Transmembrane protein 209

Overview
NameTransmembrane protein 209
Smed IDSMED30011415
Length (bp)1841
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transmembrane protein 209 (SMED30011415) t-SNE clustered cells

Violin plots show distribution of expression levels for Transmembrane protein 209 (SMED30011415) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transmembrane protein 209 (SMED30011415) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transmembrane protein 209 (SMED30011415) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011415

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30011415h1SMcG0020457 SmedASXL_004336SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30011415h1SMcG0020457 SmedASXL_004336SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30011415h1SMcG0020457 dd_Smed_v4_4525_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transmembrane protein 209 vs. Ensembl Human
Match: TMEM209 (transmembrane protein 209 [Source:HGNC Symbol;Acc:HGNC:21898])

HSP 1 Score: 171.4 bits (433), Expect = 1.580e-45
Identity = 81/246 (32.93%), Postives = 141/246 (57.32%), Query Frame = 3
Query:  984 EVWKRLEIDQRLLN---DWTFSLRQWIHGTIINRVVNEIDDINRRLMELGITDVVIGESNVQTLRHLTNQPVTPFPTLGALINFLDCSKDQAYVVNRLKELAQGCSLGKFQWDGGSSDARHPWKEHLPNDTMLVLHMLCTYIEVRYAVHSNLHGVRTFSQQFITDNVMSKDANEMKDAFLLYQTCVQPPHFKVIFNQSLYEIPPGRKNLFHCLLVFFYKIYSNE-GNFKWLNLGRSGMNINNIFAK 1709
            EVW R+ ++++LL+    WT   R WI+ TI+  +V EI+ ++ ++  +G  ++ IGE+++ +L+          PTL  ++ +LD + +Q Y+  R+KEL+QG  +  F+W+ G       W   LP D+ +++H+ CTY++ R   H      +TF+ Q         D    ++ F +YQ+ + PPH+++I+ + +Y +P GR N+FH LL+F Y I + E G    +NLG SG+NI  IF +
Sbjct:  317 EVWARVAMNRQLLDHMDSWTAKFRNWINETILVPLVQEIESVSTQMRRMGCPELQIGEASITSLKQAALVKAPLIPTLNTIVQYLDLTPNQEYLFERIKELSQGGCMSSFRWNRGGDFKGRKWDTDLPTDSAIIMHVFCTYLDSRLPPHPKYPDGKTFTSQHFVQTPNKPDVTN-ENVFCIYQSAINPPHYELIYQRHVYNLPKGRNNMFHTLLMFLYIIKTKESGMLGRVNLGLSGVNILWIFGE 561          
BLAST of Transmembrane protein 209 vs. Ensembl Human
Match: TMEM209 (transmembrane protein 209 [Source:HGNC Symbol;Acc:HGNC:21898])

HSP 1 Score: 171.014 bits (432), Expect = 1.651e-45
Identity = 81/246 (32.93%), Postives = 141/246 (57.32%), Query Frame = 3
Query:  984 EVWKRLEIDQRLLN---DWTFSLRQWIHGTIINRVVNEIDDINRRLMELGITDVVIGESNVQTLRHLTNQPVTPFPTLGALINFLDCSKDQAYVVNRLKELAQGCSLGKFQWDGGSSDARHPWKEHLPNDTMLVLHMLCTYIEVRYAVHSNLHGVRTFSQQFITDNVMSKDANEMKDAFLLYQTCVQPPHFKVIFNQSLYEIPPGRKNLFHCLLVFFYKIYSNE-GNFKWLNLGRSGMNINNIFAK 1709
            EVW R+ ++++LL+    WT   R WI+ TI+  +V EI+ ++ ++  +G  ++ IGE+++ +L+          PTL  ++ +LD + +Q Y+  R+KEL+QG  +  F+W+ G       W   LP D+ +++H+ CTY++ R   H      +TF+ Q         D    ++ F +YQ+ + PPH+++I+ + +Y +P GR N+FH LL+F Y I + E G    +NLG SG+NI  IF +
Sbjct:  316 EVWARVAMNRQLLDHMDSWTAKFRNWINETILVPLVQEIESVSTQMRRMGCPELQIGEASITSLKQAALVKAPLIPTLNTIVQYLDLTPNQEYLFERIKELSQGGCMSSFRWNRGGDFKGRKWDTDLPTDSAIIMHVFCTYLDSRLPPHPKYPDGKTFTSQHFVQTPNKPDVTN-ENVFCIYQSAINPPHYELIYQRHVYNLPKGRNNMFHTLLMFLYIIKTKESGMLGRVNLGLSGVNILWIFGE 560          
BLAST of Transmembrane protein 209 vs. Ensembl Human
Match: TMEM209 (transmembrane protein 209 [Source:HGNC Symbol;Acc:HGNC:21898])

