTLLSKIETVLKNRQLKQEKEICKNGVIESEDDTKLAQDKILDLLHGVKYSVNRRGLTVKLDYNSKLEFALGGDSELSEFIIKTCXXXXXXXXXXXXXIDYLDDKLSKCKLNNLNDLWLIGGSDSTYHILPPILSQNKNTNNEWYLRLRSIDSHSQESADNSFGPPEIKRSRCTXXXXXXXXXXXXXXXXXHIGDLKFEETNEEIDFFRLQAKSEIVNDGEGLFFKIIESDEEKMMRCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEHSIDEWPPPNQEKECWWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPSHRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIEITESQIRHVVDNMGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLLCNHDENQNKPETCNKFKSFLTFNDLSFCEKDNSVSVLP 5811
            +GSIQEHSRRMDWKSNYGGMPPPPPPPPNVQSTSRPNLPNTSQIGPGNHSQYHSTLPHGSNYVNQAPGPFSQQRQINPQLPSNLMPLNRNVLQTTNNNLSDQMNYINKSMGPSSSSAIPNSIHSMSPATCHNRSQIESSRLNTSYPSQITYSKSSSHFIKRYDSLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFGRDLFIKDLELPVIIDESVSNKTDIKTLLSKIETVLKNRQLKQEKEICKNGVIESEDDTKLAQDKILDLLHGVKYSVNRRGLTVKLDYNSKLEFALGGDSELSEFIIKTCSNSQKNENDSNNNIDYLDDKLSKCKLNNLNDLWLIGGSDSTYHILPPILSQNKNTNNEWYLRLRSIDSHSQESADNSFGPPEIKRSRCTSPHSPSSSNPPNLEHESHIGDLKFEETNEEIDFFRLQAKSEIVNDGEGLFFKIIESDEEKMMRCISVSNSIRNLSFLSGNDRIIGSNRTILVILGRLLLLGHEHSIDEWPPPNQEKECWWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPSHRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIEITESQIRHVVDNMGMEALQARPELMGTSLEFLRHSGALLNR+ASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLLCNHDENQNKPETCNKFKSFLTFNDLSFCEKDNSVSVLP
Sbjct:  388 VGSIQEHSRRMDWKSNYGGMPPPPPPPPNVQSTSRPNLPNTSQIGPGNHSQYHSTLPHGSNYVNQAPGPFSQQRQINPQLPSNLMPLNRNVLQTTNNNLSDQMNYINKSMGPSSSSAIPNSIHSMSPATCHNRSQIESSRLNTSYPSQITYSKSSSHFIKRYDSLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFGRDLFIKDLELPVIIDESVSNKTDIKTLLSKIETVLKNRQLKQEKEICKNGVIESEDDTKLAQDKILDLLHGVKYSVNRRGLTVKLDYNSKLEFALGGDSELSEFIIKTCSNSQKNENDSNNNIDYLDDKLSKCKLNNLNDLWLIGGSDSTYHILPPILSQNKNTNNEWYLRLRSIDSHSQESADNSFGPPEIKRSRCTSPHSPSSSNPPNLEHESHIGDLKFEETNEEIDFFRLQAKSEIVNDGEGLFFKIIESDEEKMMRCISVSNSIRNLSFLSGNDRIIGSNRTILVILGRLLLLGHEHSIDEWPPPNQEKECWWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPSHRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIEITESQIRHVVDNMGMEALQARPELMGTSLEFLRHSGALLNRIASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLLCNHDENQNKPETCNKFKSFLTFNDLSFCEKDNSVSVLP 1235          

HSP 2 Score: 696.812 bits (1797), Expect = 0.000e+0
Identity = 388/389 (99.74%), Postives = 388/389 (99.74%), Query Frame = 1
Query: 1642 MSSMVDENEDSVSSLGPNETNMLHHPSISNQSQFNQHQITPPMSQNHSIIYPQPYPNNQVPHTMMSSFPSHLPPQQRPFTPNPNMIPNRQYHHNESQTNNSCYQKLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPILQEIQSLSDKKKKSTSRNAXXXXXXXXXXXXXXXHNSEYGSTSSTPRPAIPHPDFNTPHPFHGHNPYNNVIHNGSMMHRSPIHYPAQXXXXXXXXXXXXXXXXXFNSPVNPMHPHARYDANIPPNWNKSMVLNQQQWXXXXXXXXXXXTHPMQMPMSPGTPTXXXXXXXXXXXPPAG 2808
            MSSMVDENEDSVSSLGPNETNMLHHPSISNQSQFNQHQITPPMSQNHSIIYPQPYPNNQVPHTMMSSFPSHLPPQQRPFTPNPNMIPNRQYHHNESQTNNSCYQKLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPILQEIQSLSDKKKKSTSRNAGSSPSSTISSGQTSQHNSEYGSTSSTPRPAIPHPDFNTPHPFHGHNPYNNVIHNGSMMHRSPIHYPAQRGHNPYPGPYNGPRMMGFNSPVNPMHPHARYDANIPPNWNKSMVLNQQQWSSPGSSSSSNSTHPMQMPMSPGTPTNSISNISQQSQPP G
Sbjct:    1 MSSMVDENEDSVSSLGPNETNMLHHPSISNQSQFNQHQITPPMSQNHSIIYPQPYPNNQVPHTMMSSFPSHLPPQQRPFTPNPNMIPNRQYHHNESQTNNSCYQKLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPILQEIQSLSDKKKKSTSRNAGSSPSSTISSGQTSQHNSEYGSTSSTPRPAIPHPDFNTPHPFHGHNPYNNVIHNGSMMHRSPIHYPAQRGHNPYPGPYNGPRMMGFNSPVNPMHPHARYDANIPPNWNKSMVLNQQQWSSPGSSSSSNSTHPMQMPMSPGTPTNSISNISQQSQPPVG 389          
BLAST of ARID domain-containing protein vs. Planmine SMEST
Match: SMESG000074600.1 (SMESG000074600.1)

