Trinucleotide repeat containing 4-like protein

Overview
NameTrinucleotide repeat containing 4-like protein
Smed IDSMED30011420
Length (bp)1726
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Trinucleotide repeat containing 4-like protein (SMED30011420) t-SNE clustered cells

Violin plots show distribution of expression levels for Trinucleotide repeat containing 4-like protein (SMED30011420) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Trinucleotide repeat containing 4-like protein (SMED30011420) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Trinucleotide repeat containing 4-like protein (SMED30011420) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011420

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30011420h1SMcG0004255 SmedASXL_012940SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30011420h1SMcG0004255 Contig40234newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011420h1SMcG0004255 Contig40234uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30011420h1SMcG0004255 dd_Smed_v4_11349_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30011420h1SMcG0004255 dd_Smed_v4_11349_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30011420h1SMcG0004255 dd_Smed_v4_11349_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30011420h1SMcG0004255 dd_Smed_v4_11349_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30011420h1SMcG0004255 dd_Smed_v6_11349_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30011420h1SMcG0004255 OX_Smed_1.0.08052ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30011420h1SMcG0004255 dd_Smed_v6_11349_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011420h1SMcG0004255 dd_Smed_v6_11349_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30011420h1SMcG0004255 dd_Smed_v6_11349_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30011420h1SMcG0004255 dd_Smed_v6_11349_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
goblet cellSMED30011420h1SMcG0004255 dd_Smed_v6_11349_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Human
Match: CELF6 (CUGBP Elav-like family member 6 [Source:HGNC Symbol;Acc:HGNC:14059])

HSP 1 Score: 272.322 bits (695), Expect = 4.968e-86
Identity = 175/424 (41.27%), Postives = 225/424 (53.07%), Query Frame = 2
Query:  413 AQHKGEDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGGSAYSQYLENLQQNTGYINPIATLAXXXXXXXXXXXXIALGATLPYTLSTGIPTNDANASQNFLGVNPLAAAVAASQNLTTQSLLSPSTAASMM-MPNNSGMNTMCQVQQQTPIISSATQMNDPSVNISHTQMSNGQTRPQNLTPFSLAAATGANWLASNSTTLPAMYGGLNLCGLAPYN---PPTLNPI-TLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            ++ +GEDRKLF+GMLGKQ  E+DVR LF+P+G IEECT+LR  +G SKGCAFVK+ ++ EA  AI  +HGS T+ GASSSLVVK ADT++ER  R+                               +QQ  G++                   + LGA   YT +         A+    G+ P+AA  A  Q++   SL++     +    P  SG  T+       P + +   +N        T  +NGQ               G++ L +N              GL+PY    P    P+ T   +Q  ++  QQ+EG        P+G N+FIYHLPQEFGDAEL Q F PFG V+SAKV++DRATNQSKCFGFVSFDN  SAQ AIQAMNGFQIGMKRLKVQLKRPK  D  +PY
Sbjct:   12 SEGRGEDRKLFVGMLGKQQGEEDVRRLFQPFGHIEECTVLRSPDGTSKGCAFVKFGSQGEAQAAIRGLHGSRTMAGASSSLVVKLADTDRERALRR-------------------------------MQQMAGHLGAF------------HPAPLPLGACGAYTTAILQHQAALLAAAQGPGLGPVAAVAAQMQHVAAFSLVAAPLLPAAANSPPGSGPGTL-------PGLPAPIGVNGFG---PLTPQTNGQP--------------GSDTLYNN--------------GLSPYPAAYPSAYAPVSTAFPQQPSALPQQQREG--------PEGCNLFIYHLPQEFGDAELIQTFLPFGAVVSAKVFVDRATNQSKCFGFVSFDNPTSAQTAIQAMNGFQIGMKRLKVQLKRPK--DANRPY 344          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Human
Match: CELF6 (CUGBP Elav-like family member 6 [Source:HGNC Symbol;Acc:HGNC:14059])

HSP 1 Score: 263.848 bits (673), Expect = 4.903e-81
Identity = 174/424 (41.04%), Postives = 225/424 (53.07%), Query Frame = 2
Query:  413 AQHKGEDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGGSAYSQYLENLQQNTGYINPIATLAXXXXXXXXXXXXIALGATLPYTLSTGIPTNDANASQNFLGVNPLAAAVAASQNLTTQSLLSPSTAASMMM--PNNSGMNTMCQVQQQTPIISSATQMNDPSVNI---SHTQMSNGQTRPQNLTPFSLAAATGANWLASNSTTLPAMYGGLNLCGLAPYNPPTLNPITLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            ++ +GEDRKLF+GMLGKQ  E+DVR LF+P+G IEECT+LR  +G SKGCAFVK+ ++ EA  AI  +HGS T+ GASSSLVVK ADT++E                               + L  +QQ  G++                   + LGA   YT +         A+    G+ P+AA  A  Q++   SL++     +     P  SG  T+  +    PI  +      P  N    S T  +NG      L+P+   +   A+ L          Y G++    A  +       T   +Q  ++  QQ+EG        P+G N+FIYHLPQEFGDAEL Q F PFG V+SAKV++DRATNQSKCFGFVSFDN  SAQ AIQAMNGFQIGMKRLKVQLKRPK  D  +PY
Sbjct:  127 SEGRGEDRKLFVGMLGKQQGEEDVRRLFQPFGHIEECTVLRSPDGTSKGCAFVKFGSQGEAQAAIRGLHGSRTMAGASSSLVVKLADTDRE-------------------------------RALRRMQQMAGHLGAF------------HPAPLPLGACGAYTTAILQHQAALLAAAQGPGLGPVAAVAAQMQHVAAFSLVAAPLLPAAAANSPPGSGPGTLPGLP--APIGVNGFGPLTPQTNGQPGSDTLYNNG------LSPYPAQSPGVADPLQQ-------AYAGMHHYAAAYPSA-YAPVSTAFPQQPSALPQQQREG--------PEGCNLFIYHLPQEFGDAELIQTFLPFGAVVSAKVFVDRATNQSKCFGFVSFDNPTSAQTAIQAMNGFQIGMKRLKVQLKRPK--DANRPY 481          

HSP 2 Score: 71.2478 bits (173), Expect = 2.140e-12
Identity = 40/115 (34.78%), Postives = 59/115 (51.30%), Query Frame = 2
Query:  437 KLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQ-NGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKL--------------QQFINPFGLIN 736
            KLF+G + +   E D++ LF+ +G I E T+L+D+  G  KGCAF+ Y  R  A  A  A+H   T+PG +  + VK A +E   + RKL              ++   PFG I 
Sbjct:   47 KLFVGQIPRGLDEQDLKPLFEEFGRIYELTVLKDRLTGLHKGCAFLTYCARDSALKAQSALHEQKTLPGMNRPIQVKPAASEGRGEDRKLFVGMLGKQQGEEDVRRLFQPFGHIE 161          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Human
Match: AC009690.3 (novel transcript)

HSP 1 Score: 263.848 bits (673), Expect = 4.903e-81
Identity = 174/424 (41.04%), Postives = 225/424 (53.07%), Query Frame = 2
Query:  413 AQHKGEDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGGSAYSQYLENLQQNTGYINPIATLAXXXXXXXXXXXXIALGATLPYTLSTGIPTNDANASQNFLGVNPLAAAVAASQNLTTQSLLSPSTAASMMM--PNNSGMNTMCQVQQQTPIISSATQMNDPSVNI---SHTQMSNGQTRPQNLTPFSLAAATGANWLASNSTTLPAMYGGLNLCGLAPYNPPTLNPITLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            ++ +GEDRKLF+GMLGKQ  E+DVR LF+P+G IEECT+LR  +G SKGCAFVK+ ++ EA  AI  +HGS T+ GASSSLVVK ADT++E                               + L  +QQ  G++                   + LGA   YT +         A+    G+ P+AA  A  Q++   SL++     +     P  SG  T+  +    PI  +      P  N    S T  +NG      L+P+   +   A+ L          Y G++    A  +       T   +Q  ++  QQ+EG        P+G N+FIYHLPQEFGDAEL Q F PFG V+SAKV++DRATNQSKCFGFVSFDN  SAQ AIQAMNGFQIGMKRLKVQLKRPK  D  +PY
Sbjct:  127 SEGRGEDRKLFVGMLGKQQGEEDVRRLFQPFGHIEECTVLRSPDGTSKGCAFVKFGSQGEAQAAIRGLHGSRTMAGASSSLVVKLADTDRE-------------------------------RALRRMQQMAGHLGAF------------HPAPLPLGACGAYTTAILQHQAALLAAAQGPGLGPVAAVAAQMQHVAAFSLVAAPLLPAAAANSPPGSGPGTLPGLP--APIGVNGFGPLTPQTNGQPGSDTLYNNG------LSPYPAQSPGVADPLQQ-------AYAGMHHYAAAYPSA-YAPVSTAFPQQPSALPQQQREG--------PEGCNLFIYHLPQEFGDAELIQTFLPFGAVVSAKVFVDRATNQSKCFGFVSFDNPTSAQTAIQAMNGFQIGMKRLKVQLKRPK--DANRPY 481          

HSP 2 Score: 71.2478 bits (173), Expect = 2.140e-12
Identity = 40/115 (34.78%), Postives = 59/115 (51.30%), Query Frame = 2
Query:  437 KLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQ-NGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKL--------------QQFINPFGLIN 736
            KLF+G + +   E D++ LF+ +G I E T+L+D+  G  KGCAF+ Y  R  A  A  A+H   T+PG +  + VK A +E   + RKL              ++   PFG I 
Sbjct:   47 KLFVGQIPRGLDEQDLKPLFEEFGRIYELTVLKDRLTGLHKGCAFLTYCARDSALKAQSALHEQKTLPGMNRPIQVKPAASEGRGEDRKLFVGMLGKQQGEEDVRRLFQPFGHIE 161          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Human
Match: CELF2 (CUGBP Elav-like family member 2 [Source:HGNC Symbol;Acc:HGNC:2550])

HSP 1 Score: 240.35 bits (612), Expect = 6.258e-72
Identity = 177/422 (41.94%), Postives = 228/422 (54.03%), Query Frame = 2
Query:  428 EDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLT---LSALGGSAYSQYLENLQQ-----NTGYINPIATLAXXXXXXXXXXXXIALGATLPYTLSTGIPTNDANASQNFLGVNPLAAAVAASQNLTTQSLLSPSTAASMMMPNNSGMNTMCQVQQQTPIISSATQMNDPSVNISHTQMSNGQTRPQNLTPFSLAAATGANWLASNSTTLPAMYGGLNLCGLAPYNPPTLNPITLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            EDRKLFIGM+ K+  E+D+R +F P+G IEEC ILR  +G S+GCAFV ++TR+ A  AI AMH S T+ G SS +VVKFADT+K+++ R+LQQ +          T   L+ LGG    QYL  LQQ     N G  + I  +A     Q            L    +       A  S      NPL+   +A   LT     SP  A++      + MN++  +     +  +   +N+ +  ++  QM +G           L A    N  A     L   Y G+     A    PTL   +LL +Q  S    QKEG        P+G+N+FIYHLPQEFGD ++ QMF PFG VISAKV+ID+ TN SKCFGFVS+DN  SAQAAIQAMNGFQIGMKRLKVQLKR K  +  KPY
Sbjct:  106 EDRKLFIGMVSKKCNENDIRVMFSPFGQIEECRILRGPDGLSRGCAFVTFSTRAMAQNAIKAMHQSQTMEGCSSPIVVKFADTQKDKEQRRLQQQLAQQMQQLNTATWGNLTGLGGLT-PQYLALLQQATSSSNLGAFSGIQQMAGMNALQ------------LQNLATLAAAAAAAQTSATSTNANPLSTTSSALGALT-----SPVAASTPNSTAGAAMNSLTSLGTLQGLAGATVGLNNINA-LAVAQMLSGMAALNG----GLGATGLTNGTAGTMDALTQAYSGIQQYAAAAL--PTLYSQSLLQQQ--SAAGSQKEG--------PEGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSK--NDSKPY 490          

HSP 2 Score: 77.7962 bits (190), Expect = 1.429e-14
Identity = 36/96 (37.50%), Postives = 58/96 (60.42%), Query Frame = 2
Query:  437 KLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGN---SKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFI 715
            K+F+G + +  +E ++++LF+PYGA+ +  +LRD++ N   SKGC FV + TR  A  A  A+H   T+PG    + +K AD+EK       + FI
Sbjct:   17 KMFVGQIPRSWSEKELKELFEPYGAVYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHPIQMKPADSEKSNAVEDRKLFI 112          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Human
Match: CELF2 (CUGBP Elav-like family member 2 [Source:HGNC Symbol;Acc:HGNC:2550])

HSP 1 Score: 240.35 bits (612), Expect = 6.258e-72
Identity = 177/422 (41.94%), Postives = 228/422 (54.03%), Query Frame = 2
Query:  428 EDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLT---LSALGGSAYSQYLENLQQ-----NTGYINPIATLAXXXXXXXXXXXXIALGATLPYTLSTGIPTNDANASQNFLGVNPLAAAVAASQNLTTQSLLSPSTAASMMMPNNSGMNTMCQVQQQTPIISSATQMNDPSVNISHTQMSNGQTRPQNLTPFSLAAATGANWLASNSTTLPAMYGGLNLCGLAPYNPPTLNPITLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            EDRKLFIGM+ K+  E+D+R +F P+G IEEC ILR  +G S+GCAFV ++TR+ A  AI AMH S T+ G SS +VVKFADT+K+++ R+LQQ +          T   L+ LGG    QYL  LQQ     N G  + I  +A     Q            L    +       A  S      NPL+   +A   LT     SP  A++      + MN++  +     +  +   +N+ +  ++  QM +G           L A    N  A     L   Y G+     A    PTL   +LL +Q  S    QKEG        P+G+N+FIYHLPQEFGD ++ QMF PFG VISAKV+ID+ TN SKCFGFVS+DN  SAQAAIQAMNGFQIGMKRLKVQLKR K  +  KPY
Sbjct:  106 EDRKLFIGMVSKKCNENDIRVMFSPFGQIEECRILRGPDGLSRGCAFVTFSTRAMAQNAIKAMHQSQTMEGCSSPIVVKFADTQKDKEQRRLQQQLAQQMQQLNTATWGNLTGLGGLT-PQYLALLQQATSSSNLGAFSGIQQMAGMNALQ------------LQNLATLAAAAAAAQTSATSTNANPLSTTSSALGALT-----SPVAASTPNSTAGAAMNSLTSLGTLQGLAGATVGLNNINA-LAVAQMLSGMAALNG----GLGATGLTNGTAGTMDALTQAYSGIQQYAAAAL--PTLYSQSLLQQQ--SAAGSQKEG--------PEGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSK--NDSKPY 490          

HSP 2 Score: 77.7962 bits (190), Expect = 1.429e-14
Identity = 36/96 (37.50%), Postives = 58/96 (60.42%), Query Frame = 2
Query:  437 KLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGN---SKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFI 715
            K+F+G + +  +E ++++LF+PYGA+ +  +LRD++ N   SKGC FV + TR  A  A  A+H   T+PG    + +K AD+EK       + FI
Sbjct:   17 KMFVGQIPRSWSEKELKELFEPYGAVYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHPIQMKPADSEKSNAVEDRKLFI 112          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Celegans
Match: etr-1 (ELAV-Type RNA binding-protein family [Source:UniProtKB/TrEMBL;Acc:A0A0K3AR37])

HSP 1 Score: 220.32 bits (560), Expect = 5.837e-66
Identity = 165/422 (39.10%), Postives = 221/422 (52.37%), Query Frame = 2
Query:  431 DRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGGSAYSQYLENL-----QQNTGYIN--PIATLAXXXXXXXXXXXXIALGATLPYTLSTGIPT--NDANASQNFLGVNPLAAAVAASQNLTTQSLLSPSTAASMMMPNNSGMNTMCQVQQQTPIISSATQMNDPSVNISHTQMSNGQTRPQNLTPFSLAAATGANWLASNSTTLPAMYGGLNLCGLAPYNPPTLNPITLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            +RKLFIG L K+H E+++R++F  +G IE+C++LRDQ+G S+GCAFV +T RS A  A   MH S T+ G S+ LVVKFADT+K++   K +  I   G  +P       GG+A    L+NL     QQ  G  N   +A+L   +  Q  QQQQ      +   L TG P   N A A+QN      +A      Q L  Q       A S      +G   M   +  +P+ +S           +H Q++        LTPF+  AA   ++ A     L A                 L     +  QA +    Q  G  D  + GPDG+N+FIYHLPQ+FGD++L   F+PFG ++SAKV+ID+ TN SKCFGFVS++N+ SA  AI AMNGFQIG KRLKVQLK     D G PY
Sbjct:   17 ERKLFIGQLSKKHNEENLREIFAKFGHIEDCSVLRDQDGKSRGCAFVTFTNRSCAVVATKEMHHSQTMEGCSAPLVVKFADTQKDKDV-KTKSMITGSGAGSPK------GGAA--SLLQNLNPALLQQLGGGQNYQAVASLLSLINGQQGQQQQHQQQQNVLGILGTGNPLLGNPAMAAQNQFDAITMAQIAHQQQMLALQGFAVQQGAPSQQQQGLAG--GMAGAKTTSPVAASLA---------NHQQIA--------LTPFAGGAAALDHFQAMQQYALLA----------------NLQATGGVGVQA-TTSAAQMVGNGD--VKGPDGANLFIYHLPQDFGDSDLINTFAPFGGILSAKVFIDKVTNLSKCFGFVSYENAQSATNAISAMNGFQIGSKRLKVQLKV----DRGNPY 387          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Celegans
Match: etr-1 (ELAV-Type RNA binding-protein family [Source:UniProtKB/TrEMBL;Acc:A0A0K3AR37])

HSP 1 Score: 220.32 bits (560), Expect = 5.837e-66
Identity = 165/422 (39.10%), Postives = 221/422 (52.37%), Query Frame = 2
Query:  431 DRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGGSAYSQYLENL-----QQNTGYIN--PIATLAXXXXXXXXXXXXIALGATLPYTLSTGIPT--NDANASQNFLGVNPLAAAVAASQNLTTQSLLSPSTAASMMMPNNSGMNTMCQVQQQTPIISSATQMNDPSVNISHTQMSNGQTRPQNLTPFSLAAATGANWLASNSTTLPAMYGGLNLCGLAPYNPPTLNPITLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            +RKLFIG L K+H E+++R++F  +G IE+C++LRDQ+G S+GCAFV +T RS A  A   MH S T+ G S+ LVVKFADT+K++   K +  I   G  +P       GG+A    L+NL     QQ  G  N   +A+L   +  Q  QQQQ      +   L TG P   N A A+QN      +A      Q L  Q       A S      +G   M   +  +P+ +S           +H Q++        LTPF+  AA   ++ A     L A                 L     +  QA +    Q  G  D  + GPDG+N+FIYHLPQ+FGD++L   F+PFG ++SAKV+ID+ TN SKCFGFVS++N+ SA  AI AMNGFQIG KRLKVQLK     D G PY
Sbjct:   17 ERKLFIGQLSKKHNEENLREIFAKFGHIEDCSVLRDQDGKSRGCAFVTFTNRSCAVVATKEMHHSQTMEGCSAPLVVKFADTQKDKDV-KTKSMITGSGAGSPK------GGAA--SLLQNLNPALLQQLGGGQNYQAVASLLSLINGQQGQQQQHQQQQNVLGILGTGNPLLGNPAMAAQNQFDAITMAQIAHQQQMLALQGFAVQQGAPSQQQQGLAG--GMAGAKTTSPVAASLA---------NHQQIA--------LTPFAGGAAALDHFQAMQQYALLA----------------NLQATGGVGVQA-TTSAAQMVGNGD--VKGPDGANLFIYHLPQDFGDSDLINTFAPFGGILSAKVFIDKVTNLSKCFGFVSYENAQSATNAISAMNGFQIGSKRLKVQLKV----DRGNPY 387          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Celegans
Match: etr-1 (ELAV-Type RNA binding-protein family [Source:UniProtKB/TrEMBL;Acc:A0A0K3AR37])