HSP 1 Score: 126.331 bits (316), Expect = 3.462e-30
Identity = 70/246 (28.46%), Postives = 118/246 (47.97%), Query Frame = 3
Query:  984 EVWKRLEIDQRLLN---DWTFSLRQWIHGTIINRVVNEIDDINRRLMELGITDVVIGESNVQTLRHLTNQPVTPFPTLGALINFLDCSKDQAYVVNRLKELAQGCSLGKFQWDGGSSDARHPWKEHLPNDTMLVLHMLCTYIEVRYAVHSNLHGVRTFSQQFITDNVMSKDANEMKDAFLLYQTCVQPPHFKVIFNQSLYEIPPGRKNLFHCLLVFFYKIYSNE-GNFKWLNLGRSGMNINNIFAK 1709
            EVW R+ ++++LL+    WT   R WI+ TI+  +V EI+ ++ ++  +G  ++ IGE                                          L+QG  +  F+W+ G       W   LP D+ +++H+ CTY++ R   H      +TF+ Q         D    ++ F +YQ+ + PPH+++I+ + +Y +P GR N+FH LL+F Y I + E G    +NLG SG+NI  IF +
Sbjct:  317 EVWARVAMNRQLLDHMDSWTAKFRNWINETILVPLVQEIESVSTQMRRMGCPELQIGE------------------------------------------LSQGGCMSSFRWNRGGDFKGRKWDTDLPTDSAIIMHVFCTYLDSRLPPHPKYPDGKTFTSQHFVQTPNKPDVTN-ENVFCIYQSAINPPHYELIYQRHVYNLPKGRNNMFHTLLMFLYIIKTKESGMLGRVNLGLSGVNILWIFGE 519          
BLAST of Transmembrane protein 209 vs. Ensembl Celegans
Match: B0464.6 (pep chromosome:WBcel235:III:9462989:9465965:-1 gene:WBGene00007186.1 transcript:B0464.6.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:B0464.6)

HSP 1 Score: 70.4774 bits (171), Expect = 1.733e-12
Identity = 59/247 (23.89%), Postives = 105/247 (42.51%), Query Frame = 3
Query: 1035 FSLRQWIHGTIINRVVNEIDDINRRL-MELGITDVVIGESNVQTLR-HLTNQPVTPFPTLGALINFLDCSKDQAYVVNRLKELAQGCSLGKFQWDGGSSD-----------ARHPWKEHLPNDTMLVLHMLCTYIEVRYAVHSNLHGVRT---FSQQFITDNVMS-KDANEMKDAFLLYQTCVQPPHFKVI-FNQSLYEIPPG----RKNLFHCLLVFFYKI-YSNEGNFKWLNLGRSGMNINNIFA 1706
            F  R WI  TI+  +   ID +N+ L  E     + +G S+V  L+     +       L  L+ FL    +Q Y+++R+KEL     +  ++W+ G S+            R  W + LP D +LV  +   Y++ +   +  +   R    F+ +F   N      A     +F L+     PPH + +  +++ Y I         NLF  +  F + + + N G     ++G SG+N+  + A
Sbjct:  397 FMTRAWIRNTILEPLAEHIDKVNKILDKEHANPPLRVGVSSVDALKLAAIERDSLKSSDLPFLLPFLSVHPNQKYLISRIKELCATQFMDAYKWNSGGSEPTDDNDQMTRLVRREWNDSLPTDAVLVFDIFLAYMDAQLNSNCLVGDSRLDQPFTSRFCVKNAQKPSSAQRTPFSFYLHMVTKSPPHAEFVHIDENGYAIKCNVLRQSPNLFRAIAQFIHFVKHENHGYLDQTSIGPSGINMTYVLA 643          
BLAST of Transmembrane protein 209 vs. Ensembl Celegans
Match: B0464.6 (pep chromosome:WBcel235:III:9462989:9465477:-1 gene:WBGene00007186.1 transcript:B0464.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:B0464.6)

HSP 1 Score: 70.4774 bits (171), Expect = 1.733e-12
Identity = 59/247 (23.89%), Postives = 105/247 (42.51%), Query Frame = 3
Query: 1035 FSLRQWIHGTIINRVVNEIDDINRRL-MELGITDVVIGESNVQTLR-HLTNQPVTPFPTLGALINFLDCSKDQAYVVNRLKELAQGCSLGKFQWDGGSSD-----------ARHPWKEHLPNDTMLVLHMLCTYIEVRYAVHSNLHGVRT---FSQQFITDNVMS-KDANEMKDAFLLYQTCVQPPHFKVI-FNQSLYEIPPG----RKNLFHCLLVFFYKI-YSNEGNFKWLNLGRSGMNINNIFA 1706
            F  R WI  TI+  +   ID +N+ L  E     + +G S+V  L+     +       L  L+ FL    +Q Y+++R+KEL     +  ++W+ G S+            R  W + LP D +LV  +   Y++ +   +  +   R    F+ +F   N      A     +F L+     PPH + +  +++ Y I         NLF  +  F + + + N G     ++G SG+N+  + A
Sbjct:  397 FMTRAWIRNTILEPLAEHIDKVNKILDKEHANPPLRVGVSSVDALKLAAIERDSLKSSDLPFLLPFLSVHPNQKYLISRIKELCATQFMDAYKWNSGGSEPTDDNDQMTRLVRREWNDSLPTDAVLVFDIFLAYMDAQLNSNCLVGDSRLDQPFTSRFCVKNAQKPSSAQRTPFSFYLHMVTKSPPHAEFVHIDENGYAIKCNVLRQSPNLFRAIAQFIHFVKHENHGYLDQTSIGPSGINMTYVLA 643          
BLAST of Transmembrane protein 209 vs. Ensembl Fly
Match: CG6479 (gene:FBgn0036710 transcript:FBtr0075245)