HSP 1 Score: 1491.09 bits (3859), Expect = 0.000e+0
Identity = 797/848 (93.99%), Postives = 799/848 (94.22%), Query Frame = 1
Query: 3268 IGSIQEHSRRMDWKSNYGGMXXXXXXXXNVQSTSRPNLPNTSQIGPGNHSQYHSTLPHGSNYVNQAPGPFSQQRQINPQLPSNLMPLNRNVLQTTNNNLSDQMNYINKXXXXXXXXXXXXXXXXXXPATCHNRSQIESSRLNTSYPSQITYSKSSSHFIKRYDSLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFGRDLFIKDLELPVIIDESVSNKTDIKTLLSKIETVLKNRQLKQEKEICKNGVIESEDDTKLAQDKILDLLHGVKYSVNRRGLTVKLDYNSKLEFALGGDSELSEFIIKTCXXXXXXXXXXXXXIDYLDDKLSKCKLNNLNDLWLIGGSDSTYHILPPILSQNKNTNNEWYLRLRSIDSHSQESADNSFGPPEIKRSRCTXXXXXXXXXXXXXXXXXHIGDLKFEETNEEIDFFRLQAKSEIVNDGEGLFFKIIESDEEKMMRCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEHSIDEWPPPNQEKECWWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPSHRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIEITESQIRHVVDNMGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLLCNHDENQNKPETCNKFKSFLTFNDLSFCEKDNSVSVLP 5811
            +GSIQEHSRRMDWKSNYGGMPPPPPPPPNVQSTSRPNLPNTSQIGPGNHSQYHSTLPHGSNYVNQAPGPFSQQRQINPQLPSNLMPLNRNVLQTTNNNLSDQMNYINKSMGPSSSSAIPNSIHSMSPATCHNRSQIESSRLNTSYPSQITYSKSSSHFIKRYDSLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFGRDLFIKDLELPVIIDESVSNKTDIKTLLSKIETVLKNRQLKQEKEICKNGVIESEDDTKLAQDKILDLLHGVKYSVNRRGLTVKLDYNSKLEFAL                               DDKLSKCKLNNLNDLWLIGGSDSTYHILPPILSQNKNTNNEWYLRLRSIDSHSQESADNSFGPPEIKRSRCTSPHSPSSSNPPNLEHESHIGDLKFEETNEEIDFFRLQAKSEIVNDGEGLFFKIIESDEEKMMRCISVSNSIRNLSFLSGNDRIIGSNRTILVILGRLLLLGHEHSIDEWPPPNQEKECWWLKWIDDIREHVFVTLVNISS                  LLHWLTCNSAAAEDSLPSHRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIEITESQIRHVVDNMGMEALQARPELMGTSLEFLRHSGALLNR+ASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLLCNHDENQNKPETCNKFKSFLTFNDLSFCEKDNSVSVLP
Sbjct:  388 VGSIQEHSRRMDWKSNYGGMPPPPPPPPNVQSTSRPNLPNTSQIGPGNHSQYHSTLPHGSNYVNQAPGPFSQQRQINPQLPSNLMPLNRNVLQTTNNNLSDQMNYINKSMGPSSSSAIPNSIHSMSPATCHNRSQIESSRLNTSYPSQITYSKSSSHFIKRYDSLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFGRDLFIKDLELPVIIDESVSNKTDIKTLLSKIETVLKNRQLKQEKEICKNGVIESEDDTKLAQDKILDLLHGVKYSVNRRGLTVKLDYNSKLEFAL-------------------------------DDKLSKCKLNNLNDLWLIGGSDSTYHILPPILSQNKNTNNEWYLRLRSIDSHSQESADNSFGPPEIKRSRCTSPHSPSSSNPPNLEHESHIGDLKFEETNEEIDFFRLQAKSEIVNDGEGLFFKIIESDEEKMMRCISVSNSIRNLSFLSGNDRIIGSNRTILVILGRLLLLGHEHSIDEWPPPNQEKECWWLKWIDDIREHVFVTLVNISS------------------LLHWLTCNSAAAEDSLPSHRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIEITESQIRHVVDNMGMEALQARPELMGTSLEFLRHSGALLNRIASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLLCNHDENQNKPETCNKFKSFLTFNDLSFCEKDNSVSVLP 1186          

HSP 2 Score: 695.656 bits (1794), Expect = 0.000e+0
Identity = 387/389 (99.49%), Postives = 388/389 (99.74%), Query Frame = 1
Query: 1642 MSSMVDENEDSVSSLGPNETNMLHHPSISNQSQFNQHQITPPMSQNHSIIYPQPYPNNQVPHTMMSSFPSHLPPQQRPFTPNPNMIPNRQYHHNESQTNNSCYQKLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPILQEIQSLSDKKKKSTSRNAXXXXXXXXXXXXXXXHNSEYGSTSSTPRPAIPHPDFNTPHPFHGHNPYNNVIHNGSMMHRSPIHYPAQXXXXXXXXXXXXXXXXXFNSPVNPMHPHARYDANIPPNWNKSMVLNQQQWXXXXXXXXXXXTHPMQMPMSPGTPTXXXXXXXXXXXPPAG 2808
            MSSMVDENEDSVSSLGPNETNMLHHPSISNQSQFNQHQITPPMSQNHSIIYPQPYPNNQVPHTMMSSFPSHLPPQQRPFTPNPNMIPNRQYHHNESQTNNSCYQKLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPILQEIQSLSDKKKKSTSRNAGSSPSSTISSGQTSQHNSEYGSTSSTPRPA+PHPDFNTPHPFHGHNPYNNVIHNGSMMHRSPIHYPAQRGHNPYPGPYNGPRMMGFNSPVNPMHPHARYDANIPPNWNKSMVLNQQQWSSPGSSSSSNSTHPMQMPMSPGTPTNSISNISQQSQPP G