HSP 1 Score: 220.32 bits (560), Expect = 5.837e-66
Identity = 165/422 (39.10%), Postives = 221/422 (52.37%), Query Frame = 2
Query:  431 DRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGGSAYSQYLENL-----QQNTGYIN--PIATLAXXXXXXXXXXXXIALGATLPYTLSTGIPT--NDANASQNFLGVNPLAAAVAASQNLTTQSLLSPSTAASMMMPNNSGMNTMCQVQQQTPIISSATQMNDPSVNISHTQMSNGQTRPQNLTPFSLAAATGANWLASNSTTLPAMYGGLNLCGLAPYNPPTLNPITLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            +RKLFIG L K+H E+++R++F  +G IE+C++LRDQ+G S+GCAFV +T RS A  A   MH S T+ G S+ LVVKFADT+K++   K +  I   G  +P       GG+A    L+NL     QQ  G  N   +A+L   +  Q  QQQQ      +   L TG P   N A A+QN      +A      Q L  Q       A S      +G   M   +  +P+ +S           +H Q++        LTPF+  AA   ++ A     L A                 L     +  QA +    Q  G  D  + GPDG+N+FIYHLPQ+FGD++L   F+PFG ++SAKV+ID+ TN SKCFGFVS++N+ SA  AI AMNGFQIG KRLKVQLK     D G PY
Sbjct:   17 ERKLFIGQLSKKHNEENLREIFAKFGHIEDCSVLRDQDGKSRGCAFVTFTNRSCAVVATKEMHHSQTMEGCSAPLVVKFADTQKDKDV-KTKSMITGSGAGSPK------GGAA--SLLQNLNPALLQQLGGGQNYQAVASLLSLINGQQGQQQQHQQQQNVLGILGTGNPLLGNPAMAAQNQFDAITMAQIAHQQQMLALQGFAVQQGAPSQQQQGLAG--GMAGAKTTSPVAASLA---------NHQQIA--------LTPFAGGAAALDHFQAMQQYALLA----------------NLQATGGVGVQA-TTSAAQMVGNGD--VKGPDGANLFIYHLPQDFGDSDLINTFAPFGGILSAKVFIDKVTNLSKCFGFVSYENAQSATNAISAMNGFQIGSKRLKVQLKV----DRGNPY 387          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Celegans
Match: etr-1 (ELAV-Type RNA binding-protein family [Source:UniProtKB/TrEMBL;Acc:A0A0K3AR37])

HSP 1 Score: 220.32 bits (560), Expect = 5.837e-66
Identity = 165/422 (39.10%), Postives = 221/422 (52.37%), Query Frame = 2
Query:  431 DRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGGSAYSQYLENL-----QQNTGYIN--PIATLAXXXXXXXXXXXXIALGATLPYTLSTGIPT--NDANASQNFLGVNPLAAAVAASQNLTTQSLLSPSTAASMMMPNNSGMNTMCQVQQQTPIISSATQMNDPSVNISHTQMSNGQTRPQNLTPFSLAAATGANWLASNSTTLPAMYGGLNLCGLAPYNPPTLNPITLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            +RKLFIG L K+H E+++R++F  +G IE+C++LRDQ+G S+GCAFV +T RS A  A   MH S T+ G S+ LVVKFADT+K++   K +  I   G  +P       GG+A    L+NL     QQ  G  N   +A+L   +  Q  QQQQ      +   L TG P   N A A+QN      +A      Q L  Q       A S      +G   M   +  +P+ +S           +H Q++        LTPF+  AA   ++ A     L A                 L     +  QA +    Q  G  D  + GPDG+N+FIYHLPQ+FGD++L   F+PFG ++SAKV+ID+ TN SKCFGFVS++N+ SA  AI AMNGFQIG KRLKVQLK     D G PY
Sbjct:   17 ERKLFIGQLSKKHNEENLREIFAKFGHIEDCSVLRDQDGKSRGCAFVTFTNRSCAVVATKEMHHSQTMEGCSAPLVVKFADTQKDKDV-KTKSMITGSGAGSPK------GGAA--SLLQNLNPALLQQLGGGQNYQAVASLLSLINGQQGQQQQHQQQQNVLGILGTGNPLLGNPAMAAQNQFDAITMAQIAHQQQMLALQGFAVQQGAPSQQQQGLAG--GMAGAKTTSPVAASLA---------NHQQIA--------LTPFAGGAAALDHFQAMQQYALLA----------------NLQATGGVGVQA-TTSAAQMVGNGD--VKGPDGANLFIYHLPQDFGDSDLINTFAPFGGILSAKVFIDKVTNLSKCFGFVSYENAQSATNAISAMNGFQIGSKRLKVQLKV----DRGNPY 387          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Celegans
Match: etr-1 (ELAV-Type RNA binding-protein family [Source:UniProtKB/TrEMBL;Acc:A0A0K3AR37])

HSP 1 Score: 219.55 bits (558), Expect = 2.251e-64
Identity = 159/415 (38.31%), Postives = 217/415 (52.29%), Query Frame = 2
Query:  431 DRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGGSAYSQYLENLQQNTGYINPIATLAXXXXXXXXXXXXIALGATLPYTLSTGIPT--NDANASQNFLGVNPLAAAVAASQNLTTQSLLSPSTAASMMMPNNSGMNTMCQVQQQTPIISSATQMNDPSVNISHTQMSNGQTRPQNLTPFSLAAATGANWLASNSTTLPAMYGGLNLCGLAPYNPPTLNPITLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            +RKLFIG L K+H E+++R++F  +G IE+C++LRDQ+G S+GCAFV +T RS A  A   MH S T+ G S+ LVVKFADT+K++   K +  I   G  +P    ++L  +     L+ L     Y   +A+L   +  Q  QQQQ      +   L TG P   N A A+QN      +A      Q L  Q       A S      +G   M   +  +P+ +S           +H Q++        LTPF+  AA   ++ A     L A                 L     +  QA +    Q  G  D  + GPDG+N+FIYHLPQ+FGD++L   F+PFG ++SAKV+ID+ TN SKCFGFVS++N+ SA  AI AMNGFQIG KRLKVQLK     D G PY
Sbjct:  141 ERKLFIGQLSKKHNEENLREIFAKFGHIEDCSVLRDQDGKSRGCAFVTFTNRSCAVVATKEMHHSQTMEGCSAPLVVKFADTQKDKDV-KTKSMITGSGAGSPKGGAASLLQNLNPALLQQLGGGQNY-QAVASLLSLINGQQGQQQQHQQQQNVLGILGTGNPLLGNPAMAAQNQFDAITMAQIAHQQQMLALQGFAVQQGAPSQQQQGLAG--GMAGAKTTSPVAASLA---------NHQQIA--------LTPFAGGAAALDHFQAMQQYALLA----------------NLQATGGVGVQA-TTSAAQMVGNGD--VKGPDGANLFIYHLPQDFGDSDLINTFAPFGGILSAKVFIDKVTNLSKCFGFVSYENAQSATNAISAMNGFQIGSKRLKVQLKV----DRGNPY 511          

HSP 2 Score: 74.7146 bits (182), Expect = 5.760e-14
Identity = 48/149 (32.21%), Postives = 76/149 (51.01%), Query Frame = 2
Query:  260 FSGLLLNILIMIFQKETEQSTFTETHIDDCFENKDEKKPATNNSNCKMSKQAQHKGEDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGN-SKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKL 703
             SG +L  ++++ + E+      E+ +     N  +  P+T   N      ++   +  K+F+G + +Q  E D R LF+ YG++  C ILRD++   SKGC FV +  R +A  A GA+H    I G    + +K ADTE  R  RKL
Sbjct:    1 MSGAVLPAVLVVPKMESVVVPIAESTV----INAKDTTPSTAADNDVSPSPSEPDTDAIKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTFYHRKDAIEAQGALHNIKVIEGMHHPVQMKPADTE-NRNERKL 144          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Fly
Match: bru3 (gene:FBgn0264001 transcript:FBtr0330348)

HSP 1 Score: 165.236 bits (417), Expect = 6.430e-46
Identity = 77/94 (81.91%), Postives = 84/94 (89.36%), Query Frame = 2
Query: 1388 LTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            ++GP+G N+FIYHLPQEFGDAEL QMF PFG VIS+KV+IDRATNQSKCFGFVSFDN  SAQAAIQAMNGFQIGMKRLKVQLKRPK  D  +PY
Sbjct:  240 ISGPEGCNLFIYHLPQEFGDAELMQMFLPFGNVISSKVFIDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK--DASRPY 331          

HSP 2 Score: 84.3445 bits (207), Expect = 2.228e-17
Identity = 39/67 (58.21%), Postives = 51/67 (76.12%), Query Frame = 2
Query:  539 QNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINP 739
            +N +  GCAFVK+ ++ EA +AI  +HGS T+PGASSSLVVK+ADTEKERQ R++QQ      L+NP
Sbjct:   31 ENESRSGCAFVKFGSQQEAQSAITNLHGSQTMPGASSSLVVKYADTEKERQIRRMQQMAGHMNLLNP 97          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Fly
Match: bru3 (gene:FBgn0264001 transcript:FBtr0330350)

HSP 1 Score: 165.236 bits (417), Expect = 8.893e-46
Identity = 77/94 (81.91%), Postives = 84/94 (89.36%), Query Frame = 2
Query: 1388 LTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            ++GP+G N+FIYHLPQEFGDAEL QMF PFG VIS+KV+IDRATNQSKCFGFVSFDN  SAQAAIQAMNGFQIGMKRLKVQLKRPK  D  +PY
Sbjct:  254 ISGPEGCNLFIYHLPQEFGDAELMQMFLPFGNVISSKVFIDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK--DASRPY 345          

HSP 2 Score: 83.9593 bits (206), Expect = 2.813e-17
Identity = 39/67 (58.21%), Postives = 51/67 (76.12%), Query Frame = 2
Query:  539 QNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINP 739
            +N +  GCAFVK+ ++ EA +AI  +HGS T+PGASSSLVVK+ADTEKERQ R++QQ      L+NP
Sbjct:   31 ENESRSGCAFVKFGSQQEAQSAITNLHGSQTMPGASSSLVVKYADTEKERQIRRMQQMAGHMNLLNP 97          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Fly
Match: bru3 (gene:FBgn0264001 transcript:FBtr0330346)

HSP 1 Score: 164.851 bits (416), Expect = 9.438e-46
Identity = 77/94 (81.91%), Postives = 84/94 (89.36%), Query Frame = 2
Query: 1388 LTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            ++GP+G N+FIYHLPQEFGDAEL QMF PFG VIS+KV+IDRATNQSKCFGFVSFDN  SAQAAIQAMNGFQIGMKRLKVQLKRPK  D  +PY
Sbjct:  246 ISGPEGCNLFIYHLPQEFGDAELMQMFLPFGNVISSKVFIDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK--DASRPY 337          

HSP 2 Score: 83.9593 bits (206), Expect = 2.645e-17
Identity = 39/67 (58.21%), Postives = 51/67 (76.12%), Query Frame = 2
Query:  539 QNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINP 739
            +N +  GCAFVK+ ++ EA +AI  +HGS T+PGASSSLVVK+ADTEKERQ R++QQ      L+NP
Sbjct:   31 ENESRSGCAFVKFGSQQEAQSAITNLHGSQTMPGASSSLVVKYADTEKERQIRRMQQMAGHMNLLNP 97          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Fly
Match: bru3 (gene:FBgn0264001 transcript:FBtr0330347)

HSP 1 Score: 165.622 bits (418), Expect = 1.260e-45
Identity = 77/94 (81.91%), Postives = 84/94 (89.36%), Query Frame = 2
Query: 1388 LTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            ++GP+G N+FIYHLPQEFGDAEL QMF PFG VIS+KV+IDRATNQSKCFGFVSFDN  SAQAAIQAMNGFQIGMKRLKVQLKRPK  D  +PY
Sbjct:  272 ISGPEGCNLFIYHLPQEFGDAELMQMFLPFGNVISSKVFIDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK--DASRPY 363          

HSP 2 Score: 83.9593 bits (206), Expect = 3.387e-17
Identity = 39/67 (58.21%), Postives = 51/67 (76.12%), Query Frame = 2
Query:  539 QNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINP 739
            +N +  GCAFVK+ ++ EA +AI  +HGS T+PGASSSLVVK+ADTEKERQ R++QQ      L+NP
Sbjct:   31 ENESRSGCAFVKFGSQQEAQSAITNLHGSQTMPGASSSLVVKYADTEKERQIRRMQQMAGHMNLLNP 97          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Fly
Match: bru3 (gene:FBgn0264001 transcript:FBtr0330355)

HSP 1 Score: 165.622 bits (418), Expect = 1.439e-45
Identity = 77/94 (81.91%), Postives = 84/94 (89.36%), Query Frame = 2
Query: 1388 LTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            ++GP+G N+FIYHLPQEFGDAEL QMF PFG VIS+KV+IDRATNQSKCFGFVSFDN  SAQAAIQAMNGFQIGMKRLKVQLKRPK  D  +PY
Sbjct:  279 ISGPEGCNLFIYHLPQEFGDAELMQMFLPFGNVISSKVFIDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK--DASRPY 370          

HSP 2 Score: 83.9593 bits (206), Expect = 3.620e-17
Identity = 39/67 (58.21%), Postives = 51/67 (76.12%), Query Frame = 2
Query:  539 QNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINP 739
            +N +  GCAFVK+ ++ EA +AI  +HGS T+PGASSSLVVK+ADTEKERQ R++QQ      L+NP
Sbjct:   31 ENESRSGCAFVKFGSQQEAQSAITNLHGSQTMPGASSSLVVKYADTEKERQIRRMQQMAGHMNLLNP 97          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Zebrafish
Match: celf5a (cugbp, Elav-like family member 5a [Source:ZFIN;Acc:ZDB-GENE-050208-746])

HSP 1 Score: 310.071 bits (793), Expect = 1.788e-98
Identity = 191/428 (44.63%), Postives = 241/428 (56.31%), Query Frame = 2
Query:  413 AQHKGEDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGGSAYSQYLENLQQ---------NTGYINPIATLAXXXXXXXXXXXXIALGATLPYTLSTGIPTNDANASQNFLGVNPLAAAVAASQNLTTQSLLSPSTAASMMMPNNSGMNTMCQVQQQTPIISSATQMNDPSVNISHTQMSNGQTRPQNLTPFSLAAATGANWLASNSTTLPAMYGGLNLCGLAPYNPPTLNPITLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            ++ +GEDRKLF+GML KQ TE+DV  LF+PYG IEECT+LR  +GNSKGCAFVK++T +EA +AI A+HGS T+PGASSSLVVKFADT+KER  R++QQ +  FG+ NP +   AL  S YS Y   L Q         + GY+ P          Q        +GA     +++  PT     S  F     LA   +   N+TT      S   S++ P  +G  ++       P + +                +NG      L P+S  + T A+ L    T            G+  Y    + P T L     S+    +   +     GP+G N+FIYHLPQEFGD EL QMF PFGTVIS+KV++DRATNQSKCFGFVSFDN  SAQAAIQAMNGFQIGMKRLKVQLKRPK  D  +PY
Sbjct:  159 SESRGEDRKLFVGMLNKQQTEEDVYRLFEPYGVIEECTVLRGPDGNSKGCAFVKFSTHAEAQSAISALHGSQTMPGASSSLVVKFADTDKERTIRRMQQMVGQFGIFNPAI---ALPFSTYSTYAHALMQQQAALMAASHGGYLAPSVAFPTTQIHQ--------MGA---LNINSLPPTPMTPVSGEFHQT--LAGLSSPPANITT------SAVPSIVTPIVNGFTSIPHQPNGHPAVEAV--------------YTNG------LPPYSTQSPTAADTLQQAFT------------GVQQYT--AIYPATTLTPIGQSLPQPPQVIQQQQQREGPEGCNLFIYHLPQEFGDNELMQMFLPFGTVISSKVFMDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK--DASRPY 528          

HSP 2 Score: 78.5666 bits (192), Expect = 7.273e-15
Identity = 38/90 (42.22%), Postives = 54/90 (60.00%), Query Frame = 2
Query:  437 KLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQ-NGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKL 703
            KLFIG + +   E D++ LF+ +G I E T+L+D+  G  KGCAF+ Y  R  A  A  A+H   T+PG +  + VK AD+E   + RKL
Sbjct:   79 KLFIGQIPRNLEEKDLKPLFEQFGKIHELTVLKDRYTGMHKGCAFLTYCARESAIKAQNALHEQKTLPGMTRPIQVKPADSESRGEDRKL 168          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Zebrafish
Match: celf5a (cugbp, Elav-like family member 5a [Source:ZFIN;Acc:ZDB-GENE-050208-746])

HSP 1 Score: 299.671 bits (766), Expect = 1.007e-94
Identity = 188/426 (44.13%), Postives = 232/426 (54.46%), Query Frame = 2
Query:  431 DRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGGSAYSQYLENLQQ---------NTGYINPIATLAXXXXXXXXXXXXIALGATLPYTLSTGIPTNDANASQNFLGVNPLAAAVAASQNLTTQSLLSPSTAASMMMPNNSGMNTMCQVQQQTPIISSATQM-----NDPSVNISHTQMSNGQTRPQNLTPFSLAAATGANWLASNSTTLPAMYGGLNLCGLAPYNPPTLNPITLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKP 1666
            DRKLF+GML KQ TE+DV  LF+PYG IEECT+LR  +GNSKGCAFVK++T +EA +AI A+HGS T+PGASSSLVVKFADT+KER  R++QQ +  FG+ NP +   AL  S YS Y   L Q         + GY+ P                            S   PT   +     L +N L                +P T  S +    + + T       TPI++  T +       P+V   +T   NG      L P+S  + T A+ L    T            G+  Y    + P T L     S+    +   +     GP+G N+FIYHLPQEFGD EL QMF PFGTVIS+KV++DRATNQSKCFGFVSFDN  SAQAAIQAMNGFQIGMKRLKVQLKRPK  D  +P
Sbjct:  152 DRKLFVGMLNKQQTEEDVYRLFEPYGVIEECTVLRGPDGNSKGCAFVKFSTHAEAQSAISALHGSQTMPGASSSLVVKFADTDKERTIRRMQQMVGQFGIFNPAI---ALPFSTYSTYAHALMQQQAALMAASHGGYLAP----------------------------SVAFPTTQIH-QMGALNINSLPP--------------TPMTPVSGLSSPPANITTSAVPSIVTPIVNGFTSIPHQPNGHPAVEAVYT---NG------LPPYSTQSPTAADTLQQAFT------------GVQQYT--AIYPATTLTPIGQSLPQPPQVIQQQQQREGPEGCNLFIYHLPQEFGDNELMQMFLPFGTVISSKVFMDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK--DASRP 506          

HSP 2 Score: 75.0998 bits (183), Expect = 7.318e-14
Identity = 39/90 (43.33%), Postives = 54/90 (60.00%), Query Frame = 2
Query:  437 KLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQ-NGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKL 703
            KLFIG + +   E D++ LF+ +G I E T+L+D+  G  KGCAF+ Y  R  A  A  A+H   T+PG +  + VK AD+E  R  RKL
Sbjct:   67 KLFIGQIPRNLEEKDLKPLFEQFGKIHELTVLKDRYTGMHKGCAFLTYCARESAIKAQNALHEQKTLPGMTRPIQVKPADSE-SRGDRKL 155          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Zebrafish
Match: celf3a (cugbp, Elav-like family member 3a [Source:NCBI gene;Acc:57922])

HSP 1 Score: 286.96 bits (733), Expect = 1.779e-90
Identity = 188/427 (44.03%), Postives = 242/427 (56.67%), Query Frame = 2
Query:  407 KQAQHKGE-DRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGGSAYSQYLENLQQNTGYINPIATLAXXXXXXXXXXXXIALGATLPYTLSTGIPTNDANASQNFLGVNP--LAAAVAASQNLTTQSLLSPSTAASMM--MPNNSGMNTMCQVQQQTPIISSATQMNDPSVNISHTQMSNGQTRPQNLTPFSLAAATGANWLASNSTTLPAMYGGLNLCGLA-PYNPPTLNPITLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            K A  +G  DRKLF+GMLGKQ ++ DVR +F+P+G+IEECT+LR  +G SKGCAFVKY + +EA  AI A+HGS T+PGASSSLVVKFADTEKER  R++QQ  +  G+I+P     +L   AY+ Y + L Q    +   A L                         + + T  A   Q    +NP  + A   AS   ++ +   P+ AA+ +  +P    +N+        P + +A      S  +    +   Q +   L P   A     ++ A    T PA YG   L G   P+ P      TL+A+Q    Q  Q+         GP+G N+FIYHLPQEF D+E+ QMF PFG VISAKV++DRATNQSKCFGFVSFDN  SAQAAIQAMNGFQIGMKRLKVQLKRPK  D  +PY
Sbjct:   84 KPADSEGRGDRKLFVGMLGKQLSDADVRKMFEPFGSIEECTVLRGPDGASKGCAFVKYQSNAEAQAAISALHGSRTLPGASSSLVVKFADTEKERGIRRMQQVASQLGVISP----MSLHLGAYNAYTQALVQQQALVAQSAYL-------------------------SPVATVAAVQMQQLAALNPSSIIATPIASITPSSGTSTPPTIAATPVPALPPPIAVNSY-------PPVPAAPNGQSASEALYTNGVHPYQAQSPALDPLQQAYTGMQHYTA----TYPAAYG---LVGQPFPHQP------TLVAQQPQQPQQLQQR-------EGPEGCNIFIYHLPQEFTDSEMLQMFLPFGNVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK--DANRPY 452          