HSP 1 Score: 108.997 bits (271), Expect = 9.704e-25
Identity = 76/249 (30.52%), Postives = 125/249 (50.20%), Query Frame = 3
Query:  981 NEVWKRLEIDQRLLNDWTFSLRQWIHGTIINRVVNEIDDINRRLMELGITDVVIGESNVQTLRHLT-NQPV--TPFPTLGALINFLDCSKDQAYVVNRLKELAQGCSLGKFQWDGGSSDARHPWKEHLPNDTMLVLHMLCTYIEVRYAVHSNLHGVRTFSQQFI--------TDNVMSKDANEMKDAFLLYQTCVQPPHFKVIFNQSLYEIPPGRKNLFHCLLVFF-YKIYSNEGNFKWLNLGRSGMNI 1691
            +EV KR+  D+  L+ +  +LR WI  TI+ R+V EI+ ++    +  + D+ IG  +V+ LR    NQ    T  P L  L+ FLD   +Q Y+V R+KELAQG  +  ++W  G +       EHLP D  ++ H+ C Y++ +        G R F  +++        T +V++   N+   A L     +  P F  I ++ L+     R NLF+ ++ F  Y     +   + +NLG+SG+NI
Sbjct:  292 SEVIKRISTDK--LSQYVANLRFWISTTILQRLVKEINYVDDVFRQRALIDIKIGSVSVERLRKTAENQQFVQTCAPMLPMLLPFLDTFSNQEYLVQRIKELAQGSCIADYRWYSGKTHNGQQRDEHLPTDAAIIFHLFCVYLDSQLMPLPQ-GGGRPFHSRYVLIRDEKSSTKDVVNAVHNKAHCAILSTGNPLN-PKFNFISDKELHNCVYDRNNLFYVIIQFLIYMRQHQDSALECVNLGKSGINI 536          
BLAST of Transmembrane protein 209 vs. Ensembl Fly
Match: CG6479 (gene:FBgn0036710 transcript:FBtr0331847)

HSP 1 Score: 108.997 bits (271), Expect = 9.891e-25
Identity = 76/249 (30.52%), Postives = 125/249 (50.20%), Query Frame = 3
Query:  981 NEVWKRLEIDQRLLNDWTFSLRQWIHGTIINRVVNEIDDINRRLMELGITDVVIGESNVQTLRHLT-NQPV--TPFPTLGALINFLDCSKDQAYVVNRLKELAQGCSLGKFQWDGGSSDARHPWKEHLPNDTMLVLHMLCTYIEVRYAVHSNLHGVRTFSQQFI--------TDNVMSKDANEMKDAFLLYQTCVQPPHFKVIFNQSLYEIPPGRKNLFHCLLVFF-YKIYSNEGNFKWLNLGRSGMNI 1691
            +EV KR+  D+  L+ +  +LR WI  TI+ R+V EI+ ++    +  + D+ IG  +V+ LR    NQ    T  P L  L+ FLD   +Q Y+V R+KELAQG  +  ++W  G +       EHLP D  ++ H+ C Y++ +        G R F  +++        T +V++   N+   A L     +  P F  I ++ L+     R NLF+ ++ F  Y     +   + +NLG+SG+NI
Sbjct:  286 SEVIKRISTDK--LSQYVANLRFWISTTILQRLVKEINYVDDVFRQRALIDIKIGSVSVERLRKTAENQQFVQTCAPMLPMLLPFLDTFSNQEYLVQRIKELAQGSCIADYRWYSGKTHNGQQRDEHLPTDAAIIFHLFCVYLDSQLMPLPQ-GGGRPFHSRYVLIRDEKSSTKDVVNAVHNKAHCAILSTGNPLN-PKFNFISDKELHNCVYDRNNLFYVIIQFLIYMRQHQDSALECVNLGKSGINI 530          
BLAST of Transmembrane protein 209 vs. Ensembl Fly
Match: CG6479 (gene:FBgn0036710 transcript:FBtr0075246)

HSP 1 Score: 108.997 bits (271), Expect = 9.919e-25
Identity = 76/249 (30.52%), Postives = 125/249 (50.20%), Query Frame = 3
Query:  981 NEVWKRLEIDQRLLNDWTFSLRQWIHGTIINRVVNEIDDINRRLMELGITDVVIGESNVQTLRHLT-NQPV--TPFPTLGALINFLDCSKDQAYVVNRLKELAQGCSLGKFQWDGGSSDARHPWKEHLPNDTMLVLHMLCTYIEVRYAVHSNLHGVRTFSQQFI--------TDNVMSKDANEMKDAFLLYQTCVQPPHFKVIFNQSLYEIPPGRKNLFHCLLVFF-YKIYSNEGNFKWLNLGRSGMNI 1691
            +EV KR+  D+  L+ +  +LR WI  TI+ R+V EI+ ++    +  + D+ IG  +V+ LR    NQ    T  P L  L+ FLD   +Q Y+V R+KELAQG  +  ++W  G +       EHLP D  ++ H+ C Y++ +        G R F  +++        T +V++   N+   A L     +  P F  I ++ L+     R NLF+ ++ F  Y     +   + +NLG+SG+NI
Sbjct:  288 SEVIKRISTDK--LSQYVANLRFWISTTILQRLVKEINYVDDVFRQRALIDIKIGSVSVERLRKTAENQQFVQTCAPMLPMLLPFLDTFSNQEYLVQRIKELAQGSCIADYRWYSGKTHNGQQRDEHLPTDAAIIFHLFCVYLDSQLMPLPQ-GGGRPFHSRYVLIRDEKSSTKDVVNAVHNKAHCAILSTGNPLN-PKFNFISDKELHNCVYDRNNLFYVIIQFLIYMRQHQDSALECVNLGKSGINI 532          
BLAST of Transmembrane protein 209 vs. Ensembl Zebrafish
Match: tmem209 (transmembrane protein 209 [Source:ZFIN;Acc:ZDB-GENE-030131-2879])