Sbjct:    1 MSSMVDENEDSVSSLGPNETNMLHHPSISNQSQFNQHQITPPMSQNHSIIYPQPYPNNQVPHTMMSSFPSHLPPQQRPFTPNPNMIPNRQYHHNESQTNNSCYQKLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPILQEIQSLSDKKKKSTSRNAGSSPSSTISSGQTSQHNSEYGSTSSTPRPAMPHPDFNTPHPFHGHNPYNNVIHNGSMMHRSPIHYPAQRGHNPYPGPYNGPRMMGFNSPVNPMHPHARYDANIPPNWNKSMVLNQQQWSSPGSSSSSNSTHPMQMPMSPGTPTNSISNISQQSQPPVG 389          
BLAST of ARID domain-containing protein vs. Planmine SMEST
Match: SMESG000074600.1 (SMESG000074600.1)

HSP 1 Score: 1474.14 bits (3815), Expect = 0.000e+0
Identity = 791/848 (93.28%), Postives = 794/848 (93.63%), Query Frame = 1
Query: 3268 IGSIQEHSRRMDWKSNYGGMXXXXXXXXNVQSTSRPNLPNTSQIGPGNHSQYHSTLPHGSNYVNQAPGPFSQQRQINPQLPSNLMPLNRNVLQTTNNNLSDQMNYINKXXXXXXXXXXXXXXXXXXPATCHNRSQIESSRLNTSYPSQITYSKSSSHFIKRYDSLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFGRDLFIKDLELPVIIDESVSNKTDIKTLLSKIETVLKNRQLKQEKEICKNGVIESEDDTKLAQDKILDLLHGVKYSVNRRGLTVKLDYNSKLEFALGGDSELSEFIIKTCXXXXXXXXXXXXXIDYLDDKLSKCKLNNLNDLWLIGGSDSTYHILPPILSQNKNTNNEWYLRLRSIDSHSQESADNSFGPPEIKRSRCTXXXXXXXXXXXXXXXXXHIGDLKFEETNEEIDFFRLQAKSEIVNDGEGLFFKIIESDEEKMMRCISVSNSIRNLSFLSGNDRIIGSNRTXXXXXXXXXXXXHEHSIDEWPPPNQEKECWWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLLHWLTCNSAAAEDSLPSHRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIEITESQIRHVVDNMGMEALQARPELMGTSLEFLRHSGALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLLCNHDENQNKPETCNKFKSFLTFNDLSFCEKDNSVSVLP 5811
            +GSIQEHSRRMDWKSNYGGMPPPPPPPPNVQSTSRPNLPNTSQIGPGNHSQYHSTLPHGSNYVNQAPGPFSQQRQINPQLPSNLMPLNRNVLQTTNNNLSDQMNYINKSMGPSSSSAIPNSIHSMSPATCHNRSQIESSRLNTSYPSQITYSKSSSHFIKRYDSLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFGRDLFIKDLELPVIIDESVSNKTDIKTLLSKIETVLKNRQLKQEKEICKNGVIESEDDTKLAQDKILDLLHGVKYSVNRRGLTVKLDYNSKLEFAL                               DDKLSKCKLNNLNDLWLIGGSDSTYHILPPILSQNKNTNNEWYLRLRSIDSHSQESADNSFGPPEIKRSRCTSPHSPSSSNPPNLEHESHIGDLKFEETNEEIDFFRLQAKSEIVNDGEGLFFKIIESDEEKMMRCISVSNSIRNLSFLSGNDRIIGSNRTILVILGRLLLLGHEHSIDEWPPPNQEKECWWLKWIDDIREHVFVTLVNISSYLEL+                       AAEDSLPSHRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIEITESQIRHVVDNMGMEALQARPELMGTSLEFLRHSGALLNR+ASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLLCNHDENQNKPETCNKFKSFLTFNDLSFCEKDNSVSVLP
Sbjct:  388 VGSIQEHSRRMDWKSNYGGMPPPPPPPPNVQSTSRPNLPNTSQIGPGNHSQYHSTLPHGSNYVNQAPGPFSQQRQINPQLPSNLMPLNRNVLQTTNNNLSDQMNYINKSMGPSSSSAIPNSIHSMSPATCHNRSQIESSRLNTSYPSQITYSKSSSHFIKRYDSLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWALNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFGRDLFIKDLELPVIIDESVSNKTDIKTLLSKIETVLKNRQLKQEKEICKNGVIESEDDTKLAQDKILDLLHGVKYSVNRRGLTVKLDYNSKLEFAL-------------------------------DDKLSKCKLNNLNDLWLIGGSDSTYHILPPILSQNKNTNNEWYLRLRSIDSHSQESADNSFGPPEIKRSRCTSPHSPSSSNPPNLEHESHIGDLKFEETNEEIDFFRLQAKSEIVNDGEGLFFKIIESDEEKMMRCISVSNSIRNLSFLSGNDRIIGSNRTILVILGRLLLLGHEHSIDEWPPPNQEKECWWLKWIDDIREHVFVTLVNISSYLELT-----------------------AAEDSLPSHRVLGCRRLALESMMRLCVHEKNIDFILSTTNKGSDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLANAQPNIISGLISFIEITESQIRHVVDNMGMEALQARPELMGTSLEFLRHSGALLNRIASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLLCNHDENQNKPETCNKFKSFLTFNDLSFCEKDNSVSVLP 1181          

HSP 2 Score: 695.656 bits (1794), Expect = 0.000e+0
Identity = 387/389 (99.49%), Postives = 388/389 (99.74%), Query Frame = 1
Query: 1642 MSSMVDENEDSVSSLGPNETNMLHHPSISNQSQFNQHQITPPMSQNHSIIYPQPYPNNQVPHTMMSSFPSHLPPQQRPFTPNPNMIPNRQYHHNESQTNNSCYQKLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPILQEIQSLSDKKKKSTSRNAXXXXXXXXXXXXXXXHNSEYGSTSSTPRPAIPHPDFNTPHPFHGHNPYNNVIHNGSMMHRSPIHYPAQXXXXXXXXXXXXXXXXXFNSPVNPMHPHARYDANIPPNWNKSMVLNQQQWXXXXXXXXXXXTHPMQMPMSPGTPTXXXXXXXXXXXPPAG 2808