HSP 2 Score: 72.7886 bits (177), Expect = 3.449e-13
Identity = 47/140 (33.57%), Postives = 69/140 (49.29%), Query Frame = 2
Query:  437 KLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQ-NGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKL--------------QQFINPFGLINPGLTLS----ALGGSAYSQYLENLQ 799
            KLFIG + +   E D++ +F+ +G I E T+++D+  G  KGCAF+ Y  R  A  A  A+H   T+PG +  + VK AD+E  R  RKL              ++   PFG I     L     A  G A+ +Y  N +
Sbjct:    8 KLFIGQIPRNLEEKDLKPIFEQFGKIYELTVIKDKYTGMHKGCAFLTYCARESALKAQNALHEQKTLPGMNRPIQVKPADSEG-RGDRKLFVGMLGKQLSDADVRKMFEPFGSIEECTVLRGPDGASKGCAFVKYQSNAE 146          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Zebrafish
Match: celf3a (cugbp, Elav-like family member 3a [Source:NCBI gene;Acc:57922])

HSP 1 Score: 286.96 bits (733), Expect = 1.779e-90
Identity = 188/427 (44.03%), Postives = 242/427 (56.67%), Query Frame = 2
Query:  407 KQAQHKGE-DRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGGSAYSQYLENLQQNTGYINPIATLAXXXXXXXXXXXXIALGATLPYTLSTGIPTNDANASQNFLGVNP--LAAAVAASQNLTTQSLLSPSTAASMM--MPNNSGMNTMCQVQQQTPIISSATQMNDPSVNISHTQMSNGQTRPQNLTPFSLAAATGANWLASNSTTLPAMYGGLNLCGLA-PYNPPTLNPITLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            K A  +G  DRKLF+GMLGKQ ++ DVR +F+P+G+IEECT+LR  +G SKGCAFVKY + +EA  AI A+HGS T+PGASSSLVVKFADTEKER  R++QQ  +  G+I+P     +L   AY+ Y + L Q    +   A L                         + + T  A   Q    +NP  + A   AS   ++ +   P+ AA+ +  +P    +N+        P + +A      S  +    +   Q +   L P   A     ++ A    T PA YG   L G   P+ P      TL+A+Q    Q  Q+         GP+G N+FIYHLPQEF D+E+ QMF PFG VISAKV++DRATNQSKCFGFVSFDN  SAQAAIQAMNGFQIGMKRLKVQLKRPK  D  +PY
Sbjct:   84 KPADSEGRGDRKLFVGMLGKQLSDADVRKMFEPFGSIEECTVLRGPDGASKGCAFVKYQSNAEAQAAISALHGSRTLPGASSSLVVKFADTEKERGIRRMQQVASQLGVISP----MSLHLGAYNAYTQALVQQQALVAQSAYL-------------------------SPVATVAAVQMQQLAALNPSSIIATPIASITPSSGTSTPPTIAATPVPALPPPIAVNSY-------PPVPAAPNGQSASEALYTNGVHPYQAQSPALDPLQQAYTGMQHYTA----TYPAAYG---LVGQPFPHQP------TLVAQQPQQPQQLQQR-------EGPEGCNIFIYHLPQEFTDSEMLQMFLPFGNVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK--DANRPY 452          

HSP 2 Score: 72.7886 bits (177), Expect = 3.449e-13
Identity = 47/140 (33.57%), Postives = 69/140 (49.29%), Query Frame = 2
Query:  437 KLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQ-NGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKL--------------QQFINPFGLINPGLTLS----ALGGSAYSQYLENLQ 799
            KLFIG + +   E D++ +F+ +G I E T+++D+  G  KGCAF+ Y  R  A  A  A+H   T+PG +  + VK AD+E  R  RKL              ++   PFG I     L     A  G A+ +Y  N +
Sbjct:    8 KLFIGQIPRNLEEKDLKPIFEQFGKIYELTVIKDKYTGMHKGCAFLTYCARESALKAQNALHEQKTLPGMNRPIQVKPADSEG-RGDRKLFVGMLGKQLSDADVRKMFEPFGSIEECTVLRGPDGASKGCAFVKYQSNAE 146          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Zebrafish
Match: celf3b (cugbp, Elav-like family member 3b [Source:ZFIN;Acc:ZDB-GENE-110408-50])

HSP 1 Score: 286.574 bits (732), Expect = 1.995e-90
Identity = 186/422 (44.08%), Postives = 243/422 (57.58%), Query Frame = 2
Query:  422 KGEDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGGSAYS---QYLENLQQNTGYINPIATLAXXXXXXXXXXXXIALGATLPYTLSTGIPTNDANASQNFLGVNPLAAAVAASQNLTTQSLLSPST---AASMMMPNNSGMNTMCQVQQQTPIISSATQMNDPSVNISHTQMSNGQTRPQNLTPFSLAAATGANWLASNSTTLPAMYGGLNLCGLAPYNPPTLNPITLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            +GEDRKLF+GMLGKQ +++DVR +F+P+G I+ECT+LR  +G SKGCAFVK+ + SEA +AI ++HGS T+PGASSSLVVKFADTEKER  R++QQ  +  G+  P +TL+    +AY+      + L     Y++P A++ +Q    L     IA   T P   +T  PT         L   P+ +A+     +   S L P+T    AS +       N +   Q Q+P+ +                          L P   A A   ++ A+     P  YG +        +P  L   TL+++Q L     Q+E        GP+G NVFIYHLPQEF D+E+ QMF PFG VISAKV++DRATNQSKCFGFVSFDN  SAQ AIQAMNGFQIGMKRLKVQLKRPK  D  +PY
Sbjct:   91 RGEDRKLFVGMLGKQQSDEDVRKIFEPFGGIDECTVLRGPDGTSKGCAFVKFQSHSEAQSAINSLHGSRTLPGASSSLVVKFADTEKERGVRRMQQVTSQLGVYTP-VTLNFNAYNAYTQALVQQQALVAQAQYLSPAASMQIQQMAALNASGIIATPITPPSGANTP-PT---------LAATPV-SALPQPIAVNGYSHLPPTTNGQPASEIY-----TNGLHPYQAQSPVAA--------------------------LDPLQQAYAGMQHYTAA----YPTAYGLV--------SPQFLQQPTLISQQQL-----QRE--------GPEGCNVFIYHLPQEFTDSEMLQMFLPFGNVISAKVFVDRATNQSKCFGFVSFDNPASAQTAIQAMNGFQIGMKRLKVQLKRPK--DANRPY 442          

HSP 2 Score: 77.0258 bits (188), Expect = 1.677e-14
Identity = 43/127 (33.86%), Postives = 65/127 (51.18%), Query Frame = 2
Query:  437 KLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQ-NGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKL--------------QQFINPFGLINPGLTLSALGGSA 772
            KLFIG + +   E D++ +F+ YG I E T+++D+  G  KGCAF+ Y  R  A  A  A+H   T+PG +  + VK AD+E   + RKL              ++   PFG I+    L    G++
Sbjct:    8 KLFIGQIPRNLEEKDLKPIFEQYGKIYELTVIKDKYTGMHKGCAFLTYCARESAVKAQSALHEQKTLPGMNRPIQVKPADSEGRGEDRKLFVGMLGKQQSDEDVRKIFEPFGGIDECTVLRGPDGTS 134          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Xenopus
Match: celf2 (CUGBP, Elav-like family member 2 [Source:NCBI gene;Acc:100125022])

HSP 1 Score: 241.506 bits (615), Expect = 3.226e-72
Identity = 178/426 (41.78%), Postives = 228/426 (53.52%), Query Frame = 2
Query:  428 EDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGG--SAYSQYLENLQQ-----NTGYINPIATLAXXXXXXXXXXXXIALGATLPYTLSTGIPTNDANASQNFLGVNPLAAAVAASQNLTTQSLLSPSTAASMMMPNNSGMNTMCQVQQQTPIISSATQMND-----PSVNISHTQMSNGQTRPQNLTPFSLAAATGANWLASNSTTLPAMYGGLNLCGLAPYNPPTLNPITLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            EDRKLFIGM+ K+  E+D+R +F P+G IEEC ILR  +G S+GCAFV ++TR+ A  AI AMH S T+ G SS +VVKFADT+K+++ R+LQQ +          T   L G  +   QYL  LQQ     N G  + I  +A     Q            L    +       A  S      NPL+   +A   LT     SP  A++      + MN++  +     +  +   +N+      +VNI+  QM +G           L A    N  A     L   Y G+     A    PTL   +LL +Q  S    QKEG        P+G+N+FIYHLPQEFGD ++ QMF PFG VISAKV+ID+ TN SKCFGFVS+DN  SAQAAIQAMNGFQIGMKRLKVQLKR K  +  KPY
Sbjct:  125 EDRKLFIGMVSKKCNENDIRVMFSPFGQIEECRILRGPDGLSRGCAFVTFSTRAMAQNAIKAMHQSQTMEGCSSPIVVKFADTQKDKEQRRLQQQLAQQMQQLNTATWGNLTGLGALTPQYLALLQQATSSSNLGAFSGIQQMAGMNALQ------------LQNLATLAAAAAAAQTSATTTNANPLSTTTSALGALT-----SPVAASTANSSAGAAMNSLTSLGTLQGLAGATVGLNNINALAGTVNIA--QMLSGMAALNG----GLGATGLTNGTAGTMDALTQAYSGIQQYAAAAL--PTLYSQSLLQQQ--SAAGSQKEG--------PEGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSK--NDSKPY 513          

HSP 2 Score: 82.4185 bits (202), Expect = 5.542e-16
Identity = 43/129 (33.33%), Postives = 67/129 (51.94%), Query Frame = 2
Query:  338 IDDCFENKDEKKPATNNSNCKMSKQAQHKGEDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGN---SKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFI 715
            +D      D     TN  N  +    Q   +  K+F+G + +  +E +++DLF+PYGA+ +  +LRD++ N   SKGC FV + TR  A  A  A+H   T+PG    + +K AD+EK       + FI
Sbjct:    3 VDSRLLVSDRINGTTNKMNGALDHSDQPDPDAIKMFVGQIPRSWSEKELKDLFEPYGAVYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHPIQMKPADSEKSNAVEDRKLFI 131          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Xenopus
Match: celf2 (CUGBP, Elav-like family member 2 [Source:NCBI gene;Acc:100125022])

HSP 1 Score: 241.121 bits (614), Expect = 7.057e-72
Identity = 178/426 (41.78%), Postives = 228/426 (53.52%), Query Frame = 2
Query:  428 EDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGG--SAYSQYLENLQQ-----NTGYINPIATLAXXXXXXXXXXXXIALGATLPYTLSTGIPTNDANASQNFLGVNPLAAAVAASQNLTTQSLLSPSTAASMMMPNNSGMNTMCQVQQQTPIISSATQMND-----PSVNISHTQMSNGQTRPQNLTPFSLAAATGANWLASNSTTLPAMYGGLNLCGLAPYNPPTLNPITLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            EDRKLFIGM+ K+  E+D+R +F P+G IEEC ILR  +G S+GCAFV ++TR+ A  AI AMH S T+ G SS +VVKFADT+K+++ R+LQQ +          T   L G  +   QYL  LQQ     N G  + I  +A     Q            L    +       A  S      NPL+   +A   LT     SP  A++      + MN++  +     +  +   +N+      +VNI+  QM +G           L A    N  A     L   Y G+     A    PTL   +LL +Q  S    QKEG        P+G+N+FIYHLPQEFGD ++ QMF PFG VISAKV+ID+ TN SKCFGFVS+DN  SAQAAIQAMNGFQIGMKRLKVQLKR K  +  KPY
Sbjct:  148 EDRKLFIGMVSKKCNENDIRVMFSPFGQIEECRILRGPDGLSRGCAFVTFSTRAMAQNAIKAMHQSQTMEGCSSPIVVKFADTQKDKEQRRLQQQLAQQMQQLNTATWGNLTGLGALTPQYLALLQQATSSSNLGAFSGIQQMAGMNALQ------------LQNLATLAAAAAAAQTSATTTNANPLSTTTSALGALT-----SPVAASTANSSAGAAMNSLTSLGTLQGLAGATVGLNNINALAGTVNIA--QMLSGMAALNG----GLGATGLTNGTAGTMDALTQAYSGIQQYAAAAL--PTLYSQSLLQQQ--SAAGSQKEG--------PEGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSK--NDSKPY 536          

HSP 2 Score: 81.2629 bits (199), Expect = 1.459e-15
Identity = 41/115 (35.65%), Postives = 64/115 (55.65%), Query Frame = 2
Query:  380 TNNSNCKMSKQAQHKGEDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGN---SKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFI 715
            TN  N  +    Q   +  K+F+G + +  +E +++DLF+PYGA+ +  +LRD++ N   SKGC FV + TR  A  A  A+H   T+PG    + +K AD+EK       + FI
Sbjct:   40 TNKMNGALDHSDQPDPDAIKMFVGQIPRSWSEKELKDLFEPYGAVYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHPIQMKPADSEKSNAVEDRKLFI 154          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Xenopus
Match: celf2 (CUGBP, Elav-like family member 2 [Source:NCBI gene;Acc:100125022])

HSP 1 Score: 239.58 bits (610), Expect = 1.405e-71
Identity = 178/428 (41.59%), Postives = 231/428 (53.97%), Query Frame = 2
Query:  428 EDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGG--SAYSQYLENLQQ-----NTGYINPIATLAXXXXXXXXXXXXIAL-GATLPYTLSTGIPTNDANASQNFLGVNPLAAAVAASQNLTTQSLLSPSTAASMMMPN-NSGMNTMCQVQQQTPIISSATQMND-----PSVNISHTQMSNGQTRPQNLTPFSLAAATGANWLASNSTTLPAMYGGLNLCGLAPYNPPTLNPITLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            EDRKLFIGM+ K+  E+D+R +F P+G IEEC ILR  +G S+GCAFV ++TR+ A  AI AMH S T+ G SS +VVKFADT+K+++ R+LQQ +          T   L G  +   QYL  LQQ     N G  + I  +A + +++       AL  + L +       TND                   S  LT   L+    AAS    +  + MN++  +     +  +   +N+      +VNI+  QM +G           L A    N  A     L   Y G+     A    PTL   +LL +Q  S    QKEG        P+G+N+FIYHLPQEFGD ++ QMF PFG VISAKV+ID+ TN SKCFGFVS+DN  SAQAAIQAMNGFQIGMKRLKVQLKR K  +  KPY
Sbjct:  126 EDRKLFIGMVSKKCNENDIRVMFSPFGQIEECRILRGPDGLSRGCAFVTFSTRAMAQNAIKAMHQSQTMEGCSSPIVVKFADTQKDKEQRRLQQQLAQQMQQLNTATWGNLTGLGALTPQYLALLQQATSSSNLGAFSGIQQMAGKWRKKHLILANYALFSSALKF-----FCTNDV-----------------LSWKLTFHYLIFFLVAASTANSSAGAAMNSLTSLGTLQGLAGATVGLNNINALAGTVNIA--QMLSGMAALNG----GLGATGLTNGTAGTMDALTQAYSGIQQYAAAAL--PTLYSQSLLQQQ--SAAGSQKEG--------PEGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSK--NDSKPY 511          

HSP 2 Score: 80.8777 bits (198), Expect = 1.898e-15
Identity = 41/115 (35.65%), Postives = 64/115 (55.65%), Query Frame = 2
Query:  380 TNNSNCKMSKQAQHKGEDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGN---SKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFI 715
            TN  N  +    Q   +  K+F+G + +  +E +++DLF+PYGA+ +  +LRD++ N   SKGC FV + TR  A  A  A+H   T+PG    + +K AD+EK       + FI
Sbjct:   18 TNKMNGALDHSDQPDPDAIKMFVGQIPRSWSEKELKDLFEPYGAVYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHPIQMKPADSEKSNAVEDRKLFI 132          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Xenopus
Match: celf2 (CUGBP, Elav-like family member 2 [Source:NCBI gene;Acc:100125022])

HSP 1 Score: 237.654 bits (605), Expect = 3.895e-71
Identity = 173/423 (40.90%), Postives = 226/423 (53.43%), Query Frame = 2
Query:  428 EDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGG--SAYSQYLENLQQ-----NTGYINPIATLAXXXXXXXXXXXXIAL-GATLPYTLSTGIPTNDANASQNFLGVNPLAAAVAASQNLTTQSLLSPSTAASMMMPN-NSGMNTMCQVQQQTPIISSATQMNDPSVNISHTQMSNGQTRPQNLTPFSLAAATGANWLASNSTTLPAMYGGLNLCGLAPYNPPTLNPITLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            EDRKLFIGM+ K+  E+D+R +F P+G IEEC ILR  +G S+GCAFV ++TR+ A  AI AMH S T+ G SS +VVKFADT+K+++ R+LQQ +          T   L G  +   QYL  LQQ     N G  + I  +A + +++       AL  + L +       TND                   S  LT   L+    AAS    +  + MN++  +     +  +   +N+ +       ++ G           L A    N  A     L   Y G+     A    PTL   +LL +Q  S    QKEG        P+G+N+FIYHLPQEFGD ++ QMF PFG VISAKV+ID+ TN SKCFGFVS+DN  SAQAAIQAMNGFQIGMKRLKVQLKR K  +  KPY
Sbjct:  106 EDRKLFIGMVSKKCNENDIRVMFSPFGQIEECRILRGPDGLSRGCAFVTFSTRAMAQNAIKAMHQSQTMEGCSSPIVVKFADTQKDKEQRRLQQQLAQQMQQLNTATWGNLTGLGALTPQYLALLQQATSSSNLGAFSGIQQMAGKWRKKHLILANYALFSSALKF-----FCTNDV-----------------LSWKLTFHYLIFFLVAASTANSSAGAAMNSLTSLGTLQGLAGATVGLNNINALAGMAALNGG-----------LGATGLTNGTAGTMDALTQAYSGIQQYAAAAL--PTLYSQSLLQQQ--SAAGSQKEG--------PEGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSK--NDSKPY 481          

HSP 2 Score: 78.9518 bits (193), Expect = 5.866e-15
Identity = 37/96 (38.54%), Postives = 58/96 (60.42%), Query Frame = 2
Query:  437 KLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGN---SKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFI 715
            K+F+G + +  +E +++DLF+PYGA+ +  +LRD++ N   SKGC FV + TR  A  A  A+H   T+PG    + +K AD+EK       + FI
Sbjct:   17 KMFVGQIPRSWSEKELKDLFEPYGAVYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHPIQMKPADSEKSNAVEDRKLFI 112          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Xenopus
Match: tpbg (trophoblast glycoprotein [Source:Xenbase;Acc:XB-GENE-1016283])

HSP 1 Score: 156.762 bits (395), Expect = 4.395e-45
Identity = 73/91 (80.22%), Postives = 79/91 (86.81%), Query Frame = 2
Query: 1397 PDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            P G N+FIYHLPQEF D+E+ QMF PFG VISAKV++DRATNQSKCFGFVSFDN  SAQAAIQAMNGFQIGMKRLKVQLKRPK  D  +PY
Sbjct:   33 PPGCNIFIYHLPQEFTDSEILQMFLPFGNVISAKVFVDRATNQSKCFGFVSFDNPGSAQAAIQAMNGFQIGMKRLKVQLKRPK--DANRPY 121          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Mouse
Match: Celf3 (CUGBP, Elav-like family member 3 [Source:MGI Symbol;Acc:MGI:1926034])