HSP 1 Score: 177.178 bits (448), Expect = 7.651e-48
Identity = 86/246 (34.96%), Postives = 140/246 (56.91%), Query Frame = 3
Query:  984 EVWKRLEIDQRLLND----WTFSLRQWIHGTIINRVVNEIDDINRRLMELGITDVVIGESNVQTLRHLTNQPVTPFPTLGALINFLDCSKDQAYVVNRLKELAQGCSLGKFQWDGGSSDARHPWKEHLPNDTMLVLHMLCTYIEVRYAVHSNLHGVRTFSQQFITDNVMSKDANEMKDAFLLYQTCVQPPHFKVIFNQSLYEIPPGRKNLFHCLLVFFYKIYSNE-GNFKWLNLGRSGMNINNIFA 1706
            EVW R+    RL+ D    WT  LR WI+ TI+  +V E+D IN +L  +G  ++ IGE+++ +L+       +  PTL A++ +LD + +Q Y+V R+KELA    +  F+W+GG       W   LP D+ +++H+LCTY++ R   H      +TF+ Q         D +  ++ F ++Q+   PPH+++++   +Y +P GR NLFH +L+F Y I + E G    +NLG SG+N+  IF 
Sbjct:  309 EVWARITTS-RLVTDSIDSWTAKLRNWINDTILVHLVKEMDSINSQLRRMGCPELQIGEASISSLKQAAVVKASAIPTLNAIVQYLDVTPNQEYLVERIKELAHSGCMSSFRWNGGGDLKNRKWDTDLPTDSAILMHVLCTYLDSRLPPHPKYPDGKTFTSQHFMQTPNKPDVSN-ENLFCIHQSSTNPPHYQLVYQGHVYSLPKGRNNLFHTILMFLYIIKTKESGMLGRVNLGLSGVNVLWIFG 552          
BLAST of Transmembrane protein 209 vs. Ensembl Xenopus
Match: tmem209 (transmembrane protein 209 [Source:NCBI gene;Acc:496808])

HSP 1 Score: 169.859 bits (429), Expect = 4.110e-45
Identity = 85/246 (34.55%), Postives = 143/246 (58.13%), Query Frame = 3
Query:  984 EVWKRLEIDQRLLN---DWTFSLRQWIHGTIINRVVNEIDDINRRLMELGITDVVIGESNVQTLRHLTNQPVTPFPTLGALINFLDCSKDQAYVVNRLKELAQGCSLGKFQWDGGSSDARHPWKEHLPNDTMLVLHMLCTYIEVRYAVHSNLHGVRTF-SQQFITDNVMSKDANEMKDAFLLYQTCVQPPHFKVIFNQSLYEIPPGRKNLFHCLLVFFYKIYSNE-GNFKWLNLGRSGMNINNIFA 1706
            EVW ++ ++++LL+    WT   R W++ TI+  +V+E+D +N ++  LG  ++ IGES++ +L+          PTL  ++ +LD + +Q Y+  RLKEL+ G  +  F+W+ G       W   LP D+ +V+H+ CTY++ R   H      +TF SQ F+        +NE  + F ++Q+ V PP++++++ + +Y +P GR NLFH LL+F Y I + E G    +NLG SG+NI  IF 
Sbjct:  316 EVWGKVTMNRQLLDHMDAWTAKFRNWVNETILVPLVHEVDSVNTQMRRLGCPELQIGESSISSLKQAALVKAPLIPTLHIIVQYLDITPNQEYLYERLKELSHGGCMSSFRWNSGGDFKGRKWDTDLPTDSAIVMHIFCTYLDSRLPPHPKYPDGKTFTSQHFVQTPDKPDTSNE--NVFCIHQSNVNPPYYELVYQKHIYSLPKGRNNLFHTLLMFLYIIKTKESGMLGRVNLGLSGVNILWIFG 559          
BLAST of Transmembrane protein 209 vs. Ensembl Xenopus
Match: tmem209 (transmembrane protein 209 [Source:NCBI gene;Acc:496808])

HSP 1 Score: 158.688 bits (400), Expect = 2.270e-41
Identity = 75/228 (32.89%), Postives = 131/228 (57.46%), Query Frame = 3
Query:  984 EVWKRLEIDQRLLN---DWTFSLRQWIHGTIINRVVNEIDDINRRLMELGITDVVIGESNVQTLRHLTNQPVTPFPTLGALINFLDCSKDQAYVVNRLKELAQGCSLGKFQWDGGSSDARHPWKEHLPNDTMLVLHMLCTYIEVRYAVHSNLHGVRTF-SQQFITDNVMSKDANEMKDAFLLYQTCVQPPHFKVIFNQSLYEIPPGRKNLFHCLLVFFYKIYSNEGNF 1655
            EVW ++ ++++LL+    WT   R W++ TI+  +V+E+D +N ++  LG  ++ IGES++ +L+          PTL  ++ +LD + +Q Y+  RLKEL+ G  +  F+W+ G       W   LP D+ +V+H+ CTY++ R   H      +TF SQ F+        +NE  + F ++Q+ V PP++++++ + +Y +P GR NLFH LL+F Y I + E   
Sbjct:  297 EVWGKVTMNRQLLDHMDAWTAKFRNWVNETILVPLVHEVDSVNTQMRRLGCPELQIGESSISSLKQAALVKAPLIPTLHIIVQYLDITPNQEYLYERLKELSHGGCMSSFRWNSGGDFKGRKWDTDLPTDSAIVMHIFCTYLDSRLPPHPKYPDGKTFTSQHFVQTPDKPDTSNE--NVFCIHQSNVNPPYYELVYQKHIYSLPKGRNNLFHTLLMFLYIIKTKESGM 522          
BLAST of Transmembrane protein 209 vs. Ensembl Xenopus
Match: tmem209 (transmembrane protein 209 [Source:NCBI gene;Acc:496808])