            MSSMVDENEDSVSSLGPNETNMLHHPSISNQSQFNQHQITPPMSQNHSIIYPQPYPNNQVPHTMMSSFPSHLPPQQRPFTPNPNMIPNRQYHHNESQTNNSCYQKLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPILQEIQSLSDKKKKSTSRNAGSSPSSTISSGQTSQHNSEYGSTSSTPRPA+PHPDFNTPHPFHGHNPYNNVIHNGSMMHRSPIHYPAQRGHNPYPGPYNGPRMMGFNSPVNPMHPHARYDANIPPNWNKSMVLNQQQWSSPGSSSSSNSTHPMQMPMSPGTPTNSISNISQQSQPP G
Sbjct:    1 MSSMVDENEDSVSSLGPNETNMLHHPSISNQSQFNQHQITPPMSQNHSIIYPQPYPNNQVPHTMMSSFPSHLPPQQRPFTPNPNMIPNRQYHHNESQTNNSCYQKLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVRERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDRNSADPGPILQEIQSLSDKKKKSTSRNAGSSPSSTISSGQTSQHNSEYGSTSSTPRPAMPHPDFNTPHPFHGHNPYNNVIHNGSMMHRSPIHYPAQRGHNPYPGPYNGPRMMGFNSPVNPMHPHARYDANIPPNWNKSMVLNQQQWSSPGSSSSSNSTHPMQMPMSPGTPTNSISNISQQSQPPVG 389          
The following BLAST results are available for this feature:
BLAST of ARID domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARID1B5.519e-3135.13AT-rich interaction domain 1B [Source:HGNC Symbol;... [more]
ARID1B5.618e-3135.13AT-rich interaction domain 1B [Source:HGNC Symbol;... [more]
ARID1B6.291e-3135.13AT-rich interaction domain 1B [Source:HGNC Symbol;... [more]
ARID1B7.374e-3135.13AT-rich interaction domain 1B [Source:HGNC Symbol;... [more]
ARID1B1.062e-3035.13AT-rich interaction domain 1B [Source:HGNC Symbol;... [more]
back to top
BLAST of ARID domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
let-5261.790e-2228.10pep chromosome:WBcel235:I:5300901:5313926:-1 gene:... [more]
let-5261.893e-2228.10pep chromosome:WBcel235:I:5300901:5310726:-1 gene:... [more]
let-5261.910e-2228.10pep chromosome:WBcel235:I:5300901:5313926:-1 gene:... [more]
let-5261.910e-2228.10pep chromosome:WBcel235:I:5300901:5317392:-1 gene:... [more]
let-5262.916e-2028.10pep chromosome:WBcel235:I:5301002:5304785:-1 gene:... [more]
back to top
BLAST of ARID domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
osa5.716e-4436.62gene:FBgn0261885 transcript:FBtr0335025[more]
osa5.959e-4436.62gene:FBgn0261885 transcript:FBtr0089583[more]
osa6.008e-4436.62gene:FBgn0261885 transcript:FBtr0335024[more]
osa7.478e-4436.62gene:FBgn0261885 transcript:FBtr0089582[more]
osa7.948e-4436.62gene:FBgn0261885 transcript:FBtr0089581[more]
back to top
BLAST of ARID domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arid1aa5.809e-2828.16AT rich interactive domain 1Aa (SWI-like) [Source:... [more]
arid1aa5.909e-2828.16AT rich interactive domain 1Aa (SWI-like) [Source:... [more]
arid1b4.598e-2633.03AT rich interactive domain 1B (SWI1-like) [Source:... [more]
arid1b4.786e-2633.03AT rich interactive domain 1B (SWI1-like) [Source:... [more]
arid1b4.828e-2633.03AT rich interactive domain 1B (SWI1-like) [Source:... [more]
back to top
BLAST of ARID domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARID1B1.507e-2634.49AT-rich interaction domain 1B [Source:NCBI gene;Ac... [more]
ARID1B1.750e-2634.49AT-rich interaction domain 1B [Source:NCBI gene;Ac... [more]
ARID1B4.235e-2634.48AT-rich interaction domain 1B [Source:NCBI gene;Ac... [more]
ARID1B4.516e-2647.46AT-rich interaction domain 1B [Source:NCBI gene;Ac... [more]
ARID1B4.637e-2647.46AT-rich interaction domain 1B [Source:NCBI gene;Ac... [more]
back to top
BLAST of ARID domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Arid1b1.211e-3035.13AT rich interactive domain 1B (SWI-like) [Source:M... [more]