HSP 1 Score: 307.76 bits (787), Expect = 5.643e-98
Identity = 193/430 (44.88%), Postives = 250/430 (58.14%), Query Frame = 2
Query:  413 AQHKGEDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGGSAYSQYLENLQQ--------NTGYINPIATLAXXXXXXXXXXXXIALGATLPYTLSTGIPTNDANASQNFLGVNPLAAAVAASQNLTTQSLLSPSTAASMMMPNNSGMNTMCQVQQQTPIISSATQMNDPSVNISHT---QMSNGQTRPQNLTPFSLAAATGANWLASNSTTLPAMYGGLNLCGLAPYNPPTLNPITLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            ++ +GEDRKLF+GMLGKQ T++DVR +F+P+G I+ECT+LR  +G SKGCAFVK+ T +EA  AI  +H S T+PGASSSLVVKFADTEKER  R++QQ     G+ +P     AL   AYS Y + L Q        ++ Y++P+AT+A    Q +       L AT P T S+G  T  A A+     + P A  V     + TQ    P+  A  + PN               + +  +    P ++ +H+    +S  Q+    + P   A A   ++ A+     PA Y   +L   A   PP L             Q QQ++  +     GPDG N+FIYHLPQEF D+E+ QMF PFG VISAKV++DRATNQSKCFGFVSFDN  SAQAAIQAMNGFQIGMKRLKVQLKRPK  D  +PY
Sbjct:   88 SESRGEDRKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTSKGCAFVKFQTHAEAQAAINTLHSSRTLPGASSSLVVKFADTEKERGLRRMQQVATQLGMFSP----IALQFGAYSAYTQALMQQQAALVAAHSAYLSPMATMAAVQMQHMAAISANGLIAT-PITPSSGTSTPPAIAATPVSAI-PAALGVNGYSPVPTQPTGQPAPDA--LYPNG------VHPYPDEALSAERSAGGVPIMSQAHSWLVMLSAAQSPAAPVDPLQQAYAGMQHYTAA----YPAAY---SLVAPAFPQPPALVAQQPPPPPQQQQQQQQQQQQQQQQREGPDGCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK--DANRPY 494          

HSP 2 Score: 74.7146 bits (182), Expect = 1.021e-13
Identity = 41/127 (32.28%), Postives = 65/127 (51.18%), Query Frame = 2
Query:  437 KLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQ-NGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKL--------------QQFINPFGLINPGLTLSALGGSA 772
            KLF+G + +   E D++ +F+ +G I E T+++D+  G  KGCAF+ Y  R  A  A  A+H   T+PG +  + VK AD+E   + RKL              ++   PFG I+    L    G++
Sbjct:    8 KLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQSALHEQKTLPGMNRPIQVKPADSESRGEDRKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTS 134          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Mouse
Match: Celf5 (CUGBP, Elav-like family member 5 [Source:MGI Symbol;Acc:MGI:2442333])

HSP 1 Score: 298.516 bits (763), Expect = 5.067e-95
Identity = 182/415 (43.86%), Postives = 231/415 (55.66%), Query Frame = 2
Query:  425 GEDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGGSAYSQYLENLQQNTGYINPIATLAXXXXXXXXXXXXIALGATLPYTLSTGIPTNDANASQNFLGVNPLAAAVAASQNLTTQSLLSPSTAASMMMPNNSGMNTMCQVQQQTPIISSATQMNDPSVNISHTQMSNGQTRPQNLTPFSLAAATGANWLASNSTTLPAMYGGLNLCGLAPYNPPTLNPITLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            G DRKLF+GML KQ +E+DV  LF+P+G I+ECT+LR  +G+SKGCAFVK+++ +EA  AI A+HGS T+PGASSSLVVKFADT+KER  R++QQ +   G++ P LTL     SAY+Q L  +QQ T  ++                  ++ G   P      I       S N L   P+A A      L +  LL  +    +M P  +G   +       P +               T  +NG      L P+   + T A  L       PA  G      + P     + P+     Q   +  QQ+E        GP+G N+FIYHLPQEFGD EL QMF PFG +IS+KV++DRATNQSKCFGFVSFD+  SAQAAIQAMNGFQIGMKRLKVQLKRPK  D G PY
Sbjct:   93 GRDRKLFVGMLNKQQSEEDVLRLFQPFGVIDECTVLRGPDGSSKGCAFVKFSSHTEAQAAIHALHGSQTMPGASSSLVVKFADTDKERTLRRMQQMVGQLGILTPSLTLPFSPYSAYAQAL--MQQQTTVLS-------------TSGSYLSPGVAFPPCHIQQI----GAVSLNGLPATPIAPA----SGLHSPPLLGTAAVPGLMAPIPNGFPGVLPFPGSHPALE--------------TVYANG------LVPYPAQSPTVAETLH------PAFSGVQQYTAMYPTA--AIAPVAHSVPQPPHLLQQQRE--------GPEGCNLFIYHLPQEFGDTELTQMFLPFGNIISSKVFMDRATNQSKCFGFVSFDHPASAQAAIQAMNGFQIGMKRLKVQLKRPK--DPGHPY 446          

HSP 2 Score: 74.3294 bits (181), Expect = 1.169e-13
Identity = 42/128 (32.81%), Postives = 64/128 (50.00%), Query Frame = 2
Query:  437 KLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRD-QNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTE---------------KERQTRKLQQFINPFGLINPGLTLSALGGSA 772
            KLF+G + +   E D++ LF+ +G I E T+L+D   G  KGCAF+ Y  R  A  A  A+H   T+PG +  + VK AD+E               K++    + +   PFG+I+    L    GS+
Sbjct:    8 KLFVGQIPRHLHEQDLKPLFEQFGRIYELTVLKDPHTGVHKGCAFLTYCARDSAIKAQTALHEQKTLPGMARPIQVKPADSESRGGRDRKLFVGMLNKQQSEEDVLRLFQPFGVIDECTVLRGPDGSS 135          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Mouse
Match: Celf3 (CUGBP, Elav-like family member 3 [Source:MGI Symbol;Acc:MGI:1926034])

HSP 1 Score: 296.59 bits (758), Expect = 5.609e-95
Identity = 189/421 (44.89%), Postives = 235/421 (55.82%), Query Frame = 2
Query:  431 DRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGGSAYSQYLENLQQ--------NTGYINPIATLAXXXXXXXXXXXXIALGATLPYTLSTGIPTNDANASQNFLGVNPLAAAVAASQNLTTQSLLSPSTAASMMMPNNSGMNTMCQVQQQTPIISSATQMNDPSVNISHTQMSNGQTRPQNLTPFSLAAATGANWLASNSTTLPAMYGGLNLCGLAPYNPPTLNPITLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            DRKLF+GMLGKQ T++DVR +F+P+G I+ECT+LR  +G SKGCAFVK+ T +EA  AI  +H S T+PGASSSLVVKFADTEKER  R++QQ     G+ +P     AL   AYS Y + L Q        ++ Y++P+AT+A    Q +       L AT P T S+G  T  A A+     + P A  V     + TQ    P+  A  + PN                               H   +     P  + P   A A   ++ A+     PA Y   +L   A   PP L             Q QQ++  +     GPDG N+FIYHLPQEF D+E+ QMF PFG VISAKV++DRATNQSKCFGFVSFDN  SAQAAIQAMNGFQIGMKRLKVQLKRPK  D  +PY
Sbjct:   17 DRKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTSKGCAFVKFQTHAEAQAAINTLHSSRTLPGASSSLVVKFADTEKERGLRRMQQVATQLGMFSP----IALQFGAYSAYTQALMQQQAALVAAHSAYLSPMATMAAVQMQHMAAISANGLIAT-PITPSSGTSTPPAIAATPVSAI-PAALGVNGYSPVPTQPTGQPAPDA--LYPNG-----------------------------VHPYPAQSPAAP--VDPLQQAYAGMQHYTAA----YPAAY---SLVAPAFPQPPALVAQQPPPPPQQQQQQQQQQQQQQQQREGPDGCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK--DANRPY 389          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Mouse
Match: Celf3 (CUGBP, Elav-like family member 3 [Source:MGI Symbol;Acc:MGI:1926034])

HSP 1 Score: 296.204 bits (757), Expect = 8.544e-94
Identity = 191/421 (45.37%), Postives = 239/421 (56.77%), Query Frame = 2
Query:  431 DRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGGSAYSQYLENLQQ--------NTGYINPIATLAXXXXXXXXXXXXIALGATLPYTLSTGIPTNDANASQNFLGVNPLAAAVAASQNLTTQSLLSPSTAASMMMPNNSGMNTMCQVQQQTPIISSATQMNDPSVNISHTQMSNGQTRPQNLTPFSLAAATGANWLASNSTTLPAMYGGLNLCGLAPYNPPTLNPITLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            DRKLF+GMLGKQ T++DVR +F+P+G I+ECT+LR  +G SKGCAFVK+ T +EA  AI  +H S T+PGASSSLVVKFADTEKER  R++QQ     G+ +P     AL   AYS Y + L Q        ++ Y++P+AT+A    Q +       L AT P T S+G  T  A A+     + P A  V     + TQ    P+  A  + PN  G++         P  S A  ++                      P   A A   ++ A+     PA Y   +L   A   PP L             Q QQ++  +     GPDG N+FIYHLPQEF D+E+ QMF PFG VISAKV++DRATNQSKCFGFVSFDN  SAQAAIQAMNGFQIGMKRLKVQLKRPK  D  +PY
Sbjct:   93 DRKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTSKGCAFVKFQTHAEAQAAINTLHSSRTLPGASSSLVVKFADTEKERGLRRMQQVATQLGMFSP----IALQFGAYSAYTQALMQQQAALVAAHSAYLSPMATMAAVQMQHMAAISANGLIAT-PITPSSGTSTPPAIAATPVSAI-PAALGVNGYSPVPTQPTGQPAPDA--LYPN--GVHPY-------PAQSPAAPVD----------------------PLQQAYAGMQHYTAA----YPAAY---SLVAPAFPQPPALVAQQPPPPPQQQQQQQQQQQQQQQQREGPDGCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK--DANRPY 465          

HSP 2 Score: 72.4034 bits (176), Expect = 5.122e-13
Identity = 42/127 (33.07%), Postives = 65/127 (51.18%), Query Frame = 2
Query:  437 KLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQ-NGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKL--------------QQFINPFGLINPGLTLSALGGSA 772
            KLF+G + +   E D++ +F+ +G I E T+++D+  G  KGCAF+ Y  R  A  A  A+H   T+PG +  + VK AD+E  R  RKL              ++   PFG I+    L    G++
Sbjct:    8 KLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQSALHEQKTLPGMNRPIQVKPADSE-SRGDRKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTS 133          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Mouse
Match: Celf2 (CUGBP, Elav-like family member 2 [Source:MGI Symbol;Acc:MGI:1338822])

HSP 1 Score: 240.736 bits (613), Expect = 2.488e-72
Identity = 177/422 (41.94%), Postives = 229/422 (54.27%), Query Frame = 2
Query:  428 EDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLT---LSALGGSAYSQYLENLQQ-----NTGYINPIATLAXXXXXXXXXXXXIALGATLPYTLSTGIPTNDANASQNFLGVNPLAAAVAASQNLTTQSLLSPSTAASMMMPNNSGMNTMCQVQQQTPIISSATQMNDPSVNISHTQMSNGQTRPQNLTPFSLAAATGANWLASNSTTLPAMYGGLNLCGLAPYNPPTLNPITLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            EDRKLFIGM+ K+  E+D+R +F P+G IEEC ILR  +G S+GCAFV ++TR+ A  AI AMH S T+ G SS +VVKFADT+K+++ R+LQQ +          T   L+ LGG    QYL  LQQ     N G  + I  +A     Q            L    +       A  S      NPL++  +A   LT     SP  A++      + MN++  +     +  +   +N+ +  ++  QM +G           L A    N  A     L   Y G+     A    PTL   +LL +Q  S    QKEG        P+G+N+FIYHLPQEFGD ++ QMF PFG VISAKV+ID+ TN SKCFGFVS+DN  SAQAAIQAMNGFQIGMKRLKVQLKR K  +  KPY
Sbjct:  106 EDRKLFIGMVSKKCNENDIRVMFSPFGQIEECRILRGPDGLSRGCAFVTFSTRAMAQNAIKAMHQSQTMEGCSSPIVVKFADTQKDKEQRRLQQQLAQQMQQLNTATWGNLTGLGG-LTPQYLALLQQATSSSNLGAFSGIQQMAGMNALQ------------LQNLATLAAAAAAAQTSATSTNANPLSSTSSALGALT-----SPVAASTPNSTAGAAMNSLTSLGTLQGLAGATVGLNNINA-LAVAQMLSGMAALNG----GLGATGLTNGTAGTMDALTQAYSGIQQYAAAAL--PTLYSQSLLQQQ--SAAGSQKEG--------PEGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSK--NDSKPY 490          

HSP 2 Score: 78.1814 bits (191), Expect = 9.555e-15
Identity = 36/96 (37.50%), Postives = 58/96 (60.42%), Query Frame = 2
Query:  437 KLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGN---SKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFI 715
            K+F+G + +  +E ++++LF+PYGA+ +  +LRD++ N   SKGC FV + TR  A  A  A+H   T+PG    + +K AD+EK       + FI
Sbjct:   17 KMFVGQIPRSWSEKELKELFEPYGAVYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHPIQMKPADSEKSNAVEDRKLFI 112          
BLAST of Trinucleotide repeat containing 4-like protein vs. UniProt/SwissProt
Match: sp|Q91579|CEL3A_XENLA (CUGBP Elav-like family member 3-A OS=Xenopus laevis OX=8355 GN=tnrc4-a PE=2 SV=2)

HSP 1 Score: 301.982 bits (772), Expect = 2.782e-95
Identity = 191/428 (44.63%), Postives = 252/428 (58.88%), Query Frame = 2
Query:  413 AQHKGEDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGGSAYSQYLEN--LQQ-------NTGYINPIATLAXXXXXXXXXXXXIALGATLPYTLSTGIPTNDANASQNFLGVNPLAAAVAASQNLTTQSLLSPSTAASMMMPNNSGMNTMCQVQQQTPIISSATQMNDPSVNISHTQMSNGQTRPQNLTPFSLAAATGANWLASNSTTLPAMYGGLNLCGLAPYNPPTLNPITLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            ++ +GEDRKLF+GMLGKQ T++DVR +F+P+G I+ECT+LR  +G SKGCAFVK+ T +EA  AI A+HGS T+PGASSSLVVKFADTEKER  R++QQ  N  G+ +P + L     SAY+Q + +  +QQ       ++ Y+NP+AT+A    QQ+       + AT P T                  +NP+ ++   S   T  +L +   +A   +P   G+N    V  Q     S  Q +  ++  +       Q+    L P   A A   ++ A+     PA YG ++         P       + +Q    Q QQ+EG        P+G N+FIYHLPQEF D+E+ QMF PFG VISAKV++DRATNQSKCFGFVSFDN  SAQAAIQAMNGFQIGMKRLKVQLKRPK  D  +PY
Sbjct:   88 SESRGEDRKLFVGMLGKQQTDEDVRRMFEPFGNIDECTVLRGPDGTSKGCAFVKFQTHTEAQAAINALHGSRTLPGASSSLVVKFADTEKERGLRRMQQVANQLGMFSP-IALQFGAYSAYTQAVSDQLMQQQAALVAAHSAYLNPMATMAAVQMQQMATINPNGIIAT-PIT-----------------QINPITSSSGTS---TPPTLTATQVSA---IPATLGVNGYSAVPTQ-----STVQPSSEAIYTNGLHPYPAQSPVAQLDPLQQAYAGMQHYTAA----YPAAYGLVS---------PAFTQPPAILQQQPPQQQQQREG--------PEGCNIFIYHLPQEFTDSEILQMFLPFGNVISAKVFVDRATNQSKCFGFVSFDNPGSAQAAIQAMNGFQIGMKRLKVQLKRPK--DANRPY 462          
BLAST of Trinucleotide repeat containing 4-like protein vs. UniProt/SwissProt
Match: sp|Q08E07|CELF3_BOVIN (CUGBP Elav-like family member 3 OS=Bos taurus OX=9913 GN=CELF3 PE=2 SV=1)

HSP 1 Score: 300.442 bits (768), Expect = 1.288e-94
Identity = 193/427 (45.20%), Postives = 244/427 (57.14%), Query Frame = 2
Query:  413 AQHKGEDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGGSAYSQYLENLQQ--------NTGYINPIATLAXXXXXXXXXXXXIALGATLPYTLSTGIPTNDANASQNFLGVNPLAAAVAASQNLTTQSLLSPSTAASMMMPNNSGMNTMCQVQQQTPIISSATQMNDPSVNISHTQMSNGQTRPQNLTPFSLAAATGANWLASNSTTLPAMYGGLNLCGLAPYNPPTLNPITLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            ++ +GEDRKLF+GMLGKQ T++DVR +F+P+G I+ECT+LR  +G SKGCAFVK+ T +EA  AI  +H S T+PGASSSLVVKFADTEKER  R++QQ     G+ +P     AL   AYS Y + L Q        ++ Y++P+AT+A    Q +       L AT P T S+G  T  A A+     + P A  V     + TQ    P+  A  + PN  G++         P  S A  ++                      P   A A   ++     T  PA Y   +L   A   PP L             Q QQ++  ++    GPDG N+FIYHLPQEF D+E+ QMF PFG VISAKV++DRATNQSKCFGFVSFDN  SAQAAIQAMNGFQIGMKRLKVQLKRPK  D  +PY
Sbjct:   88 SESRGEDRKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTSKGCAFVKFQTHAEAQAAINTLHSSRTLPGASSSLVVKFADTEKERGLRRMQQVATQLGMFSP----IALQFGAYSAYTQALMQQQAALVAAHSAYLSPMATMAAVQMQHMAAINANGLIAT-PITPSSGTSTPPAIAATPVSAI-PAALGVNGYSPVPTQPTGQPAPDA--LYPN--GVHPY-------PAQSPAAPVD----------------------PLQQAYAGMQHY-----TAYPAAY---SLVAPAFPQPPALVAQQPPPPPQQQQQQQQQQQQRE----GPDGCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK--DANRPY 461          

HSP 2 Score: 75.485 bits (184), Expect = 4.459e-13
Identity = 41/127 (32.28%), Postives = 65/127 (51.18%), Query Frame = 2
Query:  437 KLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQ-NGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKL--------------QQFINPFGLINPGLTLSALGGSA 772
            KLF+G + +   E D++ +F+ +G I E T+++D+  G  KGCAF+ Y  R  A  A  A+H   T+PG +  + VK AD+E   + RKL              ++   PFG I+    L    G++
Sbjct:    8 KLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQSALHEQKTLPGMNRPIQVKPADSESRGEDRKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTS 134          
BLAST of Trinucleotide repeat containing 4-like protein vs. UniProt/SwissProt
Match: sp|Q8CIN6|CELF3_MOUSE (CUGBP Elav-like family member 3 OS=Mus musculus OX=10090 GN=Celf3 PE=2 SV=1)

HSP 1 Score: 296.204 bits (757), Expect = 5.976e-93
Identity = 191/421 (45.37%), Postives = 239/421 (56.77%), Query Frame = 2
Query:  431 DRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGGSAYSQYLENLQQ--------NTGYINPIATLAXXXXXXXXXXXXIALGATLPYTLSTGIPTNDANASQNFLGVNPLAAAVAASQNLTTQSLLSPSTAASMMMPNNSGMNTMCQVQQQTPIISSATQMNDPSVNISHTQMSNGQTRPQNLTPFSLAAATGANWLASNSTTLPAMYGGLNLCGLAPYNPPTLNPITLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            DRKLF+GMLGKQ T++DVR +F+P+G I+ECT+LR  +G SKGCAFVK+ T +EA  AI  +H S T+PGASSSLVVKFADTEKER  R++QQ     G+ +P     AL   AYS Y + L Q        ++ Y++P+AT+A    Q +       L AT P T S+G  T  A A+     + P A  V     + TQ    P+  A  + PN  G++         P  S A  ++                      P   A A   ++ A+     PA Y   +L   A   PP L             Q QQ++  +     GPDG N+FIYHLPQEF D+E+ QMF PFG VISAKV++DRATNQSKCFGFVSFDN  SAQAAIQAMNGFQIGMKRLKVQLKRPK  D  +PY
Sbjct:   93 DRKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTSKGCAFVKFQTHAEAQAAINTLHSSRTLPGASSSLVVKFADTEKERGLRRMQQVATQLGMFSP----IALQFGAYSAYTQALMQQQAALVAAHSAYLSPMATMAAVQMQHMAAISANGLIAT-PITPSSGTSTPPAIAATPVSAI-PAALGVNGYSPVPTQPTGQPAPDA--LYPN--GVHPY-------PAQSPAAPVD----------------------PLQQAYAGMQHYTAA----YPAAY---SLVAPAFPQPPALVAQQPPPPPQQQQQQQQQQQQQQQQREGPDGCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK--DANRPY 465          