HSP 1 Score: 157.918 bits (398), Expect = 2.405e-41
Identity = 75/228 (32.89%), Postives = 131/228 (57.46%), Query Frame = 3
Query:  984 EVWKRLEIDQRLLN---DWTFSLRQWIHGTIINRVVNEIDDINRRLMELGITDVVIGESNVQTLRHLTNQPVTPFPTLGALINFLDCSKDQAYVVNRLKELAQGCSLGKFQWDGGSSDARHPWKEHLPNDTMLVLHMLCTYIEVRYAVHSNLHGVRTF-SQQFITDNVMSKDANEMKDAFLLYQTCVQPPHFKVIFNQSLYEIPPGRKNLFHCLLVFFYKIYSNEGNF 1655
            EVW ++ ++++LL+    WT   R W++ TI+  +V+E+D +N ++  LG  ++ IGES++ +L+          PTL  ++ +LD + +Q Y+  RLKEL+ G  +  F+W+ G       W   LP D+ +V+H+ CTY++ R   H      +TF SQ F+        +NE  + F ++Q+ V PP++++++ + +Y +P GR NLFH LL+F Y I + E   
Sbjct:  263 EVWGKVTMNRQLLDHMDAWTAKFRNWVNETILVPLVHEVDSVNTQMRRLGCPELQIGESSISSLKQAALVKAPLIPTLHIIVQYLDITPNQEYLYERLKELSHGGCMSSFRWNSGGDFKGRKWDTDLPTDSAIVMHIFCTYLDSRLPPHPKYPDGKTFTSQHFVQTPDKPDTSNE--NVFCIHQSNVNPPYYELVYQKHIYSLPKGRNNLFHTLLMFLYIIKTKESGM 488          
BLAST of Transmembrane protein 209 vs. Ensembl Xenopus
Match: tmem209 (transmembrane protein 209 [Source:NCBI gene;Acc:496808])

HSP 1 Score: 158.688 bits (400), Expect = 3.128e-41
Identity = 75/228 (32.89%), Postives = 131/228 (57.46%), Query Frame = 3
Query:  984 EVWKRLEIDQRLLN---DWTFSLRQWIHGTIINRVVNEIDDINRRLMELGITDVVIGESNVQTLRHLTNQPVTPFPTLGALINFLDCSKDQAYVVNRLKELAQGCSLGKFQWDGGSSDARHPWKEHLPNDTMLVLHMLCTYIEVRYAVHSNLHGVRTF-SQQFITDNVMSKDANEMKDAFLLYQTCVQPPHFKVIFNQSLYEIPPGRKNLFHCLLVFFYKIYSNEGNF 1655
            EVW ++ ++++LL+    WT   R W++ TI+  +V+E+D +N ++  LG  ++ IGES++ +L+          PTL  ++ +LD + +Q Y+  RLKEL+ G  +  F+W+ G       W   LP D+ +V+H+ CTY++ R   H      +TF SQ F+        +NE  + F ++Q+ V PP++++++ + +Y +P GR NLFH LL+F Y I + E   
Sbjct:  309 EVWGKVTMNRQLLDHMDAWTAKFRNWVNETILVPLVHEVDSVNTQMRRLGCPELQIGESSISSLKQAALVKAPLIPTLHIIVQYLDITPNQEYLYERLKELSHGGCMSSFRWNSGGDFKGRKWDTDLPTDSAIVMHIFCTYLDSRLPPHPKYPDGKTFTSQHFVQTPDKPDTSNE--NVFCIHQSNVNPPYYELVYQKHIYSLPKGRNNLFHTLLMFLYIIKTKESGM 534          
BLAST of Transmembrane protein 209 vs. Ensembl Xenopus
Match: tmem209 (transmembrane protein 209 [Source:NCBI gene;Acc:496808])