Arid1b1.621e-3035.13AT rich interactive domain 1B (SWI-like) [Source:M... [more]
Arid1b1.719e-3035.13AT rich interactive domain 1B (SWI-like) [Source:M... [more]
Arid1b1.984e-3035.13AT rich interactive domain 1B (SWI-like) [Source:M... [more]
Arid1a5.358e-2631.51AT rich interactive domain 1A (SWI-like) [Source:M... [more]
back to top
BLAST of ARID domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8IN94|OSA_DROME7.968e-4336.62Trithorax group protein osa OS=Drosophila melanoga... [more]
sp|Q8NFD5|ARI1B_HUMAN8.796e-3035.13AT-rich interactive domain-containing protein 1B O... [more]
sp|E9Q4N7|ARI1B_MOUSE1.134e-2935.13AT-rich interactive domain-containing protein 1B O... [more]
sp|A2BH40|ARI1A_MOUSE5.223e-2531.51AT-rich interactive domain-containing protein 1A O... [more]
sp|O14497|ARI1A_HUMAN5.313e-2531.51AT-rich interactive domain-containing protein 1A O... [more]
back to top
BLAST of ARID domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G4VMH91.218e-6844.16ARID domain-containing protein OS=Schistosoma mans... [more]
A0A183KPQ21.310e-6843.87ARID domain-containing protein OS=Schistosoma cura... [more]
A0A183NEL51.458e-6843.59ARID domain-containing protein OS=Schistosoma matt... [more]
A0A0R3SQA77.903e-6735.31BAF250_C domain-containing protein OS=Hymenolepis ... [more]
A0A0R3T1R17.969e-6735.86ARID domain-containing protein OS=Rodentolepis nan... [more]
back to top
BLAST of ARID domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARID1B1.304e-2834.58AT-rich interactive domain-containing protein 1B [... [more]
arid1aa1.106e-2731.21AT-rich interactive domain-containing protein 1A [... [more]
arid1aa1.346e-2731.21AT-rich interactive domain-containing protein 1A [... [more]
arid1b1.055e-2545.45AT rich interactive domain 1B (SWI1-like) [Source:... [more]
arid1b1.967e-2545.45AT rich interactive domain 1B (SWI1-like) [Source:... [more]
back to top
BLAST of ARID domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
arid1b3.359e-2732.13AT rich interactive domain 1B (SWI1-like) [Source:... [more]
arid1b3.664e-2732.13AT rich interactive domain 1B (SWI1-like) [Source:... [more]
ENSPMAT00000010019.11.339e-734.12pep scaffold:Pmarinus_7.0:GL481681:6200:13508:-1 g... [more]
back to top
BLAST of ARID domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ARID domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO455846.968e-2243.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO307029.985e-1930.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391683.937e-731.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ARID domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arid1aa7.476e-2831.31AT-rich interactive domain-containing protein 1A [... [more]
arid1ab1.100e-2731.51AT-rich interactive domain-containing protein 1A [... [more]
arid1ab1.232e-2731.51AT-rich interactive domain-containing protein 1A [... [more]
ENSORLT00000021561.27.826e-2631.55AT-rich interactive domain-containing protein 1B [... [more]
ENSORLT00000034945.19.385e-2631.55AT-rich interactive domain-containing protein 1B [... [more]
back to top
BLAST of ARID domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074580.10.000e+099.76SMESG000074580.1[more]
SMESG000074580.10.000e+099.76SMESG000074580.1[more]
SMESG000074580.10.000e+099.76SMESG000074580.1[more]
SMESG000074600.10.000e+093.99SMESG000074600.1[more]
SMESG000074600.10.000e+093.28SMESG000074600.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011440 ID=SMED30011440|Name=ARID domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=6261bp