HSP 2 Score: 72.4034 bits (176), Expect = 3.582e-12
Identity = 42/127 (33.07%), Postives = 65/127 (51.18%), Query Frame = 2
Query:  437 KLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQ-NGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKL--------------QQFINPFGLINPGLTLSALGGSA 772
            KLF+G + +   E D++ +F+ +G I E T+++D+  G  KGCAF+ Y  R  A  A  A+H   T+PG +  + VK AD+E  R  RKL              ++   PFG I+    L    G++
Sbjct:    8 KLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQSALHEQKTLPGMNRPIQVKPADSE-SRGDRKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTS 133          
BLAST of Trinucleotide repeat containing 4-like protein vs. UniProt/SwissProt
Match: sp|Q7ZWM3|CEL3B_XENLA (CUGBP Elav-like family member 3-B OS=Xenopus laevis OX=8355 GN=tnrc4-b PE=2 SV=1)

HSP 1 Score: 295.049 bits (754), Expect = 1.221e-92
Identity = 186/428 (43.46%), Postives = 247/428 (57.71%), Query Frame = 2
Query:  413 AQHKGEDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGGSAYSQYLEN---------LQQNTGYINPIATLAXXXXXXXXXXXXIALGATLPYTLSTGIPTNDANASQNFLGVNPLAAAVAASQNLTTQSLLSPSTAASMMMPNNSGMNTMCQVQQQTPIISSATQMNDPSVNISHTQMSNGQTRPQNLTPFSLAAATGANWLASNSTTLPAMYGGLNLCGLAPYNPPTLNPITLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            ++ +GEDRKLF+GMLGKQ T++DVR +F+ +G I+ECT+LR  +G SKGCAFVK+ T +EA  AI A+HGS T+PGASSSLVVKFADTEKER  R++QQ  N  G+ +P + L     SAY+Q + +         +   + Y+NP+AT+A    QQ+       + AT P T    I ++   ++   L   P++A                       +P   G+N    V  Q     S  Q +  ++  +       Q+    L P   A A   ++ A+     PA YG   L   A   PP +          L+ Q  Q++  ++    GP+G N+FIYHLPQEF D+E+ QMF PFG VISAKV++DRATNQSKCFGFVSFDN  SAQAAIQ+MNGFQIGMKRLKVQLKRPK  D  +PY
Sbjct:   88 SESRGEDRKLFVGMLGKQQTDEDVRRMFETFGNIDECTVLRGPDGTSKGCAFVKFQTHTEAQAAINALHGSRTLPGASSSLVVKFADTEKERGLRRMQQVANQLGMFSP-IALQFGAYSAYTQAVSDQLMQQQAALVAAQSAYLNPMATMAAVQMQQMATINPNGIIAT-PITQINSITSSSGTSTPPTLTATPVSA-----------------------IPATLGVNGYSAVPTQ-----STVQPSSEAIYTNGLHPYPAQSPVAQLDPLQQAYAGMQHYTAA----YPAAYG---LVSPAFTQPPAI----------LTQQPPQQQQQRE----GPEGCNIFIYHLPQEFTDSEILQMFLPFGNVISAKVFVDRATNQSKCFGFVSFDNPGSAQAAIQSMNGFQIGMKRLKVQLKRPK--DANRPY 462          

HSP 2 Score: 74.3294 bits (181), Expect = 9.668e-13
Identity = 36/90 (40.00%), Postives = 54/90 (60.00%), Query Frame = 2
Query:  437 KLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQ-NGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKL 703
            KLFIG + +   E D++ +F+ +G I E T+++D+  G  KGCAF+ Y  R  A  A  A+H   T+PG +  + VK AD+E   + RKL
Sbjct:    8 KLFIGQIPRNLDEKDLKPIFEQFGKIYELTVIKDKFTGMHKGCAFLTYCARESALKAQSALHEQKTLPGMNRPIQVKPADSESRGEDRKL 97          
BLAST of Trinucleotide repeat containing 4-like protein vs. UniProt/SwissProt
Match: sp|Q9IBD1|CELF3_DANRE (CUGBP Elav-like family member 3 OS=Danio rerio OX=7955 GN=celf3 PE=2 SV=2)

HSP 1 Score: 286.96 bits (733), Expect = 1.343e-89
Identity = 188/427 (44.03%), Postives = 242/427 (56.67%), Query Frame = 2
Query:  407 KQAQHKGE-DRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGGSAYSQYLENLQQNTGYINPIATLAXXXXXXXXXXXXIALGATLPYTLSTGIPTNDANASQNFLGVNP--LAAAVAASQNLTTQSLLSPSTAASMM--MPNNSGMNTMCQVQQQTPIISSATQMNDPSVNISHTQMSNGQTRPQNLTPFSLAAATGANWLASNSTTLPAMYGGLNLCGLA-PYNPPTLNPITLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            K A  +G  DRKLF+GMLGKQ ++ DVR +F+P+G+IEECT+LR  +G SKGCAFVKY + +EA  AI A+HGS T+PGASSSLVVKFADTEKER  R++QQ  +  G+I+P     +L   AY+ Y + L Q    +   A L                         + + T  A   Q    +NP  + A   AS   ++ +   P+ AA+ +  +P    +N+        P + +A      S  +    +   Q +   L P   A     ++ A    T PA YG   L G   P+ P      TL+A+Q    Q  Q+         GP+G N+FIYHLPQEF D+E+ QMF PFG VISAKV++DRATNQSKCFGFVSFDN  SAQAAIQAMNGFQIGMKRLKVQLKRPK  D  +PY
Sbjct:   84 KPADSEGRGDRKLFVGMLGKQLSDADVRKMFEPFGSIEECTVLRGPDGASKGCAFVKYQSNAEAQAAISALHGSRTLPGASSSLVVKFADTEKERGIRRMQQVASQLGVISP----MSLHLGAYNAYTQALVQQQALVAQSAYL-------------------------SPVATVAAVQMQQLAALNPSSIIATPIASITPSSGTSTPPTIAATPVPALPPPIAVNSY-------PPVPAAPNGQSASEALYTNGVHPYQAQSPALDPLQQAYTGMQHYTA----TYPAAYG---LVGQPFPHQP------TLVAQQPQQPQQLQQR-------EGPEGCNIFIYHLPQEFTDSEMLQMFLPFGNVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK--DANRPY 452          

HSP 2 Score: 72.7886 bits (177), Expect = 2.603e-12
Identity = 47/140 (33.57%), Postives = 69/140 (49.29%), Query Frame = 2
Query:  437 KLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQ-NGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKL--------------QQFINPFGLINPGLTLS----ALGGSAYSQYLENLQ 799
            KLFIG + +   E D++ +F+ +G I E T+++D+  G  KGCAF+ Y  R  A  A  A+H   T+PG +  + VK AD+E  R  RKL              ++   PFG I     L     A  G A+ +Y  N +
Sbjct:    8 KLFIGQIPRNLEEKDLKPIFEQFGKIYELTVIKDKYTGMHKGCAFLTYCARESALKAQNALHEQKTLPGMNRPIQVKPADSEG-RGDRKLFVGMLGKQLSDADVRKMFEPFGSIEECTVLRGPDGASKGCAFVKYQSNAE 146          
BLAST of Trinucleotide repeat containing 4-like protein vs. TrEMBL
Match: D5JG66 (Trinucleotide repeat containing 4-like protein OS=Dugesia japonica OX=6161 GN=TNRC-4 PE=2 SV=1)

HSP 1 Score: 837.025 bits (2161), Expect = 0.000e+0
Identity = 415/460 (90.22%), Postives = 437/460 (95.00%), Query Frame = 2
Query:  290 MIFQKETEQSTFTETHIDDCFENKDEKKPATNNSNCKMSKQAQHKGEDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGGSAYSQYLENLQQNTGYINPIATLAXXXXXXXXXXXXIALGATLPYTLSTGIPTNDANASQNFLGVNPLAAAVAASQNLTTQSLLSPSTAASMMMPNNSGMNTMCQVQQQTPIISSATQMNDPSVNISHTQMSNGQTRPQNLTPFSLAAATGANWLASNSTTLPAMYGGLNLCGLAPYNPPTLNPITLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            MIFQKETEQ++F ETH+DDCFE+KDEKK   NN++ K+ KQ QHKGEDRKLFIGMLGKQHTEDDVRD+FKP+G IEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGGSAYSQY+ENLQQNTGYINPIATLALQLQQQLQQQQQI LGATLPY+LSTGI ++D NASQNFLGVN LAAAVAASQNLTTQSLLSPSTA S+MMPNNSGMNTMCQ+Q QT +++SAT +NDPSVNI++T +SNGQTR QNLTPFSLAAATG NWL SN T LP MYGGLNLCGLAPYNPPTLNPITLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY
Sbjct:    1 MIFQKETEQASFAETHVDDCFESKDEKKHTNNNNSGKLGKQTQHKGEDRKLFIGMLGKQHTEDDVRDMFKPFGMIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGGSAYSQYIENLQQNTGYINPIATLALQLQQQLQQQQQITLGATLPYSLSTGISSSDVNASQNFLGVNSLAAAVAASQNLTTQSLLSPSTATSIMMPNNSGMNTMCQLQPQTSVMTSATGINDPSVNITNTPISNGQTRAQNLTPFSLAAATGPNWLTSNPTALPQMYGGLNLCGLAPYNPPTLNPITLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 460          
BLAST of Trinucleotide repeat containing 4-like protein vs. TrEMBL
Match: A0A267ES24 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032096g1 PE=4 SV=1)

HSP 1 Score: 349.362 bits (895), Expect = 5.963e-111
Identity = 214/430 (49.77%), Postives = 268/430 (62.33%), Query Frame = 2
Query:  428 EDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGGSAYSQYLENLQQNTGYINPIATLAXXXXXXXXXXXXIALGATLPYTLSTGIPTNDANASQNFLGVNPLAAAVAASQNLTTQSLLSPSTAASMMMPNNSGMNTMCQVQQQTPIISSATQMNDPSVNISHTQMSNGQTRPQNLTPFSLAAATGANWL-ASNSTTLPAMYGGLN-LCGLAPY--------------NPPTLNPITLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            +DRKLF+GML KQ +E+DVR LF+PYG IEECTILRDQNG SKGCAFVKY    EA +AI  +HGS T+PGASSS+VVKFAD EKERQ RKLQQ + P GLI+PGL  + + G          QQ++GYINP+A LA+QLQ            AT P T   G  T   N++      NP +       +LT+      +  A+++ P +SG   +   QQQ P+ S+A      +   +    +   +       ++  +   A ++  + +  L  MY  ++   G+A Y                    P   L +QA+SM VQ K+G+K+FILTGPDG N+FIYHLPQEFGD ELAQMF+PFGTVISAKVY+DRATNQSKCFGFVSFDNS +A AAIQAMNGFQIGMKRLKVQLKRPKG   G+PY
Sbjct:   76 DDRKLFVGMLSKQQSEEDVRRLFEPYGQIEECTILRDQNGASKGCAFVKYGNHLEAQSAINNLHGSQTMPGASSSIVVKFADNEKERQLRKLQQMVGPLGLISPGL--AGVAGQLNPVATPFPQQSSGYINPVAALAIQLQS-----------ATGPQTGGLGGLTPALNSTV----ANPGSGCGGGHTSLTS------AAQATVLSPVSSGAGGL---QQQQPLSSAAAAAAAVNGAAAAAAAAAAASADTAAALYAATSGMPAQYINGAGTDPLHQMYSTVHPYSGIAAYPADPTATYPAAAAAAAYAAAPFMSLTQQAMSMPVQHKDGSKEFILTGPDGCNLFIYHLPQEFGDCELAQMFAPFGTVISAKVYVDRATNQSKCFGFVSFDNSAAAAAAIQAMNGFQIGMKRLKVQLKRPKG--EGRPY 477          
BLAST of Trinucleotide repeat containing 4-like protein vs. TrEMBL
Match: A0A267DS20 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig008724g1 PE=4 SV=1)

HSP 1 Score: 347.436 bits (890), Expect = 4.179e-110
Identity = 213/430 (49.53%), Postives = 267/430 (62.09%), Query Frame = 2
Query:  428 EDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGGSAYSQYLENLQQNTGYINPIATLAXXXXXXXXXXXXIALGATLPYTLSTGIPTNDANASQNFLGVNPLAAAVAASQNLTTQSLLSPSTAASMMMPNNSGMNTMCQVQQQTPIISSATQMNDPSVNISHTQMSNGQTRPQNLTPFSLAAATGANWL-ASNSTTLPAMYGGLN-LCGLAPY--------------NPPTLNPITLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            +DRKLF+GML KQ +E+DVR LF+PYG IEECTILRDQNG SKGCAFVKY    EA +AI  +HGS T+PGASSS+VVKFAD E ERQ RKLQQ + P GLI+PGL  + + G          QQ++GYINP+A LA+QLQ            AT P T   G  T   N++      NP +       +LT+      +  A+++ P +SG   +   QQQ P+ S+A      +   +    +   +       ++  +   A ++  + +  L  MY  ++   G+A Y                    P   L +QA+SM VQ K+G+K+FILTGPDG N+FIYHLPQEFGD ELAQMF+PFGTVISAKVY+DRATNQSKCFGFVSFDNS +A AAIQAMNGFQIGMKRLKVQLKRPKG   G+PY
Sbjct:   77 DDRKLFVGMLSKQQSEEDVRRLFEPYGQIEECTILRDQNGASKGCAFVKYGNHLEAQSAINNLHGSQTMPGASSSIVVKFADNENERQLRKLQQMVGPLGLISPGL--AGVAGQLNPVATPFPQQSSGYINPVAALAIQLQS-----------ATGPQTGGLGGLTPALNSTV----ANPGSGCGGGHTSLTS------AAQATVLSPVSSGAGGL---QQQQPLSSAAAAAAAVNGAAAAAAAAAAASADTAAALYAATSGMPAQYINGAGTDPLHQMYSTVHPYSGIAAYPADPTATYPAAAAAAAYAAAPFMSLTQQAMSMPVQHKDGSKEFILTGPDGCNLFIYHLPQEFGDCELAQMFAPFGTVISAKVYVDRATNQSKCFGFVSFDNSAAAAAAIQAMNGFQIGMKRLKVQLKRPKG--EGRPY 478          
BLAST of Trinucleotide repeat containing 4-like protein vs. TrEMBL
Match: A0A267GPB9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032096g2 PE=4 SV=1)

HSP 1 Score: 333.954 bits (855), Expect = 4.437e-106
Identity = 208/422 (49.29%), Postives = 260/422 (61.61%), Query Frame = 2
Query:  452 MLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGGSAYSQYLENLQQNTGYINPIATLAXXXXXXXXXXXXIALGATLPYTLSTGIPTNDANASQNFLGVNPLAAAVAASQNLTTQSLLSPSTAASMMMPNNSGMNTMCQVQQQTPIISSATQMNDPSVNISHTQMSNGQTRPQNLTPFSLAAATGANWL-ASNSTTLPAMYGGLN-LCGLAPY--------------NPPTLNPITLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            ML KQ +E+DVR LF+PYG IEECTILRDQNG SKGCAFVKY    EA +AI  +HGS T+PGASSS+VVKFAD EKERQ RKLQQ + P GLI+PGL  + + G          QQ++GYINP+A LA+QLQ            AT P T   G  T   N++      NP +       +LT+      +  A+++ P +SG   +   QQQ P+ S+A      +   +    +   +       ++  +   A ++  + +  L  MY  ++   G+A Y                    P   L +QA+SM VQ K+G+K+FILTGPDG N+FIYHLPQEFGD ELAQMF+PFGTVISAKVY+DRATNQSKCFGFVSFDNS +A AAIQAMNGFQIGMKRLKVQLKRPKG   G+PY
Sbjct:    1 MLSKQQSEEDVRRLFEPYGQIEECTILRDQNGASKGCAFVKYGNHLEAQSAINNLHGSQTMPGASSSIVVKFADNEKERQLRKLQQMVGPLGLISPGL--AGVAGQLNPVATPFPQQSSGYINPVAALAIQLQS-----------ATGPQTGGLGGLTPALNSTV----ANPGSGCGGGHTSLTS------AAQATVLSPVSSGAGGL---QQQQPLSSAAAAAAAVNGAAAAAAAAAAASADTAAALYAATSGMPAQYINGAGTDPLHQMYSTVHPYSGIAAYPADPTATYPAAAAAAAYAAAPFMSLTQQAMSMPVQHKDGSKEFILTGPDGCNLFIYHLPQEFGDCELAQMFAPFGTVISAKVYVDRATNQSKCFGFVSFDNSAAAAAAIQAMNGFQIGMKRLKVQLKRPKG--EGRPY 394          
BLAST of Trinucleotide repeat containing 4-like protein vs. TrEMBL
Match: A0A1S3PCG6 (CUGBP Elav-like family member 5 isoform X11 OS=Salmo salar OX=8030 GN=LOC106584443 PE=4 SV=1)

HSP 1 Score: 317.39 bits (812), Expect = 8.846e-98
Identity = 200/435 (45.98%), Postives = 250/435 (57.47%), Query Frame = 2
Query:  413 AQHKGEDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGGSAYSQYLENLQQ---------NTGYINPIATLAXXXXXXXXXXXXIALGAT----LPYTLSTGIPTNDANASQNFLGVNPLAAAVAASQNLTTQSLLSPSTAASMMMPNNSGMNTMCQVQQQTPIISSATQMN-DPSVNISHTQMSNGQTRPQNLTPFSLAAATGANWLASNSTTLPAMYGGLNLCGLAPYNPPTLNPI--TLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            ++ +GEDRKLF+GML KQ TE+DV  LF+PYG IEECT+LR  +GNSKGCAFVK++T +EA +AI A+HGS T+PGASSSLVVKFADT+KER  R++QQ +  FG+ NP +   AL  S YS Y   L Q         + GY+ P          Q        +GA     LP+   T +      A        PL    +   N+TT S+++P       +P++                    Q N  P+V    T  +NG      L+P+S  + T A+ L    T +   Y  +   G       TL PI  TL     +  Q QQ+EG       GP+G N+FIYHLPQEFGD EL QMF PFG+VIS+KV++DRATNQSKCFGFVSFDN  SAQAAIQAMNGFQIGMKRLKVQLKRPK  D  +PY
Sbjct:  159 SESRGEDRKLFVGMLNKQQTEEDVYRLFEPYGVIEECTVLRGPDGNSKGCAFVKFSTHAEAQSAISALHGSQTMPGASSSLVVKFADTDKERTIRRMQQMVGQFGIFNPAI---ALPFSTYSTYAHALMQQQAAIMAASHGGYLTPSVAFPATQIHQ--------MGALNINGLPHNSMTPVSAEFHQALGEHCVSFPLPGLSSPPANITTPSIVTPIVNGFTGIPHH--------------------QPNGHPAVE---TMYTNG------LSPYSTQSPTAADTLQQAFTGV-QQYTAIYPAG-------TLTPIGQTLPQPSQVIQQQQQREG------EGPEGCNLFIYHLPQEFGDNELMQMFLPFGSVISSKVFMDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK--DASRPY 537          

HSP 2 Score: 77.7962 bits (190), Expect = 2.584e-11
Identity = 38/90 (42.22%), Postives = 54/90 (60.00%), Query Frame = 2
Query:  437 KLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQ-NGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKL 703
            KLFIG + +   E D++ LF+ +G I E T+L+D+  G  KGCAF+ Y  R  A  A  A+H   T+PG +  + VK AD+E   + RKL
Sbjct:   79 KLFIGQIPRNLEEKDLKPLFEQFGKIHELTVLKDRYTGMHKGCAFLTYCARESAIKAQNALHEQKTLPGMTRPIQVKPADSESRGEDRKL 168          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Cavefish
Match: celf3b (cugbp, Elav-like family member 3b [Source:ZFIN;Acc:ZDB-GENE-110408-50])