HSP 1 Score: 158.303 bits (399), Expect = 3.558e-41
Identity = 75/228 (32.89%), Postives = 131/228 (57.46%), Query Frame = 3
Query:  984 EVWKRLEIDQRLLN---DWTFSLRQWIHGTIINRVVNEIDDINRRLMELGITDVVIGESNVQTLRHLTNQPVTPFPTLGALINFLDCSKDQAYVVNRLKELAQGCSLGKFQWDGGSSDARHPWKEHLPNDTMLVLHMLCTYIEVRYAVHSNLHGVRTF-SQQFITDNVMSKDANEMKDAFLLYQTCVQPPHFKVIFNQSLYEIPPGRKNLFHCLLVFFYKIYSNEGNF 1655
            EVW ++ ++++LL+    WT   R W++ TI+  +V+E+D +N ++  LG  ++ IGES++ +L+          PTL  ++ +LD + +Q Y+  RLKEL+ G  +  F+W+ G       W   LP D+ +V+H+ CTY++ R   H      +TF SQ F+        +NE  + F ++Q+ V PP++++++ + +Y +P GR NLFH LL+F Y I + E   
Sbjct:  297 EVWGKVTMNRQLLDHMDAWTAKFRNWVNETILVPLVHEVDSVNTQMRRLGCPELQIGESSISSLKQAALVKAPLIPTLHIIVQYLDITPNQEYLYERLKELSHGGCMSSFRWNSGGDFKGRKWDTDLPTDSAIVMHIFCTYLDSRLPPHPKYPDGKTFTSQHFVQTPDKPDTSNE--NVFCIHQSNVNPPYYELVYQKHIYSLPKGRNNLFHTLLMFLYIIKTKESGM 522          
BLAST of Transmembrane protein 209 vs. Ensembl Mouse
Match: Tmem209 (transmembrane protein 209 [Source:MGI Symbol;Acc:MGI:1919899])

HSP 1 Score: 176.022 bits (445), Expect = 1.099e-48
Identity = 85/254 (33.46%), Postives = 145/254 (57.09%), Query Frame = 3
Query:  960 LLTEVPINEVWKRLEIDQRLLN---DWTFSLRQWIHGTIINRVVNEIDDINRRLMELGITDVVIGESNVQTLRHLTNQPVTPFPTLGALINFLDCSKDQAYVVNRLKELAQGCSLGKFQWDGGSSDARHPWKEHLPNDTMLVLHMLCTYIEVRYAVHSNLHGVRTFSQQFITDNVMSKDANEMKDAFLLYQTCVQPPHFKVIFNQSLYEIPPGRKNLFHCLLVFFYKIYSNE-GNFKWLNLGRSGMNINNIFAK 1709
            L+++    EVW R+ ++++LL+    WT   R WI  TI+  +V EI+ ++ ++  +G  ++ IGE++V +L+          PTL A++ +LD + +Q Y+  R+KEL+QG  +  F+W+ G       W   LP D+ +++H+ CTY++ R   H      +TF+ Q         D    ++ F +YQ+ V PPH+++I+ + +Y +P GR N+FH LL+F Y I + E G    +NLG SG+NI  IF +
Sbjct:  151 LISKQAAEEVWARVTMNRQLLDHMDSWTAKFRNWISETILVPLVQEIESVSTQMRRMGCPELQIGEASVTSLKQAALVRAPLIPTLNAIVQYLDLTPNQEYLFERIKELSQGGCMSSFRWNRGGDFKGRKWDTDLPTDSAIIMHVFCTYLDSRLPPHPKYPDGKTFTSQHFVQTPNKPDVTN-ENVFCIYQSAVNPPHYELIYQRHVYNLPKGRNNMFHTLLMFLYIIKTKESGMLGRVNLGLSGVNILWIFGE 403          
BLAST of Transmembrane protein 209 vs. Ensembl Mouse
Match: Tmem209 (transmembrane protein 209 [Source:MGI Symbol;Acc:MGI:1919899])

HSP 1 Score: 176.022 bits (445), Expect = 1.099e-48
Identity = 85/254 (33.46%), Postives = 145/254 (57.09%), Query Frame = 3
Query:  960 LLTEVPINEVWKRLEIDQRLLN---DWTFSLRQWIHGTIINRVVNEIDDINRRLMELGITDVVIGESNVQTLRHLTNQPVTPFPTLGALINFLDCSKDQAYVVNRLKELAQGCSLGKFQWDGGSSDARHPWKEHLPNDTMLVLHMLCTYIEVRYAVHSNLHGVRTFSQQFITDNVMSKDANEMKDAFLLYQTCVQPPHFKVIFNQSLYEIPPGRKNLFHCLLVFFYKIYSNE-GNFKWLNLGRSGMNINNIFAK 1709
            L+++    EVW R+ ++++LL+    WT   R WI  TI+  +V EI+ ++ ++  +G  ++ IGE++V +L+          PTL A++ +LD + +Q Y+  R+KEL+QG  +  F+W+ G       W   LP D+ +++H+ CTY++ R   H      +TF+ Q         D    ++ F +YQ+ V PPH+++I+ + +Y +P GR N+FH LL+F Y I + E G    +NLG SG+NI  IF +
Sbjct:  151 LISKQAAEEVWARVTMNRQLLDHMDSWTAKFRNWISETILVPLVQEIESVSTQMRRMGCPELQIGEASVTSLKQAALVRAPLIPTLNAIVQYLDLTPNQEYLFERIKELSQGGCMSSFRWNRGGDFKGRKWDTDLPTDSAIIMHVFCTYLDSRLPPHPKYPDGKTFTSQHFVQTPNKPDVTN-ENVFCIYQSAVNPPHYELIYQRHVYNLPKGRNNMFHTLLMFLYIIKTKESGMLGRVNLGLSGVNILWIFGE 403          
BLAST of Transmembrane protein 209 vs. Ensembl Mouse
Match: Tmem209 (transmembrane protein 209 [Source:MGI Symbol;Acc:MGI:1919899])