TTATTTTTTTAGTTATTTAAATACAAATTTTAAAAATATTAATGTTCATA
TGTTTTCTTAAAGTTGCTATTTATATTTATTAAATAACTAAATTTATTAA
GCAAAATCAGTTATGACATCGTTATTTCAAGGTTTATAATCGTCTAGTGG
ATTTTTCAAAATCGCTTTGTGTTCCTACTTTAGAAATTACGTTCAGTCTA
ACTTTGTGGAGCTCTTATTGTAAATTTATTAAACTCAATTTCAATTTCCT
TCTCTATTTGCCCTAGAAATCAACAATCGATATCAATTGGAATTTTTATT
TAAATGGAATATTCAAACTCAGGAGCAACTACAAATCTTCAGTCACCAAA
TCACATGTCAGTGGAAGCTGTCCAGCACTTCGGTGAAAATTCTAATGAAA
CTGGAGTCTTATCACCTGCTACATTTAGCCATTACGATGAAAAGCAAGCT
TATCAATATCAAAATCAAAATTCATCTCTTAATCAACTTTTACAAAACAA
TCAGTATGGGCCTTATTCCAATATACCATTTCGCCCTCCTCCTTCAAGTA
ATTATCATGCGAATTTTAGAAACTATGAAAATAATTGGAATTTATCAAGA
TCACAAGCCGAATCAGCTCGCATGTATTATTCACAATATCAAGAAACATA
TCCCCAAAATTCAAATGATATTACTTATTCCAAAATTGATAAAATGAAAC
CTTCGGATTATGTTATTTCCGGTGACGTCCAAGGAAATAGTAATTATAAA
AATGAAAATAGATCCTATCAAAATAGTGAAATTGATAAATCAAAAACTAA
TGTTCAGGAATGGAAAACTAAAAATGAACCCATGAGTCCTTTAGATTCAA
ATAATAAGGATTGCATTAGTAAAGTAGATAATGAAATTAAATCTGACAAA
CAAAATTGTATTGAAACTGATTGTAATACTTCAAAATCAGATTCTAGTGT
TAATCCTGGTTTCCATATAAATACATCTTGTACGGATTCTGCCACAGAAA
AAAGTGATAATATGCATAATGGGCCAAATTATGCCTTTGATAATAAAGTT
AATCCATCTCAAATAAAATCTCAACCCACCACTGTTGGATATGATAGTTC
TATATACAGTCACATGATGATGCACCCTAATTCACCATATTATTCACAAT
TTCGATATAATAATCCTCAACAAGGAAACAATACCCATAATTATATTAAT
CAAGCGAGTAATGCAATGATGACCAGCTCTATCGCCCGACCTCCTGTCAT
GAATTATCCTAATTATATTCAAACTTCCAGCCCCGGACCCGGCTATGGGT
ATATTCCTCCTATAGCTATGCATCAAAATAGACCATACAATGTGCATAGT
TCATTTGTTTCTCGTGGGGGATCACAATCTCCGTTTTCCAGTAATTCAGA
TATTTATATGAATGGATCTATTCCGCAACAGAACACCGGCTCTAAAGACT
TGCCTGACAGAAAAGACGAAGTAAACGCGGCTACTAGCGCGAATCAAGAC
ACATCTAGTGCAGGAAGCAATTCAAATAAATCAGTCAATGCTCGATCTTC
ATCTGCATCCAAGACAAAAAATACACCAAAAAATGAAAGCCATCCTGCTA
CACCAGTTAGTAATACTGTCCCATCGCCTTCACAGACTAGTATGAGTTCT
ATGGTTGATGAAAATGAAGATAGTGTCAGTAGTCTTGGTCCTAATGAAAC
TAATATGCTTCATCATCCATCTATTTCTAACCAGTCACAATTCAATCAAC
ATCAAATAACTCCACCAATGTCGCAAAACCATTCAATTATTTATCCTCAA
CCTTATCCAAATAACCAAGTTCCACATACAATGATGAGTTCTTTTCCAAG
TCACCTGCCTCCTCAACAGAGGCCATTTACTCCAAATCCAAATATGATTC
CTAATCGCCAATACCACCATAACGAATCTCAAACCAATAATAGTTGCTAT
CAAAAATTAATGGAACTCGGTAATGAGCCTGAAAGAGGACCTTGGATCGA
AAGATATTTGCGATTCATGCAGGAAAATAATACTCCTTTAAGTGCTGTAC
CTACTGTTGTAAAACAGCCATTAGATCTTTTCAGGTTATATCATGCAGTT
CGTGAGCGTGGAGGTTTATTGAATGTAGTTAAGACTAAGAGATGGAAAGA
AATTTGTTTGATTGTAAATGTGAATGCTTCAGCATCTGGAGCTTATACGC
TGAGAAGAAATTATATTAAGTGTCTTTTAGATTACGAATGTAAATTTGAT
CGCAACAGTGCAGATCCAGGACCTATTTTACAGGAAATTCAAAGTTTATC
AGATAAGAAAAAGAAAAGTACTTCTAGAAATGCAGGATCATCCCCTTCTT
CTACAATATCATCAGGTCAGACTTCACAGCATAATTCTGAATATGGGAGT
ACTTCTTCAACTCCACGACCTGCAATTCCACATCCTGATTTCAATACTCC
TCATCCCTTTCATGGCCACAATCCATATAATAATGTTATTCATAATGGTT
CCATGATGCATAGAAGTCCCATACATTACCCAGCCCAAAGAGGTCATAAT
CCGTATCCAGGTCCATACAATGGTCCCAGAATGATGGGGTTTAATTCTCC
AGTCAATCCCATGCATCCACACGCAAGATACGATGCAAATATCCCGCCGA
ATTGGAATAAATCCATGGTTCTGAACCAACAACAATGGTCAAGTCCTGGT
TCAAGTTCAAGCTCCAATTCAACACATCCAATGCAAATGCCAATGTCTCC
TGGAACTCCGACAAATAGTATTTCCAATATATCTCAACAATCTCAGCCAC
CAGCTGGTGATAATTTTGACATCAATTCAAAAGATGTTTCCAAATTGGAA
TCTAATGTGGCACGTTTCACAAATTCTGAAAGCAATAATAAACATTTGGA
TAATTTCGCCGATAAAGATGTTGATAAAATCGAAATGGTTTCTAAATCTG
ACTCTACAAACTACTACAATAATCCTTATATAGAATATTCTGGCCAAGAA
ATTTCATGTGATTATAAAAATTTGGCAAATAGCACCAGCCAATTTTATCC
ACCAATGCAATACCCATGCTTCACTTACTCTAGACAGTATAGTTCAACAT
TTCGCCAAGCTGCTCCTAATTCACTTTCATTTTCATCATATTATCCACCG
AATCCTAATTATATTTATCCTCCCAGTGGTGCTGTCTCTCATTCTTCTAA
TATGATGAATAATTCCCATCATGTGACAAATAGTGTCAGTTCACATTCCA
CTTCCCCGTATTATTCTATTGGAAGCATACAAGAACATTCTCGGAGAATG