HSP 1 Score: 289.271 bits (739), Expect = 1.934e-92
Identity = 188/432 (43.52%), Postives = 240/432 (55.56%), Query Frame = 2
Query:  422 KGEDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGGSAYSQYLENLQQ----NTGYINP---IATLAXXXXXXXXXXXXIALGATLPYTLSTGIPTNDANASQNFLGVNPLAAAVAASQNLTTQSLLSPSTAASMMMPNNSGMNTMCQVQQQTPIISSATQMNDPSVNISHTQMSNGQTRPQNLTPFSLAAATGA--------NWLASNSTTLPAMYGGLNLCGLAPY-NPPTLNPITLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            +GEDRKLF+GMLGKQ  +DDVR +F+ +G I+ECTILR  +G SKGCAFVK+ + +EA  AI ++HGS T+PGASSSLVVKFADTEKER  R++QQ  +   + +P +TL+    +AY+Q L   QQ     + Y++P   +AT+ +Q    L     IA   T P T S+G  T  +      +   P+ A             L P  A +   P  +  N                       + S T  +NG      + PF   +A             +   +   PA YG ++    +P+   PTL P           Q QQ+EG        P+G N+FIYHLPQEF D+EL QMF PFG VISAKV++DRATNQSKCFGFVSFDN  SAQ AIQAMNGFQIGMKRLKVQLKRPK  D  +PY
Sbjct:   15 RGEDRKLFVGMLGKQQEDDDVRKMFELFGRIDECTILRAPDGTSKGCAFVKFQSHAEAQAAINSLHGSRTLPGASSSLVVKFADTEKERGLRRMQQVASQLSVFSP-MTLNLGAYNAYAQALVQQQQTLVAQSAYLSPIATVATVQMQQMAALNANGIIATPIT-PITPSSGTNTPPS------IAATPVPA-------------LPPPIALNGYSPVPTAANGQ---------------------SASETIYTNG------IHPFQAQSAVAVLDPLQQAYTGMQHYTAAYPAAYGLVS----SPFPQQPTLVP----------QQQQQREG--------PEGCNIFIYHLPQEFTDSELLQMFVPFGNVISAKVFVDRATNQSKCFGFVSFDNPTSAQTAIQAMNGFQIGMKRLKVQLKRPK--DANRPY 374          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000034315.1 (pep primary_assembly:Astyanax_mexicanus-2.0:5:21901697:21908852:1 gene:ENSAMXG00000034719.1 transcript:ENSAMXT00000034315.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 162.155 bits (409), Expect = 2.816e-47
Identity = 76/92 (82.61%), Postives = 82/92 (89.13%), Query Frame = 2
Query: 1394 GPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            GP+G N+FIYHLPQEFGD EL QMF PFGTVIS+KV++DRATNQSKCFGFVSFDN  SAQAAIQAMNGFQIGMKRLKVQLKRPK  D  +PY
Sbjct:   35 GPEGCNLFIYHLPQEFGDNELMQMFLPFGTVISSKVFMDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK--DASRPY 124          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000012369.2 (CUGBP Elav-like family member 5 [Source:NCBI gene;Acc:103039850])

HSP 1 Score: 167.933 bits (424), Expect = 6.157e-45
Identity = 72/113 (63.72%), Postives = 93/113 (82.30%), Query Frame = 2
Query:  413 AQHKGEDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTL 751
            ++ +GEDRKLF+GML KQ TE+DV  +F+PYG IEECT+LR  +GNSKGCAFVK++T +EA +AIG +HGS T+PGASSSLVVKFADT+KER  R++QQ +  FG+ NP + L
Sbjct:  191 SESRGEDRKLFVGMLNKQQTEEDVYRIFEPYGVIEECTVLRGPDGNSKGCAFVKFSTHTEAQSAIGGLHGSQTMPGASSSLVVKFADTDKERTIRRMQQMVGQFGIFNPAVAL 303          

HSP 2 Score: 160.999 bits (406), Expect = 1.806e-42
Identity = 74/92 (80.43%), Postives = 81/92 (88.04%), Query Frame = 2
Query: 1394 GPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            GP+G N+FIYHLPQEFGD EL QMF PFG+VIS+KV++DRATNQSKCFGFVSFDN  SA AAIQAMNGFQIGMKRLKVQLKRPK  D  +PY
Sbjct:  467 GPEGCNLFIYHLPQEFGDNELMQMFLPFGSVISSKVFMDRATNQSKCFGFVSFDNPASAHAAIQAMNGFQIGMKRLKVQLKRPK--DASRPY 556          

HSP 3 Score: 78.1814 bits (191), Expect = 8.963e-15
Identity = 38/90 (42.22%), Postives = 54/90 (60.00%), Query Frame = 2
Query:  437 KLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQ-NGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKL 703
            KLFIG + +   E D++ LF+ +G I E T+L+D+  G  KGCAF+ Y  R  A  A  A+H   T+PG +  + VK AD+E   + RKL
Sbjct:  111 KLFIGQIPRNLEEKDLKPLFEQFGKIHELTVLKDRYTGMHKGCAFLTYCARESAIKAQNALHEQKTLPGMTRPIQVKPADSESRGEDRKL 200          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Cavefish
Match: celf3a (cugbp, Elav-like family member 3a [Source:NCBI gene;Acc:57922])

HSP 1 Score: 163.696 bits (413), Expect = 7.553e-45
Identity = 81/148 (54.73%), Postives = 110/148 (74.32%), Query Frame = 2
Query:  407 KQAQHKGE-DRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGGSAYSQYL---ENLQQNTGYINPIATLA 838
            K A  +G  DRKLF+GMLGKQ ++ DVR +F+P+G+IEECT+LR  +G SKGCAFVKY + +EA  AI A+HGS T+PGASSSLVVKFADTEKER  R++QQ  +  G+I+P ++L     +AY+Q L   + L   + Y++P+AT+A
Sbjct:    8 KPADSEGRGDRKLFVGMLGKQQSDADVRKMFEPFGSIEECTVLRGPDGVSKGCAFVKYQSNAEAQAAISALHGSRTLPGASSSLVVKFADTEKERGIRRMQQVASQLGVISP-MSLHLGAYNAYTQALVQQQALVAQSAYLSPVATVA 154          

HSP 2 Score: 160.614 bits (405), Expect = 1.120e-43
Identity = 73/92 (79.35%), Postives = 80/92 (86.96%), Query Frame = 2
Query: 1394 GPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            GP+G N+FIYHLPQEF D+E+ QMF PFG VISAKV++DRATNQSKCFGFVSFDN  SAQ AIQAMNGFQIGMKRLKVQLKRPK  D  +PY
Sbjct:  287 GPEGCNIFIYHLPQEFTDSEMLQMFLPFGNVISAKVFVDRATNQSKCFGFVSFDNPASAQTAIQAMNGFQIGMKRLKVQLKRPK--DANRPY 376          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Cavefish
Match: si:dkey-205h23.2 (si:dkey-205h23.2 [Source:ZFIN;Acc:ZDB-GENE-120215-101])

HSP 1 Score: 163.696 bits (413), Expect = 6.619e-44
Identity = 76/91 (83.52%), Postives = 82/91 (90.11%), Query Frame = 2
Query: 1397 PDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            P+G N+FIYHLPQEFGDAEL QMF PFG VISAKV++DRATNQSKCFGFVSFDN +SAQAAIQAMNGFQIGMKRLKVQLKRPK  D  +PY
Sbjct:  399 PEGCNLFIYHLPQEFGDAELMQMFLPFGNVISAKVFVDRATNQSKCFGFVSFDNPSSAQAAIQAMNGFQIGMKRLKVQLKRPK--DANRPY 487          

HSP 2 Score: 147.517 bits (371), Expect = 4.317e-38
Identity = 72/142 (50.70%), Postives = 97/142 (68.31%), Query Frame = 2
Query:  422 KGEDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGGSAYSQYLENLQQNTG--------YINP 823
            +GEDRKLF+GMLGKQ +E+DVR LF+ +G IEECT+LR  +G SKGCAFVK+++ +EA  AI  +HG  T+PGASSSLVVKFADT+KER  R++ Q     G+ +P +T+      AY+  +  +QQ           Y+NP
Sbjct:  137 RGEDRKLFVGMLGKQQSEEDVRRLFEAFGQIEECTVLRGPDGASKGCAFVKFSSHAEAQAAINTLHGGQTMPGASSSLVVKFADTDKERTMRRMHQMAGQLGIFSP-MTIQFGAYGAYTHAM--MQQQAALMAASQGSYLNP 275          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008846.1 (pep scaffold:Pmarinus_7.0:GL480623:147895:156346:1 gene:ENSPMAG00000008007.1 transcript:ENSPMAT00000008846.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 142.124 bits (357), Expect = 4.824e-41
Identity = 66/92 (71.74%), Postives = 78/92 (84.78%), Query Frame = 2
Query: 1394 GPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            GP+G+N+FIYHLPQEFGD +L Q F PFG+V+S+KV++D+ TN SKCFGFVS+DN  SAQAAIQAMNGFQIG KRLKVQLKR K  +  KPY
Sbjct:    1 GPEGANLFIYHLPQEFGDQDLMQTFMPFGSVVSSKVFVDKQTNLSKCFGFVSYDNPISAQAAIQAMNGFQIGTKRLKVQLKRSK--NDSKPY 90          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002852.1 (pep scaffold:Pmarinus_7.0:GL477021:232626:260651:-1 gene:ENSPMAG00000002591.1 transcript:ENSPMAT00000002852.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 111.309 bits (277), Expect = 9.554e-28
Identity = 49/94 (52.13%), Postives = 71/94 (75.53%), Query Frame = 2
Query:  428 EDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQ 709
            E+RKLFIGM+ K+ +E+D+R +F P+G +EEC +LR  +G SKGCAF+ YT R+ A  AI  MH S T+ G ++ L VKFADT+K+++ ++LQQ
Sbjct:  142 EERKLFIGMISKKCSENDIRAMFSPFGQMEECRVLRGPDGQSKGCAFITYTARAMAQNAIKGMHQSQTMEGCAAPL-VKFADTQKDKEQKRLQQ 234          

HSP 2 Score: 62.003 bits (149), Expect = 5.412e-11
Identity = 33/94 (35.11%), Postives = 52/94 (55.32%), Query Frame = 2
Query:  437 KLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGN---SKGCAFVKYTTRSEAYTAIGAMHGSMTIPG--ASSSLVVKFADTEKERQTRKL 703
            K+F+G + +  +E ++RDLF+ +G + E  I+RD+      S+GC FV + TR  A  A  A+H   T+PG  A + LV     +    + RKL
Sbjct:   53 KMFVGQIPRSWSEKELRDLFEQFGPVYEINIVRDRTQKPPQSRGCCFVTFYTRKAALEAQNALHNIKTLPGLHAPTELVPSTTSSSSSLEERKL 146          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007375.1 (pep scaffold:Pmarinus_7.0:GL478911:2009:38506:1 gene:ENSPMAG00000006638.1 transcript:ENSPMAT00000007375.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.8853 bits (211), Expect = 3.328e-18
Identity = 49/118 (41.53%), Postives = 67/118 (56.78%), Query Frame = 2
Query:  365 EKKPATNNSNCKMSKQAQHKGEDRKLFIGMLGKQHTEDDVRDLFKPY------GAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRK 700
            + KPA +  +  M        E+RKLFIGML KQ +E DVR +F P+      G     T+L       K C F+ + TR  A  AI +MH S T+ G SS++VVKFADT+K+++ RK
Sbjct:   94 QMKPADSEKSSGM--------EERKLFIGMLSKQLSEADVRVIFSPFVGENPLGGAPLDTVL-------KWCGFITFATRMMAQNAIKSMHHSQTMEGCSSAVVVKFADTQKDKEQRK 196          

HSP 2 Score: 71.633 bits (174), Expect = 1.141e-13
Identity = 34/97 (35.05%), Postives = 55/97 (56.70%), Query Frame = 2
Query:  437 KLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQN---GNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFIN 718
            K+F+G + +   E ++R+LF+ +GA+ E  +LRD+      S+GC FV Y TR  A  A  ++H   T+PG    + +K AD+EK     + + FI 
Sbjct:   18 KMFVGQIPRSWGESELRELFEQFGAVHEVNVLRDRTQTPAVSRGCCFVTYCTRKAALEAQSSLHNIKTLPGMYHPIQMKPADSEKSSGMEERKLFIG 114          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007448.1 (pep scaffold:Pmarinus_7.0:GL479027:131562:138944:-1 gene:ENSPMAG00000006727.1 transcript:ENSPMAT00000007448.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.7734 bits (151), Expect = 3.174e-12
Identity = 27/73 (36.99%), Postives = 44/73 (60.27%), Query Frame = 2
Query: 1406 SNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMN--GFQIGMKR 1618
            +N++I  LP    D +L ++  P+G ++S K  +D+ TNQ K +GFV FD+  +AQ A+ A+   G Q  M +
Sbjct:   55 TNLYIRGLPPHTSDQDLVKLCHPYGKIVSTKAILDKTTNQCKGYGFVDFDSPTAAQKAVTALKATGIQAQMAK 127          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008168.1 (pep scaffold:Pmarinus_7.0:GL476829:41182:80090:-1 gene:ENSPMAG00000007358.1 transcript:ENSPMAT00000008168.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.2326 bits (147), Expect = 2.744e-10
Identity = 28/79 (35.44%), Postives = 46/79 (58.23%), Query Frame = 2
Query: 1406 SNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRP 1642
            +N++I  LP    D +L ++  P+G ++S K  +D+ TNQ K +GFV FD  ++AQ A+ A+    I  +  K Q + P
Sbjct:   35 TNLYIRGLPPGTTDQDLVKLCQPYGKIVSTKAILDKTTNQCKGYGFVDFDGPSAAQKAVTALKASGIQAQMAKQQEQDP 113          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Yeast
Match: NAM8 (RNA binding protein, component of the U1 snRNP protein; mutants are defective in meiotic recombination and in formation of viable spores, involved in the formation of DSBs through meiosis-specific splicing of REC107 pre-mRNA; Nam8p regulon embraces the meiotic pre-mRNAs of REC107, HFM1, AMA1 SPO22 and PCH2; the putative RNA binding domains RRM2 and RRM3 are required for Nam8p meiotic function [Source:SGD;Acc:S000001128])

HSP 1 Score: 57.3806 bits (137), Expect = 3.425e-9
Identity = 34/95 (35.79%), Postives = 48/95 (50.53%), Query Frame = 2
Query: 1355 VQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKR 1639
            VQQ+     F  T P+ + VFI  L     + EL   F PFGT++  K+ +       KC GFV + +  SA+AAI  M GF I   R+++   R
Sbjct:  298 VQQQPSLNHF--TDPNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPV------GKCCGFVQYVDRLSAEAAIAGMQGFPIANSRVRLSWGR 384          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Yeast
Match: NSR1 (Nucleolar protein that binds nuclear localization sequences; required for pre-rRNA processing and ribosome biogenesis; binds to single stranded telomeric DNA and mRNA; methylated by Hmt1p; interaction with Top1p and nucleolar localization are negatively regulated by polyphosphorylation [Source:SGD;Acc:S000003391])

HSP 1 Score: 55.8398 bits (133), Expect = 8.177e-9
Identity = 24/65 (36.92%), Postives = 38/65 (58.46%), Query Frame = 2
Query: 1412 VFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQI 1606
            +F+  L     D  L + F   G VI A+V  +R T++S+ +G+V F+N + A+ AIQ M G +I
Sbjct:  170 IFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQEMQGKEI 234          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Yeast
Match: HRP1 (Subunit of cleavage factor I; cleavage factor I is a five-subunit complex required for the cleavage and polyadenylation of pre-mRNA 3' ends; RRM-containing heteronuclear RNA binding protein and hnRNPA/B family member that binds to poly (A) signal sequences; required for genome stability [Source:SGD;Acc:S000005483])

HSP 1 Score: 53.1434 bits (126), Expect = 6.996e-8
Identity = 35/110 (31.82%), Postives = 59/110 (53.64%), Query Frame = 2
Query: 1310 LNPITLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKR 1639
            L+   +  ++A+    Q K G    I  G  G +V     P+EF      + FS +GT+I A++ +D+ T QS+ FGFV++D++++     Q  N F I  K  K+++KR
Sbjct:  223 LDGKVIDPKRAIPRDEQDKTGK---IFVGGIGPDV----RPKEF-----EEFFSQWGTIIDAQLMLDKDTGQSRGFGFVTYDSADAVDRVCQ--NKF-IDFKDRKIEIKR 317          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Yeast
Match: NOP15 (Constituent of 66S pre-ribosomal particles; involved in 60S ribosomal subunit biogenesis; localizes to both nucleolus and cytoplasm [Source:SGD;Acc:S000005054])

HSP 1 Score: 50.0618 bits (118), Expect = 2.336e-7
Identity = 25/86 (29.07%), Postives = 47/86 (54.65%), Query Frame = 2
Query: 1412 VFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            +++  LP  F + EL++ F+ FG +   ++  ++ T  S+ +GF+ F N   A  A ++MN + +    L+V++  PKG    K Y
Sbjct:   93 IYVSRLPHGFHEKELSKYFAQFGDLKEVRLARNKKTGNSRHYGFLEFVNKEDAMIAQESMNNYLLMGHLLQVRV-LPKGAKIEKLY 177          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Yeast
Match: IST3 (Component of the U2 snRNP; required for the first catalytic step of splicing and for spliceosomal assembly; interacts with Rds3p and is required for Mer1p-activated splicing; diploid mutants have a specific defect in MATa1 pre-mRNA splicing which leads to haploid gene expression in diploids [Source:SGD;Acc:S000001444])

HSP 1 Score: 48.1358 bits (113), Expect = 3.675e-7
Identity = 23/84 (27.38%), Postives = 47/84 (55.95%), Query Frame = 2
Query: 1400 DGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQ--LKRPK 1645
            D + ++I +L +E  + ++  +FS +G  +   +  D  T +S+ F ++ +++  S   A+  +NGF+IG + LK+     RPK
Sbjct:   29 DNAYIYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILAVDNLNGFKIGGRALKIDHTFYRPK 112          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Nematostella
Match: EDO29519 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T3E7])

HSP 1 Score: 150.599 bits (379), Expect = 5.981e-43
Identity = 71/92 (77.17%), Postives = 77/92 (83.70%), Query Frame = 2
Query: 1394 GPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            GPDGSN+FIYHLPQEF DA+L Q F PFGTVISAKV+ID+ TN SKCFGFVS+DN  SAQ AIQ MNGFQIG KRLKVQLKRPK  D  +PY
Sbjct:   70 GPDGSNLFIYHLPQEFTDADLMQTFQPFGTVISAKVFIDKQTNMSKCFGFVSYDNVMSAQNAIQHMNGFQIGAKRLKVQLKRPK--DANRPY 159          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Nematostella
Match: EDO35559 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL64])

HSP 1 Score: 151.754 bits (382), Expect = 8.608e-41
Identity = 71/92 (77.17%), Postives = 77/92 (83.70%), Query Frame = 2
Query: 1394 GPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            GPDGSN+FIYHLPQEF DA+L Q F PFGTVISAKV+ID+ TN SKCFGFVS+DN  SAQ AIQ MNGFQIG KRLKVQLKRPK  D  +PY
Sbjct:  294 GPDGSNLFIYHLPQEFTDADLMQTFQPFGTVISAKVFIDKQTNMSKCFGFVSYDNVMSAQNAIQHMNGFQIGAKRLKVQLKRPK--DANRPY 383          

HSP 2 Score: 86.2705 bits (212), Expect = 3.064e-18
Identity = 35/69 (50.72%), Postives = 49/69 (71.01%), Query Frame = 2
Query:  428 EDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTI 634
            +DRKLF+GM+ K   E+D+R +F P+G IEE T+LR+ +  SKGCAF+K+  R +A  AI  MH S T+
Sbjct:   83 DDRKLFVGMISKHAKEEDLRVMFSPFGTIEELTVLRNADSTSKGCAFIKFANRMQAQNAIATMHNSTTM 151          

HSP 3 Score: 53.9138 bits (128), Expect = 9.040e-8
Identity = 41/141 (29.08%), Postives = 62/141 (43.97%), Query Frame = 2
Query:  437 KLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGA----MHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTL----SALGGSAYSQYLENLQQNTGYINPIATL 835
            KLF+G + +   E D+R +F+PYG I E TIL+D           KYT + + + A  A    +H   T+PG     +       K  +   L+   +PFG I     L    S   G A+ ++   +Q      N IAT+
Sbjct:   21 KLFVGQVPRTWEEKDLRPIFEPYGQIYELTILKD-----------KYTGQHKGWDACNAAQKHLHEKKTLPGMDDRKLF-VGMISKHAKEEDLRVMFSPFGTIEELTVLRNADSTSKGCAFIKFANRMQAQ----NAIATM 145          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Nematostella
Match: EDO30576 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0E1])