HSP 1 Score: 175.252 bits (443), Expect = 4.090e-47
Identity = 85/256 (33.20%), Postives = 146/256 (57.03%), Query Frame = 3
Query:  954 SGLLTEVPINEVWKRLEIDQRLLN---DWTFSLRQWIHGTIINRVVNEIDDINRRLMELGITDVVIGESNVQTLRHLTNQPVTPFPTLGALINFLDCSKDQAYVVNRLKELAQGCSLGKFQWDGGSSDARHPWKEHLPNDTMLVLHMLCTYIEVRYAVHSNLHGVRTFSQQFITDNVMSKDANEMKDAFLLYQTCVQPPHFKVIFNQSLYEIPPGRKNLFHCLLVFFYKIYSNE-GNFKWLNLGRSGMNINNIFAK 1709
            + L+++    EVW R+ ++++LL+    WT   R WI  TI+  +V EI+ ++ ++  +G  ++ IGE++V +L+          PTL A++ +LD + +Q Y+  R+KEL+QG  +  F+W+ G       W   LP D+ +++H+ CTY++ R   H      +TF+ Q         D    ++ F +YQ+ V PPH+++I+ + +Y +P GR N+FH LL+F Y I + E G    +NLG SG+NI  IF +
Sbjct:  306 ADLISKQAAEEVWARVTMNRQLLDHMDSWTAKFRNWISETILVPLVQEIESVSTQMRRMGCPELQIGEASVTSLKQAALVRAPLIPTLNAIVQYLDLTPNQEYLFERIKELSQGGCMSSFRWNRGGDFKGRKWDTDLPTDSAIIMHVFCTYLDSRLPPHPKYPDGKTFTSQHFVQTPNKPDVTN-ENVFCIYQSAVNPPHYELIYQRHVYNLPKGRNNMFHTLLMFLYIIKTKESGMLGRVNLGLSGVNILWIFGE 560          
BLAST of Transmembrane protein 209 vs. Ensembl Mouse
Match: Tmem209 (transmembrane protein 209 [Source:MGI Symbol;Acc:MGI:1919899])

HSP 1 Score: 175.252 bits (443), Expect = 4.541e-47
Identity = 85/256 (33.20%), Postives = 146/256 (57.03%), Query Frame = 3
Query:  954 SGLLTEVPINEVWKRLEIDQRLLN---DWTFSLRQWIHGTIINRVVNEIDDINRRLMELGITDVVIGESNVQTLRHLTNQPVTPFPTLGALINFLDCSKDQAYVVNRLKELAQGCSLGKFQWDGGSSDARHPWKEHLPNDTMLVLHMLCTYIEVRYAVHSNLHGVRTFSQQFITDNVMSKDANEMKDAFLLYQTCVQPPHFKVIFNQSLYEIPPGRKNLFHCLLVFFYKIYSNE-GNFKWLNLGRSGMNINNIFAK 1709
            + L+++    EVW R+ ++++LL+    WT   R WI  TI+  +V EI+ ++ ++  +G  ++ IGE++V +L+          PTL A++ +LD + +Q Y+  R+KEL+QG  +  F+W+ G       W   LP D+ +++H+ CTY++ R   H      +TF+ Q         D    ++ F +YQ+ V PPH+++I+ + +Y +P GR N+FH LL+F Y I + E G    +NLG SG+NI  IF +
Sbjct:  307 ADLISKQAAEEVWARVTMNRQLLDHMDSWTAKFRNWISETILVPLVQEIESVSTQMRRMGCPELQIGEASVTSLKQAALVRAPLIPTLNAIVQYLDLTPNQEYLFERIKELSQGGCMSSFRWNRGGDFKGRKWDTDLPTDSAIIMHVFCTYLDSRLPPHPKYPDGKTFTSQHFVQTPNKPDVTN-ENVFCIYQSAVNPPHYELIYQRHVYNLPKGRNNMFHTLLMFLYIIKTKESGMLGRVNLGLSGVNILWIFGE 561          
BLAST of Transmembrane protein 209 vs. Ensembl Mouse
Match: Tmem209 (transmembrane protein 209 [Source:MGI Symbol;Acc:MGI:1919899])