GATTGGAAATCAAATTATGGTGGAATGCCACCACCACCTCCACCCCCTCC
AAATGTTCAATCTACAAGTCGACCAAATCTTCCAAATACTTCACAGATTG
GACCTGGGAATCACTCTCAATATCATTCTACTTTACCACATGGAAGTAAT
TACGTGAATCAAGCTCCAGGACCTTTTAGTCAGCAAAGACAGATAAATCC
TCAATTGCCGTCAAATTTAATGCCTCTTAATAGAAATGTTCTTCAAACAA
CAAACAACAATTTATCTGATCAAATGAATTATATAAACAAATCTATGGGA
CCGTCTTCATCTAGTGCAATACCAAACTCCATTCATAGCATGTCGCCTGC
CACCTGTCACAATAGATCTCAAATAGAGAGTTCTAGGTTAAATACATCTT
ATCCTTCGCAAATAACCTATTCGAAATCCAGCTCACATTTTATCAAACGA
TACGATAGTTTGTTTCCTCCGAATTCCGTTGAAGCCACTCAACCTGATTA
TGGAAAAAAACGGAAATATTCCAGCAAAGATATCAAAGTATTTAATCCAA
CGACAGTTACTATGGCTCTAAAATCTGGACTTGTTACTGAAATCAGTTGG
GCACTCAATTATTTAAACATATGGTCTAGGGATGACACATTTTTTGAAAA
ATTAAATCTGAAAAATCTCATGCCAATGTTTCAAGCTCTCATTGATGTGT
GGCGGAATAGCCTAGGAAGTATATTCGGTCGTGATTTGTTCATTAAAGAT
TTGGAATTGCCAGTAATTATCGACGAGTCTGTTTCGAATAAAACTGATAT
TAAAACTCTTCTTTCCAAAATCGAAACAGTTTTGAAGAATCGACAATTGA
AACAAGAAAAAGAGATTTGTAAAAATGGAGTCATAGAATCCGAAGATGAT
ACCAAACTCGCTCAAGACAAGATTTTAGATTTGTTGCATGGTGTTAAATA
TTCCGTCAATAGAAGGGGCTTAACAGTGAAATTAGACTACAATTCAAAAC
TGGAATTTGCACTCGGTGGAGATTCAGAACTTTCTGAATTCATTATAAAA
ACATGCTCTAATTCTCAGAAAAACGAAAACGACTCTAATAATAATATAGA
TTATTTAGATGACAAACTATCCAAGTGTAAATTAAATAATTTAAATGATC
TATGGCTTATTGGAGGATCCGACTCAACGTATCATATATTACCACCAATT
TTATCACAAAACAAAAATACAAACAACGAATGGTATTTAAGACTGAGAAG
TATTGATTCTCACTCTCAAGAATCAGCAGATAATTCCTTTGGTCCTCCAG
AAATTAAAAGAAGTCGATGCACATCTCCTCATTCACCGTCATCCTCAAAT
CCTCCTAATCTTGAACACGAAAGTCACATAGGAGATTTGAAGTTCGAAGA
AACAAACGAAGAGATTGACTTTTTCCGTTTGCAAGCTAAATCAGAAATTG
TTAACGATGGAGAAGGCTTGTTTTTTAAAATTATTGAATCTGACGAAGAA
AAAATGATGCGCTGTATAAGTGTATCGAATTCAATTAGAAATTTAAGTTT
TTTGAGTGGAAATGATAGAATTATTGGATCAAACAGAACTATTTTAGTAA
TTCTTGGTCGTTTATTATTACTTGGACATGAACATAGTATTGATGAGTGG
CCTCCTCCCAACCAAGAAAAGGAATGTTGGTGGTTAAAATGGATTGATGA
CATTAGAGAGCATGTGTTTGTGACTTTGGTAAACATATCAAGTTACCTAG
AACTCAGTAAACATCATGAAATAATTGTTCGTCCCATAGTGACAGGTTTA
TTACACTGGCTAACATGTAATTCAGCTGCTGCTGAGGATTCATTACCCAG
TCACAGAGTCTTAGGTTGCCGGAGATTAGCCTTGGAATCTATGATGAGGC
TCTGTGTTCATGAAAAAAATATTGATTTCATTTTATCTACGACAAATAAA
GGATCTGACCTTGTTATTCAAGAATTATTTAATTATTTAGCTGCATCATT
CTGTTATCCAGATGTACAAGTAGTTAAGGAAATGTCTTTAGCGGTTATGC
ATTATTTATCACTGGGTGGAGAAAATGGTATCGGTTGTATTTATCTTGCT
AATGCGCAACCAAATATCATCAGTGGTTTAATAAGTTTCATTGAAATAAC
TGAATCTCAAATAAGGCATGTGGTCGACAATATGGGCATGGAAGCTTTAC
AAGCAAGGCCAGAACTAATGGGAACAAGTCTTGAATTTTTACGACACTCT
GGTGCTCTTTTAAATAGACTTGCTAGCTATGAAATAAATAGAAAACATTT
CAGTCGAGATCATGAAATACGAATGCTTAATCTAGTTATATCCACAGTCT
TAGATCAAACAGTTGCCCAGTCAATATCTGGTGTCTTGTACCTTCTCTGT
AATCACGATGAAAATCAAAACAAACCAGAAACCTGTAATAAATTTAAGTC
ATTTTTAACTTTTAATGATTTGAGCTTCTGTGAAAAAGACAATTCCGTTT
CAGTACTACCAGAAAATGAAACTGCAACCACTTATGCAAACTAATATTAT
ATTTTAGCTATAATAATTCTTAACTGTGGAAGCCGGTGCTTTTCTTTCAT
CTTGAATAACAAATTATTGAATTCCAAGGTGTATTGTAAATATTTTTATT
TCTTGTTAGAAATTCTGATTTGTGTTTAATTCCCTTTTAATGAAAGATTC
GTTAAAAACTGAAACGTTGGTTTTAGTATGTTATGTAATTTATTAGATTC
TATTTATTTAAAGATGAATGTAAAGGATATCAATAGTATTATGAGTTCAT
GTAATGAACTGTGTTATATAGTTAAGTTTAGTTGGAAACTTAGTGTATTA
TGCAGATTCGGTTTTATTTAATTCTGAAAATGTTATTTTAATTTGTGAAG
CTACAACATGCATTTCGTAAATTGTGTAATTGTATAGAAAGTTAACTGTC
CTTCTAGGTTT
back to top

protein sequence of SMED30011440-orf-1

>SMED30011440-orf-1 ID=SMED30011440-orf-1|Name=SMED30011440-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1847bp
MEYSNSGATTNLQSPNHMSVEAVQHFGENSNETGVLSPATFSHYDEKQAY
QYQNQNSSLNQLLQNNQYGPYSNIPFRPPPSSNYHANFRNYENNWNLSRS
QAESARMYYSQYQETYPQNSNDITYSKIDKMKPSDYVISGDVQGNSNYKN
ENRSYQNSEIDKSKTNVQEWKTKNEPMSPLDSNNKDCISKVDNEIKSDKQ
NCIETDCNTSKSDSSVNPGFHINTSCTDSATEKSDNMHNGPNYAFDNKVN