HSP 1 Score: 152.525 bits (384), Expect = 1.808e-40
Identity = 81/132 (61.36%), Postives = 93/132 (70.45%), Query Frame = 2
Query: 1283 GLAPYNP--PTLNPITLLARQALSMQ-VQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            G+ PY+   PT+        QAL  Q  +Q +  +     GPDGSN+FIYHLPQEF DA+L Q F PFGTVISAKV+ID+ TN SKCFGFVS+DN  SAQ AIQ MNGFQIG KRLKVQLKRPK  D  +PY
Sbjct:  332 GIQPYSAAFPTV------YNQALYQQTARQPQKEESHYTPGPDGSNLFIYHLPQEFTDADLMQTFQPFGTVISAKVFIDKQTNMSKCFGFVSYDNVMSAQNAIQHMNGFQIGAKRLKVQLKRPK--DANRPY 455          

HSP 2 Score: 120.939 bits (302), Expect = 1.537e-29
Identity = 57/115 (49.57%), Postives = 76/115 (66.09%), Query Frame = 2
Query:  422 KGEDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFIN----PFGLINPGLTLS 754
            K +DRKLF+GM+ K   E+D+R +F P+G IEE T+LR+ +  SKGCAF+K+  R +A  AI  MH S T+ G SS LVVKFADTEKE+  +K+Q         FG  +PG  L+
Sbjct:  104 KSDDRKLFVGMISKHAKEEDLRVMFSPFGTIEELTVLRNADSTSKGCAFIKFANRMQAQNAIATMHNSTTMEGCSSPLVVKFADTEKEKLQKKMQHLAAFGGMAFGGASPGFPLA 218          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Nematostella
Match: EDO35562 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL69])

HSP 1 Score: 85.5001 bits (210), Expect = 9.448e-21
Identity = 35/68 (51.47%), Postives = 48/68 (70.59%), Query Frame = 2
Query:  431 DRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTI 634
            DRKLF+GM+ K   E+D+R +F P+G IEE T+LR+ +  SKGCAF+K+  R +A  AI  MH S T+
Sbjct:    1 DRKLFVGMISKHAKEEDLRVMFSPFGTIEELTVLRNADSTSKGCAFIKFANRMQAQNAIATMHNSTTM 68          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Nematostella
Match: EDO34879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN30])

HSP 1 Score: 67.781 bits (164), Expect = 2.843e-12
Identity = 34/84 (40.48%), Postives = 49/84 (58.33%), Query Frame = 2
Query:  440 LFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQ 691
            L+I  L K   E++V  LFKP+G I    +L+D +G  +G  FV++  R EA TAI  ++   T+PG +  L VKFA+    RQ
Sbjct:   98 LYISGLPKDMKEEEVEALFKPFGKIITSKVLKDVSGEGRGTGFVRFDKRCEAQTAIDDLNNK-TLPGTNVKLTVKFANPPNSRQ 180          

HSP 2 Score: 62.7734 bits (151), Expect = 1.175e-10
Identity = 30/84 (35.71%), Postives = 48/84 (57.14%), Query Frame = 2
Query: 1391 TGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRP 1642
            T  + +N+ I ++P      ++ ++F   G V S K+  DRAT QS  + FV++DN + A  A++ MNG ++  K LKV   RP
Sbjct:    5 TSDERTNLIINYVPPSMSQEDIKKIFGTVGNVTSCKLIRDRATGQSLGYAFVNYDNPDDANKAVREMNGARLQNKTLKVSFARP 88          

HSP 3 Score: 53.1434 bits (126), Expect = 1.548e-7
Identity = 29/83 (34.94%), Postives = 44/83 (53.01%), Query Frame = 2
Query: 1397 PDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPK 1645
            P G  +F+Y LPQE     L ++FSP+G + + ++ +D+       +GFV+  N   A  AI  +NG     K L+V  K PK
Sbjct:  252 PQGWCIFVYGLPQEATPLFLYKLFSPYGAITNIELKLDKG------YGFVNMSNYEEACHAICCLNGTPQHGKILQVSFKTPK 328          

HSP 4 Score: 51.2174 bits (121), Expect = 5.612e-7
Identity = 25/77 (32.47%), Postives = 44/77 (57.14%), Query Frame = 2
Query: 1406 SNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLK 1636
            +N++I  LP++  + E+  +F PFG +I++KV  D  + + +  GFV FD    AQ AI  +N   +    +K+ +K
Sbjct:   96 ANLYISGLPKDMKEEEVEALFKPFGKIITSKVLKD-VSGEGRGTGFVRFDKRCEAQTAIDDLNNKTLPGTNVKLTVK 171          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Medaka
Match: celf5b (CUGBP Elav-like family member 5 [Source:NCBI gene;Acc:101171069])

HSP 1 Score: 308.916 bits (790), Expect = 4.255e-98
Identity = 196/436 (44.95%), Postives = 252/436 (57.80%), Query Frame = 2
Query:  413 AQHKGEDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGGSAYSQYLENLQ------QNTGYINPIATLAXXXXXXXXXXXXIALGATL-----PYTLSTGIPTNDANASQNFLGVNPLAAAVAAS-QNLTTQSLLSPSTAASMMMPNNSGMNTMCQVQQQTPIISSATQM-----NDPSVNISHTQMSNGQTRPQNLTPFSLAAATGANWLASNSTTLPAMYGGLNLCGLAPYNPPTLNPITLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            ++ +GEDRKLF+GML KQ TE+DV  LF+PYG IEECT+LR  +GNSKGCAFVK++  +EA +AIGA+HGS T+PGASSSLVVKFADT+KER  R++QQ +  FG+ NP +   AL  S YS Y    Q       + GY+ P                 +A  AT      P  +++  PT           + P++A +++   N+TT ++  PS                      TPI++  T +       P+V   +T   NG      L P+S  +   A+ L        A  G      + P    TL PI+    QA  +  QQ++  ++    GP+G N+FIYHLPQEFGD EL QMF PFGTVIS+KV++DRATNQSKCFGFVSFDN  SAQAAIQAMNGFQIGMKRLKVQLKRPK  D  +PY
Sbjct:  158 SESRGEDRKLFVGMLNKQQTEEDVYRLFEPYGVIEECTVLRGPDGNSKGCAFVKFSAHTEAQSAIGALHGSQTMPGASSSLVVKFADTDKERTIRRMQQMVGQFGIFNPAI---ALPFSTYSSYAHAQQAAIMAASHGGYLTP----------------SVAFPATQIHQMGPLNINSLPPTP----------MTPVSAGLSSPPANITTSAV--PSIV--------------------TPIVNGFTGIPHQPNGHPAVETVYT---NG------LPPYSTQSPNAADTLQQ------AFTGVQQYTAIYPAT--TLTPISQTLPQAPQVIQQQQQQQRE----GPEGCNLFIYHLPQEFGDNELMQMFLPFGTVISSKVFMDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK--DASRPY 519          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Medaka
Match: celf5b (CUGBP Elav-like family member 5 [Source:NCBI gene;Acc:101171069])

HSP 1 Score: 304.294 bits (778), Expect = 5.747e-97
Identity = 194/433 (44.80%), Postives = 246/433 (56.81%), Query Frame = 2
Query:  428 EDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGGSAYSQYLENLQQ---------NTGYINPIATLAXXXXXXXXXXXXIALGATL-----PYTLSTGIPTNDANASQNFLGVNPLAAAVAASQNLTTQSLLSPSTAASMMMPNNSGMNTMCQVQQQTPIISSATQM-----NDPSVNISHTQMSNGQTRPQNLTPFSLAAATGANWLASNSTTLPAMYGGLNLCGLAPYNPPTLNPITLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            +DRKLF+GML KQ TE+DV  LF+PYG IEECT+LR  +GNSKGCAFVK++  +EA +AIGA+HGS T+PGASSSLVVKFADT+KER  R++QQ +  FG+ NP +   AL  S YS Y   L Q         + GY+ P                 +A  AT      P  +++  PT           + P++   +   N+TT ++  PS                      TPI++  T +       P+V   +T   NG      L P+S  +   A+ L        A  G      + P    TL PI+    QA  +  QQ++  ++    GP+G N+FIYHLPQEFGD EL QMF PFGTVIS+KV++DRATNQSKCFGFVSFDN  SAQAAIQAMNGFQIGMKRLKVQLKRPK  D  +PY
Sbjct:  118 KDRKLFVGMLNKQQTEEDVYRLFEPYGVIEECTVLRGPDGNSKGCAFVKFSAHTEAQSAIGALHGSQTMPGASSSLVVKFADTDKERTIRRMQQMVGQFGIFNPAI---ALPFSTYSSYAHALMQQQAAIMAASHGGYLTP----------------SVAFPATQIHQMGPLNINSLPPTP----------MTPVSGLSSPPANITTSAV--PSIV--------------------TPIVNGFTGIPHQPNGHPAVETVYT---NG------LPPYSTQSPNAADTLQQ------AFTGVQQYTAIYPAT--TLTPISQTLPQAPQVIQQQQQQQRE----GPEGCNLFIYHLPQEFGDNELMQMFLPFGTVISSKVFMDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK--DASRPY 476          

HSP 2 Score: 69.707 bits (169), Expect = 3.456e-12
Identity = 47/157 (29.94%), Postives = 74/157 (47.13%), Query Frame = 2
Query:  320 TFTETHIDDCFENKDEKKPATNNSN---CKMSKQAQHKGEDR-KLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQ-NGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRK-LQQFINPFGLINPGLTLSALGGSA 772
            T +E   D   +N     P   N +   C   +    K +D  KLFIG + +   E D++ LF+ +G I E T+L+D+  G  KGCAF+ Y  R  A  A  A+H   T+PG     +  F     ++QT + + +   P+G+I     L    G++
Sbjct:    5 TNSEFRFDLRHQNPQNPSPKPMNGSEPICIHPESGAMKDQDAIKLFIGQIPRNLEEKDLKPLFEQFGKIHELTVLKDRYTGMHKGCAFLTYCARESAIKAQNALHEQKTLPGVKDRKL--FVGMLNKQQTEEDVYRLFEPYGVIEECTVLRGPDGNS 159          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Medaka
Match: celf3b (CUGBP Elav-like family member 3 [Source:NCBI gene;Acc:101160192])

HSP 1 Score: 296.59 bits (758), Expect = 8.108e-94
Identity = 194/425 (45.65%), Postives = 246/425 (57.88%), Query Frame = 2
Query:  422 KGEDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGGSAYSQYL-------ENLQQNTGYINPIATLAXXXXXXXXXXXXIALGAT--LPYTLSTGIPTNDANASQNFLGVNPLAAAVAASQNLTTQSLLSPSTAASMMMPNNSGMNTMCQVQQQTPIISSATQMNDPSVNISHTQMSNGQTRPQNLTPFSLAAATGANWLASNSTTLPAMYGGLNLCGLAPYNPPTLNPITLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            +GEDRKLF+GMLGKQ T++DVR LF+P+G I+ECT+LR  +G SKGCAFVK+   +EA  AI ++HGS T+PGASSSLVVKFADTEKER  R++QQ  +  G+ +P +TL+    +AY+Q +       + L   + Y++P+AT+A    QQ+       + AT   P T S+G  T  A A+       P+ A                       +P   GMN    V    P  ++  Q      N  H   +     P  L P   A A   ++ A+     PA YG   L G      P     TL+A+Q    Q QQ+         GP+G N+FIYHLPQEF D+E+ QMF PFG VISAKV++DRATNQSKCFGFVSFDN  SAQAAIQAMNGFQIGMKRLKVQLKRPK  D  +PY
Sbjct:  124 RGEDRKLFVGMLGKQQTDEDVRRLFEPFGTIDECTVLRGPDGTSKGCAFVKFQGHAEAQAAINSLHGSRTMPGASSSLVVKFADTEKERGLRRMQQVASQLGIFSP-MTLNFPAYNAYTQAVNAQLVQHQALVAQSAYLSPVATVAAVQMQQMAALNANGIIATPITPITPSSGTNTPPAIAA------TPVPA-----------------------LPPPIGMNGYSSV----PAPTNGQQTETLYTNGVHQYQAQS---PAALDPLQQAYAGMQHYTAA----YPAAYG---LVGQ-----PFPQQQTLVAQQHQQPQQQQQR-------EGPEGCNIFIYHLPQEFSDSEMLQMFLPFGNVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK--DANRPY 490          

HSP 2 Score: 75.0998 bits (183), Expect = 5.633e-14
Identity = 41/127 (32.28%), Postives = 65/127 (51.18%), Query Frame = 2
Query:  437 KLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQ-NGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKL--------------QQFINPFGLINPGLTLSALGGSA 772
            KLF+G + +   E D++ +F+ +G I E T+++D+  G  KGCAF+ Y  R  A  A  A+H   T+PG +  + VK AD+E   + RKL              ++   PFG I+    L    G++
Sbjct:   41 KLFVGQIPRNLEEKDLKPIFEQFGKIYELTVIKDKYTGMHKGCAFLTYCARESALKAQSALHEQKTLPGMNRPIQVKPADSEGRGEDRKLFVGMLGKQQTDEDVRRLFEPFGTIDECTVLRGPDGTS 167          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Medaka
Match: si:dkey-205h23.2 (CUGBP Elav-like family member 6 [Source:NCBI gene;Acc:101171151])

HSP 1 Score: 166.392 bits (420), Expect = 7.996e-45
Identity = 77/92 (83.70%), Postives = 83/92 (90.22%), Query Frame = 2
Query: 1394 GPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            GP+G N+FIYHLPQEFGDAEL QMF PFG VISAKV++DRATNQSKCFGFVSFDN +SAQAAIQAMNGFQIGMKRLKVQLKRPK  D  +PY
Sbjct:  393 GPEGCNLFIYHLPQEFGDAELMQMFLPFGNVISAKVFVDRATNQSKCFGFVSFDNPSSAQAAIQAMNGFQIGMKRLKVQLKRPK--DANRPY 482          

HSP 2 Score: 150.984 bits (380), Expect = 2.791e-39
Identity = 68/127 (53.54%), Postives = 95/127 (74.80%), Query Frame = 2
Query:  413 AQHKGEDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINP-GLTLSALGGSAYSQYLE 790
            ++ +GEDRKLF+GMLGKQ +EDDVR LF+ +G IEECT+LR  +G SKGCAFVK+++ +EA  AI ++HG  T+PGASSSLVVKFADT+KER  R++ Q     G+ +P  +   A G  +++Q ++
Sbjct:  123 SEGRGEDRKLFVGMLGKQQSEDDVRRLFETFGQIEECTVLRGPDGASKGCAFVKFSSHAEAQAAINSLHGGQTMPGASSSLVVKFADTDKERTLRRMHQMAGQLGIFSPMTIQFGAYGTYSHAQMMQ 249          

HSP 3 Score: 75.8702 bits (185), Expect = 3.564e-14
Identity = 38/90 (42.22%), Postives = 54/90 (60.00%), Query Frame = 2
Query:  437 KLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQ-NGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKL 703
            KLFIG + +   E D++ LF+ +G I E T+L+D+  G  KGCAF+ Y  R  A  A  A+H   T+PG +  + VK AD+E   + RKL
Sbjct:   43 KLFIGQIPRNLEEKDLKPLFEEFGKIYELTVLKDRFTGMHKGCAFLTYCARESALKAQSALHEQKTLPGMNRPIQVKPADSEGRGEDRKL 132          
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Medaka
Match: si:dkey-205h23.2 (CUGBP Elav-like family member 6 [Source:NCBI gene;Acc:101171151])

HSP 1 Score: 166.392 bits (420), Expect = 7.996e-45
Identity = 77/92 (83.70%), Postives = 83/92 (90.22%), Query Frame = 2
Query: 1394 GPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            GP+G N+FIYHLPQEFGDAEL QMF PFG VISAKV++DRATNQSKCFGFVSFDN +SAQAAIQAMNGFQIGMKRLKVQLKRPK  D  +PY
Sbjct:  393 GPEGCNLFIYHLPQEFGDAELMQMFLPFGNVISAKVFVDRATNQSKCFGFVSFDNPSSAQAAIQAMNGFQIGMKRLKVQLKRPK--DANRPY 482          

HSP 2 Score: 150.984 bits (380), Expect = 2.791e-39
Identity = 68/127 (53.54%), Postives = 95/127 (74.80%), Query Frame = 2
Query:  413 AQHKGEDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINP-GLTLSALGGSAYSQYLE 790
            ++ +GEDRKLF+GMLGKQ +EDDVR LF+ +G IEECT+LR  +G SKGCAFVK+++ +EA  AI ++HG  T+PGASSSLVVKFADT+KER  R++ Q     G+ +P  +   A G  +++Q ++
Sbjct:  123 SEGRGEDRKLFVGMLGKQQSEDDVRRLFETFGQIEECTVLRGPDGASKGCAFVKFSSHAEAQAAINSLHGGQTMPGASSSLVVKFADTDKERTLRRMHQMAGQLGIFSPMTIQFGAYGTYSHAQMMQ 249          

HSP 3 Score: 75.8702 bits (185), Expect = 3.564e-14
Identity = 38/90 (42.22%), Postives = 54/90 (60.00%), Query Frame = 2
Query:  437 KLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQ-NGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKL 703
            KLFIG + +   E D++ LF+ +G I E T+L+D+  G  KGCAF+ Y  R  A  A  A+H   T+PG +  + VK AD+E   + RKL
Sbjct:   43 KLFIGQIPRNLEEKDLKPLFEEFGKIYELTVLKDRFTGMHKGCAFLTYCARESALKAQSALHEQKTLPGMNRPIQVKPADSEGRGEDRKL 132          
BLAST of Trinucleotide repeat containing 4-like protein vs. Planmine SMEST
Match: SMESG000005424.1 (SMESG000005424.1)

HSP 1 Score: 923.694 bits (2386), Expect = 0.000e+0
Identity = 459/460 (99.78%), Postives = 459/460 (99.78%), Query Frame = 2
Query:  290 MIFQKETEQSTFTETHIDDCFENKDEKKPATNNSNCKMSKQAQHKGEDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGGSAYSQYLENLQQNTGYINPIATLAXXXXXXXXXXXXIALGATLPYTLSTGIPTNDANASQNFLGVNPLAAAVAASQNLTTQSLLSPSTAASMMMPNNSGMNTMCQVQQQTPIISSATQMNDPSVNISHTQMSNGQTRPQNLTPFSLAAATGANWLASNSTTLPAMYGGLNLCGLAPYNPPTLNPITLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            MIFQKETEQSTFTETHIDDCFENKDEKKPATNNSNCKMSKQ QHKGEDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGGSAYSQYLENLQQNTGYINPIATLALQLQQQLQQQQQIALGATLPYTLSTGIPTNDANASQNFLGVNPLAAAVAASQNLTTQSLLSPSTAASMMMPNNSGMNTMCQVQQQTPIISSATQMNDPSVNISHTQMSNGQTRPQNLTPFSLAAATGANWLASNSTTLPAMYGGLNLCGLAPYNPPTLNPITLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY
Sbjct:    1 MIFQKETEQSTFTETHIDDCFENKDEKKPATNNSNCKMSKQTQHKGEDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGGSAYSQYLENLQQNTGYINPIATLALQLQQQLQQQQQIALGATLPYTLSTGIPTNDANASQNFLGVNPLAAAVAASQNLTTQSLLSPSTAASMMMPNNSGMNTMCQVQQQTPIISSATQMNDPSVNISHTQMSNGQTRPQNLTPFSLAAATGANWLASNSTTLPAMYGGLNLCGLAPYNPPTLNPITLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 460          
BLAST of Trinucleotide repeat containing 4-like protein vs. Planmine SMEST
Match: SMESG000005424.1 (SMESG000005424.1)