PSQIKSQPTTVGYDSSIYSHMMMHPNSPYYSQFRYNNPQQGNNTHNYINQ
ASNAMMTSSIARPPVMNYPNYIQTSSPGPGYGYIPPIAMHQNRPYNVHSS
FVSRGGSQSPFSSNSDIYMNGSIPQQNTGSKDLPDRKDEVNAATSANQDT
SSAGSNSNKSVNARSSSASKTKNTPKNESHPATPVSNTVPSPSQTSMSSM
VDENEDSVSSLGPNETNMLHHPSISNQSQFNQHQITPPMSQNHSIIYPQP
YPNNQVPHTMMSSFPSHLPPQQRPFTPNPNMIPNRQYHHNESQTNNSCYQ
KLMELGNEPERGPWIERYLRFMQENNTPLSAVPTVVKQPLDLFRLYHAVR
ERGGLLNVVKTKRWKEICLIVNVNASASGAYTLRRNYIKCLLDYECKFDR
NSADPGPILQEIQSLSDKKKKSTSRNAGSSPSSTISSGQTSQHNSEYGST
SSTPRPAIPHPDFNTPHPFHGHNPYNNVIHNGSMMHRSPIHYPAQRGHNP
YPGPYNGPRMMGFNSPVNPMHPHARYDANIPPNWNKSMVLNQQQWSSPGS
SSSSNSTHPMQMPMSPGTPTNSISNISQQSQPPAGDNFDINSKDVSKLES
NVARFTNSESNNKHLDNFADKDVDKIEMVSKSDSTNYYNNPYIEYSGQEI
SCDYKNLANSTSQFYPPMQYPCFTYSRQYSSTFRQAAPNSLSFSSYYPPN
PNYIYPPSGAVSHSSNMMNNSHHVTNSVSSHSTSPYYSIGSIQEHSRRMD
WKSNYGGMPPPPPPPPNVQSTSRPNLPNTSQIGPGNHSQYHSTLPHGSNY
VNQAPGPFSQQRQINPQLPSNLMPLNRNVLQTTNNNLSDQMNYINKSMGP
SSSSAIPNSIHSMSPATCHNRSQIESSRLNTSYPSQITYSKSSSHFIKRY
DSLFPPNSVEATQPDYGKKRKYSSKDIKVFNPTTVTMALKSGLVTEISWA
LNYLNIWSRDDTFFEKLNLKNLMPMFQALIDVWRNSLGSIFGRDLFIKDL
ELPVIIDESVSNKTDIKTLLSKIETVLKNRQLKQEKEICKNGVIESEDDT
KLAQDKILDLLHGVKYSVNRRGLTVKLDYNSKLEFALGGDSELSEFIIKT
CSNSQKNENDSNNNIDYLDDKLSKCKLNNLNDLWLIGGSDSTYHILPPIL
SQNKNTNNEWYLRLRSIDSHSQESADNSFGPPEIKRSRCTSPHSPSSSNP
PNLEHESHIGDLKFEETNEEIDFFRLQAKSEIVNDGEGLFFKIIESDEEK
MMRCISVSNSIRNLSFLSGNDRIIGSNRTILVILGRLLLLGHEHSIDEWP
PPNQEKECWWLKWIDDIREHVFVTLVNISSYLELSKHHEIIVRPIVTGLL
HWLTCNSAAAEDSLPSHRVLGCRRLALESMMRLCVHEKNIDFILSTTNKG
SDLVIQELFNYLAASFCYPDVQVVKEMSLAVMHYLSLGGENGIGCIYLAN
AQPNIISGLISFIEITESQIRHVVDNMGMEALQARPELMGTSLEFLRHSG
ALLNRLASYEINRKHFSRDHEIRMLNLVISTVLDQTVAQSISGVLYLLCN
HDENQNKPETCNKFKSFLTFNDLSFCEKDNSVSVLPENETATTYAN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0016514SWI/SNF complex
GO:0035060brahma complex
GO:0090544BAF-type complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000044cephalic ganglia
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036431ARID_dom_sf
IPR021906BAF250/Osa
IPR001606ARID_dom
IPR033388BAF250_C
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
Vocabulary: biological process
TermDefinition
GO:0006338chromatin remodeling
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSMARTSM01014ARID_2coord: 555..645
e-value: 1.4E-21
score: 87.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 675..705
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1439..1454
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1422..1455
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 792..834
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 392..460
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 664..705
NoneNo IPR availablePANTHERPTHR12656:SF5TRITHORAX GROUP PROTEIN OSAcoord: 396..1806
NoneNo IPR availableCDDcd16865ARID_ARID1A-likecoord: 559..651
e-value: 4.21899E-47
score: 161.678
IPR001606ARID DNA-binding domainSMARTSM00501bright_3coord: 559..650
e-value: 1.6E-26
score: 104.1
IPR001606ARID DNA-binding domainPFAMPF01388ARIDcoord: 564..645
e-value: 7.2E-14
score: 52.2
IPR001606ARID DNA-binding domainPROSITEPS51011ARIDcoord: 558..649
score: 24.444
IPR036431ARID DNA-binding domain superfamilyGENE3DG3DSA:1.10.150.60coord: 541..660
e-value: 7.0E-37
score: 127.7
IPR036431ARID DNA-binding domain superfamilySUPERFAMILYSSF46774ARID-likecoord: 545..654
IPR033388SWI/SNF-like complex subunit BAF250, C-terminalPFAMPF12031BAF250_Ccoord: 1502..1746
e-value: 1.1E-67
score: 228.1
IPR021906SWI/SNF-like complex subunit BAF250/OsaPANTHERPTHR12656BRG-1 ASSOCIATED FACTOR 250 BAF250coord: 396..1806