HSP 1 Score: 842.417 bits (2175), Expect = 0.000e+0
Identity = 422/423 (99.76%), Postives = 422/423 (99.76%), Query Frame = 2
Query:  401 MSKQAQHKGEDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGGSAYSQYLENLQQNTGYINPIATLAXXXXXXXXXXXXIALGATLPYTLSTGIPTNDANASQNFLGVNPLAAAVAASQNLTTQSLLSPSTAASMMMPNNSGMNTMCQVQQQTPIISSATQMNDPSVNISHTQMSNGQTRPQNLTPFSLAAATGANWLASNSTTLPAMYGGLNLCGLAPYNPPTLNPITLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            MSKQ QHKGEDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGGSAYSQYLENLQQNTGYINPIATLALQLQQQLQQQQQIALGATLPYTLSTGIPTNDANASQNFLGVNPLAAAVAASQNLTTQSLLSPSTAASMMMPNNSGMNTMCQVQQQTPIISSATQMNDPSVNISHTQMSNGQTRPQNLTPFSLAAATGANWLASNSTTLPAMYGGLNLCGLAPYNPPTLNPITLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY
Sbjct:    1 MSKQTQHKGEDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGGSAYSQYLENLQQNTGYINPIATLALQLQQQLQQQQQIALGATLPYTLSTGIPTNDANASQNFLGVNPLAAAVAASQNLTTQSLLSPSTAASMMMPNNSGMNTMCQVQQQTPIISSATQMNDPSVNISHTQMSNGQTRPQNLTPFSLAAATGANWLASNSTTLPAMYGGLNLCGLAPYNPPTLNPITLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 423          
BLAST of Trinucleotide repeat containing 4-like protein vs. Planmine SMEST
Match: SMESG000026947.1 (SMESG000026947.1)

HSP 1 Score: 331.643 bits (849), Expect = 7.694e-107
Identity = 205/436 (47.02%), Postives = 261/436 (59.86%), Query Frame = 2
Query:  410 QAQHKGEDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGGSAYSQ-YLENLQQNTGYINPIATLAXXXXXXXXXXXXIALGATLPYTLSTGIPTNDANASQNFLGVNPLAAAVAASQNLTTQSLLSPSTAASMMMPNNSGMNTMCQVQQQTPI------------ISSATQMNDPSVNISHT--QMSNGQTRPQNLTPFSLAAATGANWLASNSTTLPAMYGGLNLCGLA-PYNPPTLNPITLLARQALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKGGDTGKPY 1669
            + + K E+RKLF+GML K  TE+DVR LFK +G IEECT+LRDQNGNSKGCAFVK++++ EA  AI A+HGS T+ GASSS+VVKFADTEKERQTRKLQQ INP  L+N  L L+ LGG+ Y Q  L+N        NP+A L+ QLQQ         +         TG+  N  N       ++P+AA  AA        LLSP   ++     N+G N + Q                   I+ A+Q ++  V   H+  Q+SN      N++ +  A   G     ++S T  + Y  +   G+A P       PI    +  LS+ V QK+  KD   +GP+  N+FIYHLP EFGD +L QMFSPFG + SAKVY+DRATNQSKCFGFVS+ N   AQAAIQAMNGFQ+G+KRLKVQLKRPK  D+ KPY
Sbjct:  124 KEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYGQTILDNQLSPPRIFNPVAALSFQLQQTSGLPSLAGI---------TGLSINPTNGQAY---IDPVAANTAA--------LLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPVTAIHSSAQISNLSDSCVNVSLYQNACLGGQFVNTNSSATSDSSYHSIPAFGIAFPA------PIGQFGQSGLSLTVPQKDLEKDMGGSGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPK-SDSIKPY 532          

HSP 2 Score: 72.7886 bits (177), Expect = 2.551e-13
Identity = 39/106 (36.79%), Postives = 58/106 (54.72%), Query Frame = 2
Query:  389 SNCKMSKQAQHKGEDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQ-NGNSKGCAFVKYTTRSEAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKL 703
            SN K +       +  KLF+G + +   E D+R +F+ YG I E +ILRD+  G  KGCAF+ Y  R  +     A+H   ++PG +  L VK A  E++ + RKL
Sbjct:   29 SNGKSTSVLSKDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKL 134          
BLAST of Trinucleotide repeat containing 4-like protein vs. Planmine SMEST
Match: SMESG000021009.1 (SMESG000021009.1)

HSP 1 Score: 261.151 bits (666), Expect = 2.190e-81
Identity = 178/425 (41.88%), Postives = 224/425 (52.71%), Query Frame = 2
Query:  416 QHKGEDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHG---SMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGGSAYSQYLENLQQNTGYINP-IATLAXXXXXXXXXXXXIALGATLPYTLSTGIPTNDANASQNFLGVNPLAAAVAASQNLTTQSLLS-PSTAASMMMPNNSGMNTMCQVQQQTPIISSATQMNDPSVNISHTQMSNGQTRPQNLTPFSLAAATGANWLASNSTTLPAMYGGLNLCGLAPYNPPTLNPITLLARQ-------ALSMQVQQ--KEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKG 1648
            Q+  E+ KLFIGML K  +EDDVR L +PYG I+ C IL+D  GNSKGCAFV Y    EA  AI +++G   SM  P   S +V + AD E+ERQ RK+Q       L+ P                    QN GY N  I  +        QQ   +     L   LS                 N     V +S ++T Q  +  P +AA+ +  N   MN           I  +  +N   +N +H Q+ N      N TP +L               LP++Y     CG    N P L     L+ Q       ALS+Q QQ  K+G KD I+TGP+G N+FIYHLPQ+FGDA LAQ+F+PFG VISAKVY+DRATNQSKCFGFVSFDN+++A+AAI+ MNGFQIG KRLKVQLKRPKG
Sbjct:   28 QNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTP--------------------QNVGYYNQGIVPMIQFPHATDQQTANLINAYALQMHLSQ------------MYSPNLTPPLVNSSPSVTPQPQIGVPMSAANDISSNQCSMNHFVLPSINNENIPLSPALNS-YINPAHPQLINIANI--NFTPEALH--------------LPSLYSMFPQCGFN-LNTPALG----LSGQNIYPNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPKG 398          
BLAST of Trinucleotide repeat containing 4-like protein vs. Planmine SMEST
Match: SMESG000021009.1 (SMESG000021009.1)

HSP 1 Score: 259.225 bits (661), Expect = 1.524e-80
Identity = 180/426 (42.25%), Postives = 229/426 (53.76%), Query Frame = 2
Query:  416 QHKGEDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHG---SMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGGSAYSQYLENLQQNTGYINP--IATLAXXXXXXXXXXXXIALGATLPYTLSTGIPTNDANASQNFLGVNPLAAAVAASQNLTTQSLLS-PSTAASMMMPNNSGMNTMCQVQQQTPIISSATQMNDPSVNISHTQMSNGQTRPQNLTPFSLAAATGANWLASNSTTLPAMYGGLNLCGLAPYNPPTLNPITLLARQ-------ALSMQVQQ--KEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKG 1648
            Q+  E+ KLFIGML K  +EDDVR L +PYG I+ C IL+D  GNSKGCAFV Y    EA  AI +++G   SM  P   S +V + AD E+ERQ RK+Q       L+ P                    QN GY N   +  +  Q      QQ    + A   Y L   +       SQ +   N     V +S ++T Q  +  P +AA+ +  N   MN           I  +  +N   +N +H Q+ N      N TP +L               LP++Y     CG    N P L     L+ Q       ALS+Q QQ  K+G KD I+TGP+G N+FIYHLPQ+FGDA LAQ+F+PFG VISAKVY+DRATNQSKCFGFVSFDN+++A+AAI+ MNGFQIG KRLKVQLKRPKG
Sbjct:   28 QNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTP--------------------QNVGYYNQGIVPMILQQFPHATDQQTANLINA---YALQMHL-------SQMY-SPNLTPPLVNSSPSVTPQPQIGVPMSAANDISSNQCSMNHFVLPSINNENIPLSPALNS-YINPAHPQLINIANI--NFTPEALH--------------LPSLYSMFPQCGFN-LNTPALG----LSGQNIYPNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPKG 400          
The following BLAST results are available for this feature:
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CELF64.968e-8641.27CUGBP Elav-like family member 6 [Source:HGNC Symbo... [more]
CELF64.903e-8141.04CUGBP Elav-like family member 6 [Source:HGNC Symbo... [more]
AC009690.34.903e-8141.04novel transcript[more]
CELF26.258e-7241.94CUGBP Elav-like family member 2 [Source:HGNC Symbo... [more]
CELF26.258e-7241.94CUGBP Elav-like family member 2 [Source:HGNC Symbo... [more]
back to top
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
etr-15.837e-6639.10ELAV-Type RNA binding-protein family [Source:UniP... [more]
etr-15.837e-6639.10ELAV-Type RNA binding-protein family [Source:UniP... [more]
etr-15.837e-6639.10ELAV-Type RNA binding-protein family [Source:UniP... [more]
etr-15.837e-6639.10ELAV-Type RNA binding-protein family [Source:UniP... [more]
etr-12.251e-6438.31ELAV-Type RNA binding-protein family [Source:UniP... [more]
back to top
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bru36.430e-4681.91gene:FBgn0264001 transcript:FBtr0330348[more]
bru38.893e-4681.91gene:FBgn0264001 transcript:FBtr0330350[more]
bru39.438e-4681.91gene:FBgn0264001 transcript:FBtr0330346[more]
bru31.260e-4581.91gene:FBgn0264001 transcript:FBtr0330347[more]
bru31.439e-4581.91gene:FBgn0264001 transcript:FBtr0330355[more]
back to top
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
celf5a1.788e-9844.63cugbp, Elav-like family member 5a [Source:ZFIN;Acc... [more]
celf5a1.007e-9444.13cugbp, Elav-like family member 5a [Source:ZFIN;Acc... [more]
celf3a1.779e-9044.03cugbp, Elav-like family member 3a [Source:NCBI gen... [more]
celf3a1.779e-9044.03cugbp, Elav-like family member 3a [Source:NCBI gen... [more]
celf3b1.995e-9044.08cugbp, Elav-like family member 3b [Source:ZFIN;Acc... [more]
back to top
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
celf23.226e-7241.78CUGBP, Elav-like family member 2 [Source:NCBI gene... [more]
celf27.057e-7241.78CUGBP, Elav-like family member 2 [Source:NCBI gene... [more]
celf21.405e-7141.59CUGBP, Elav-like family member 2 [Source:NCBI gene... [more]
celf23.895e-7140.90CUGBP, Elav-like family member 2 [Source:NCBI gene... [more]
tpbg4.395e-4580.22trophoblast glycoprotein [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Celf35.643e-9844.88CUGBP, Elav-like family member 3 [Source:MGI Symbo... [more]
Celf55.067e-9543.86CUGBP, Elav-like family member 5 [Source:MGI Symbo... [more]
Celf35.609e-9544.89CUGBP, Elav-like family member 3 [Source:MGI Symbo... [more]
Celf38.544e-9445.37CUGBP, Elav-like family member 3 [Source:MGI Symbo... [more]
Celf22.488e-7241.94CUGBP, Elav-like family member 2 [Source:MGI Symbo... [more]
back to top
BLAST of Trinucleotide repeat containing 4-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q91579|CEL3A_XENLA2.782e-9544.63CUGBP Elav-like family member 3-A OS=Xenopus laevi... [more]
sp|Q08E07|CELF3_BOVIN1.288e-9445.20CUGBP Elav-like family member 3 OS=Bos taurus OX=9... [more]
sp|Q8CIN6|CELF3_MOUSE5.976e-9345.37CUGBP Elav-like family member 3 OS=Mus musculus OX... [more]
sp|Q7ZWM3|CEL3B_XENLA1.221e-9243.46CUGBP Elav-like family member 3-B OS=Xenopus laevi... [more]
sp|Q9IBD1|CELF3_DANRE1.343e-8944.03CUGBP Elav-like family member 3 OS=Danio rerio OX=... [more]
back to top
BLAST of Trinucleotide repeat containing 4-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
D5JG660.000e+090.22Trinucleotide repeat containing 4-like protein OS=... [more]
A0A267ES245.963e-11149.77Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DS204.179e-11049.53Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GPB94.437e-10649.29Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1S3PCG68.846e-9845.98CUGBP Elav-like family member 5 isoform X11 OS=Sal... [more]
back to top
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
celf3b1.934e-9243.52cugbp, Elav-like family member 3b [Source:ZFIN;Acc... [more]
ENSAMXT00000034315.12.816e-4782.61pep primary_assembly:Astyanax_mexicanus-2.0:5:2190... [more]
ENSAMXT00000012369.26.157e-4563.72CUGBP Elav-like family member 5 [Source:NCBI gene;... [more]
celf3a7.553e-4554.73cugbp, Elav-like family member 3a [Source:NCBI gen... [more]
si:dkey-205h23.26.619e-4483.52si:dkey-205h23.2 [Source:ZFIN;Acc:ZDB-GENE-120215-... [more]
back to top
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008846.14.824e-4171.74pep scaffold:Pmarinus_7.0:GL480623:147895:156346:1... [more]
ENSPMAT00000002852.19.554e-2852.13pep scaffold:Pmarinus_7.0:GL477021:232626:260651:-... [more]
ENSPMAT00000007375.13.328e-1841.53pep scaffold:Pmarinus_7.0:GL478911:2009:38506:1 ge... [more]
ENSPMAT00000007448.13.174e-1236.99pep scaffold:Pmarinus_7.0:GL479027:131562:138944:-... [more]
ENSPMAT00000008168.12.744e-1035.44pep scaffold:Pmarinus_7.0:GL476829:41182:80090:-1 ... [more]
back to top
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
NAM83.425e-935.79RNA binding protein, component of the U1 snRNP pro... [more]
NSR18.177e-936.92Nucleolar protein that binds nuclear localization ... [more]
HRP16.996e-831.82Subunit of cleavage factor I; cleavage factor I is... [more]
NOP152.336e-729.07Constituent of 66S pre-ribosomal particles; involv... [more]
IST33.675e-727.38Component of the U2 snRNP; required for the first ... [more]
back to top
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO295195.981e-4377.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355598.608e-4177.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO305761.808e-4061.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355629.448e-2151.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348792.843e-1240.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Trinucleotide repeat containing 4-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
celf5b4.255e-9844.95CUGBP Elav-like family member 5 [Source:NCBI gene;... [more]
celf5b5.747e-9744.80CUGBP Elav-like family member 5 [Source:NCBI gene;... [more]
celf3b8.108e-9445.65CUGBP Elav-like family member 3 [Source:NCBI gene;... [more]
si:dkey-205h23.27.996e-4583.70CUGBP Elav-like family member 6 [Source:NCBI gene;... [more]
si:dkey-205h23.27.996e-4583.70CUGBP Elav-like family member 6 [Source:NCBI gene;... [more]
back to top
BLAST of Trinucleotide repeat containing 4-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005424.10.000e+099.78SMESG000005424.1[more]
SMESG000005424.10.000e+099.76SMESG000005424.1[more]
SMESG000026947.17.694e-10747.02SMESG000026947.1[more]
SMESG000021009.12.190e-8141.88SMESG000021009.1[more]
SMESG000021009.11.524e-8042.25SMESG000021009.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011420 ID=SMED30011420|Name=Trinucleotide repeat containing 4-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1726bp
GTTGAAAATGAGTTTATATTTAAGAATAATAAAAAAGAATTTAAAAAGCA
GTTAATTTAAACAAAAAAAATGTCAAAAATTAGTTCGTTAAAAATATTAT
GAATTTTGTTGTAACTTTGATGACTTGCTCCAATTTTATGTTGTATAGAT
CATCGTTTTTATCACTATTATCCTACAAGGAGTCTTTATCATTGTTGTCG
GGGTGGTATTGCTTGCCTGAACAAAATATCTGGTGTACTGAAGCTGTTGT
AACAACTGTTTTTCTGGACTACTATTGAACATTCTCATCATGATATTCCA
AAAGGAAACCGAACAGTCAACATTCACAGAAACTCACATTGACGATTGTT
TTGAAAATAAAGATGAAAAGAAACCAGCGACCAACAATAGTAATTGCAAA
ATGTCAAAACAAGCCCAGCATAAAGGAGAAGATAGAAAACTATTCATCGG
TATGCTTGGAAAGCAGCACACAGAAGACGATGTTAGAGATCTATTCAAAC
CGTATGGTGCTATTGAGGAATGCACAATATTACGGGATCAAAATGGAAAT
AGTAAAGGATGCGCCTTCGTTAAATATACAACAAGATCAGAAGCTTATAC
AGCAATTGGTGCCATGCATGGGAGCATGACCATTCCAGGAGCCTCGTCGA
GTTTAGTTGTGAAATTTGCTGACACTGAAAAAGAAAGGCAAACTAGGAAA
CTTCAACAATTTATCAATCCCTTCGGACTGATTAACCCTGGTTTAACTTT
ATCAGCCTTGGGTGGGTCAGCATACTCTCAGTATTTAGAGAATCTTCAAC
AAAACACTGGCTACATTAATCCTATTGCCACTTTGGCATTGCAGTTGCAA
CAGCAATTACAGCAACAGCAACAAATTGCTTTAGGAGCAACTTTGCCATA
CACTTTGTCAACCGGGATACCGACCAATGACGCTAACGCCTCTCAAAATT
TCCTTGGTGTAAATCCATTAGCTGCCGCCGTTGCTGCCTCTCAAAATTTA
ACCACCCAGTCATTATTATCCCCATCAACTGCAGCAAGCATGATGATGCC
CAATAATTCCGGAATGAACACTATGTGTCAAGTGCAACAGCAGACTCCAA
TAATAAGCTCTGCCACACAAATGAATGACCCATCTGTTAATATTTCTCAT
ACACAGATGTCTAATGGACAAACCCGTCCCCAGAATCTTACTCCATTTTC
TTTGGCGGCAGCCACTGGTGCCAATTGGCTAGCTAGTAATTCAACAACGT
TACCAGCAATGTATGGAGGACTTAATTTATGTGGTTTAGCTCCATATAAC
CCTCCCACTTTAAATCCCATTACTCTATTAGCCAGACAAGCTCTTTCAAT
GCAAGTACAACAAAAGGAAGGAACAAAGGATTTCATTTTAACAGGCCCAG
ATGGTAGTAATGTTTTTATATATCATTTACCCCAAGAATTTGGCGATGCA
GAGCTGGCCCAAATGTTTTCCCCTTTCGGAACTGTGATTAGTGCTAAAGT
ATACATCGACAGAGCAACGAATCAAAGTAAATGTTTTGGTTTTGTAAGTT
TTGATAATTCCAATAGCGCACAAGCAGCAATTCAAGCAATGAATGGATTC
CAAATCGGAATGAAGAGACTTAAAGTCCAACTAAAAAGACCAAAGGGTGG
AGACACTGGGAAGCCATATTAATTGTAAATGCATATCAAAAACAAAGTAT
GTGACAAACGAAACATACCCGAGATC
back to top

protein sequence of SMED30011420-orf-1

>SMED30011420-orf-1 ID=SMED30011420-orf-1|Name=SMED30011420-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=461bp
MIFQKETEQSTFTETHIDDCFENKDEKKPATNNSNCKMSKQAQHKGEDRK
LFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRS
EAYTAIGAMHGSMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINP
GLTLSALGGSAYSQYLENLQQNTGYINPIATLALQLQQQLQQQQQIALGA
TLPYTLSTGIPTNDANASQNFLGVNPLAAAVAASQNLTTQSLLSPSTAAS
MMMPNNSGMNTMCQVQQQTPIISSATQMNDPSVNISHTQMSNGQTRPQNL
TPFSLAAATGANWLASNSTTLPAMYGGLNLCGLAPYNPPTLNPITLLARQ
ALSMQVQQKEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVI
SAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKR
PKGGDTGKPY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000039gamma neoblast
PLANA:0000067goblet cell
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
GO:0003723RNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0006397mRNA processing
GO:0048026positive regulation of mRNA splicing, via spliceosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 50..125
e-value: 5.5E-18
score: 75.8
coord: 374..447
e-value: 2.5E-23
score: 93.5
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 51..116
e-value: 6.0E-17
score: 61.2
coord: 375..445
e-value: 1.6E-19
score: 69.5
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 49..129
score: 16.705
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 373..451
score: 17.609
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 350..456
e-value: 1.3E-27
score: 98.1
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 35..137
e-value: 1.4E-27
score: 97.8
NoneNo IPR availablePANTHERPTHR24012RNA BINDING PROTEINcoord: 196..455
NoneNo IPR availablePANTHERPTHR24012RNA BINDING PROTEINcoord: 43..189
NoneNo IPR availablePANTHERPTHR24012:SF716CUGBP ELAV-LIKE FAMILY MEMBER 6coord: 43..189
NoneNo IPR availablePANTHERPTHR24012:SF716CUGBP ELAV-LIKE FAMILY MEMBER 6coord: 196..455
NoneNo IPR availableCDDcd12639RRM3_CELF3_4_5_6coord: 369..447
e-value: 5.63061E-51
score: 165.414
NoneNo IPR availableCDDcd12635RRM2_CELF3_4_5_6coord: 48..128
e-value: 6.24868E-54
score: 173.004
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 48..453