HSP 1 Score: 175.252 bits (443), Expect = 4.541e-47
Identity = 85/256 (33.20%), Postives = 146/256 (57.03%), Query Frame = 3
Query:  954 SGLLTEVPINEVWKRLEIDQRLLN---DWTFSLRQWIHGTIINRVVNEIDDINRRLMELGITDVVIGESNVQTLRHLTNQPVTPFPTLGALINFLDCSKDQAYVVNRLKELAQGCSLGKFQWDGGSSDARHPWKEHLPNDTMLVLHMLCTYIEVRYAVHSNLHGVRTFSQQFITDNVMSKDANEMKDAFLLYQTCVQPPHFKVIFNQSLYEIPPGRKNLFHCLLVFFYKIYSNE-GNFKWLNLGRSGMNINNIFAK 1709
            + L+++    EVW R+ ++++LL+    WT   R WI  TI+  +V EI+ ++ ++  +G  ++ IGE++V +L+          PTL A++ +LD + +Q Y+  R+KEL+QG  +  F+W+ G       W   LP D+ +++H+ CTY++ R   H      +TF+ Q         D    ++ F +YQ+ V PPH+++I+ + +Y +P GR N+FH LL+F Y I + E G    +NLG SG+NI  IF +
Sbjct:  307 ADLISKQAAEEVWARVTMNRQLLDHMDSWTAKFRNWISETILVPLVQEIESVSTQMRRMGCPELQIGEASVTSLKQAALVRAPLIPTLNAIVQYLDLTPNQEYLFERIKELSQGGCMSSFRWNRGGDFKGRKWDTDLPTDSAIIMHVFCTYLDSRLPPHPKYPDGKTFTSQHFVQTPNKPDVTN-ENVFCIYQSAVNPPHYELIYQRHVYNLPKGRNNMFHTLLMFLYIIKTKESGMLGRVNLGLSGVNILWIFGE 561          
BLAST of Transmembrane protein 209 vs. UniProt/SwissProt
Match: sp|Q68FR5|TM209_RAT (Transmembrane protein 209 OS=Rattus norvegicus OX=10116 GN=Tmem209 PE=2 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 3.177e-46
Identity = 84/254 (33.07%), Postives = 145/254 (57.09%), Query Frame = 3
Query:  960 LLTEVPINEVWKRLEIDQRLLN---DWTFSLRQWIHGTIINRVVNEIDDINRRLMELGITDVVIGESNVQTLRHLTNQPVTPFPTLGALINFLDCSKDQAYVVNRLKELAQGCSLGKFQWDGGSSDARHPWKEHLPNDTMLVLHMLCTYIEVRYAVHSNLHGVRTFSQQFITDNVMSKDANEMKDAFLLYQTCVQPPHFKVIFNQSLYEIPPGRKNLFHCLLVFFYKIYSNE-GNFKWLNLGRSGMNINNIFAK 1709
            L+++    EVW R+ ++++LL+    WT   R WI  TI+  +V EI+ ++ ++  +G  ++ IGE++V +L+          PTL A++ +LD + +Q Y+  R+KEL+QG  +  F+W+ G       W   LP D+ +++H+ CTY++ R   H      +TF+ Q         D    ++ F +YQ+ + PPH+++I+ + +Y +P GR N+FH LL+F Y I + E G    +NLG SG+NI  IF +
Sbjct:  309 LISKQAAEEVWARVTMNRQLLDHMDSWTAKFRNWISETILVPLVQEIESVSTQMRRMGCPELQIGEASVTSLKQAALVKAPLIPTLNAIVQYLDLTPNQEYLFERIKELSQGGCMSSFRWNRGGDFKGRRWDTDLPTDSAIIMHVFCTYLDSRLPPHPKYPDGKTFTSQHFVQTPNKPDVTN-ENVFCVYQSAINPPHYELIYQRHVYSLPKGRNNMFHTLLMFLYIIKTKESGMLGRVNLGLSGVNILWIFGE 561          
BLAST of Transmembrane protein 209 vs. UniProt/SwissProt
Match: sp|Q8BRG8|TM209_MOUSE (Transmembrane protein 209 OS=Mus musculus OX=10090 GN=Tmem209 PE=2 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 3.177e-46
Identity = 85/256 (33.20%), Postives = 146/256 (57.03%), Query Frame = 3
Query:  954 SGLLTEVPINEVWKRLEIDQRLLN---DWTFSLRQWIHGTIINRVVNEIDDINRRLMELGITDVVIGESNVQTLRHLTNQPVTPFPTLGALINFLDCSKDQAYVVNRLKELAQGCSLGKFQWDGGSSDARHPWKEHLPNDTMLVLHMLCTYIEVRYAVHSNLHGVRTFSQQFITDNVMSKDANEMKDAFLLYQTCVQPPHFKVIFNQSLYEIPPGRKNLFHCLLVFFYKIYSNE-GNFKWLNLGRSGMNINNIFAK 1709
            + L+++    EVW R+ ++++LL+    WT   R WI  TI+  +V EI+ ++ ++  +G  ++ IGE++V +L+          PTL A++ +LD + +Q Y+  R+KEL+QG  +  F+W+ G       W   LP D+ +++H+ CTY++ R   H      +TF+ Q         D    ++ F +YQ+ V PPH+++I+ + +Y +P GR N+FH LL+F Y I + E G    +NLG SG+NI  IF +
Sbjct:  307 ADLISKQAAEEVWARVTMNRQLLDHMDSWTAKFRNWISETILVPLVQEIESVSTQMRRMGCPELQIGEASVTSLKQAALVRAPLIPTLNAIVQYLDLTPNQEYLFERIKELSQGGCMSSFRWNRGGDFKGRKWDTDLPTDSAIIMHVFCTYLDSRLPPHPKYPDGKTFTSQHFVQTPNKPDVTN-ENVFCIYQSAVNPPHYELIYQRHVYNLPKGRNNMFHTLLMFLYIIKTKESGMLGRVNLGLSGVNILWIFGE 561          
BLAST of Transmembrane protein 209 vs. UniProt/SwissProt
Match: sp|Q96SK2|TM209_HUMAN (Transmembrane protein 209 OS=Homo sapiens OX=9606 GN=TMEM209 PE=1 SV=2)

HSP 1 Score: 171.4 bits (433), Expect = 7.586e-45
Identity = 81/246 (32.93%), Postives = 141/246 (57.32%), Query Frame = 3
Query:  984 EVWKRLEIDQRLLN---DWTFSLRQWIHGTIINRVVNEIDDINRRLMELGITDVVIGESNVQTLRHLTNQPVTPFPTLGALINFLDCSKDQAYVVNRLKELAQGCSLGKFQWDGGSSDARHPWKEHLPNDTMLVLHMLCTYIEVRYAVHSNLHGVRTFSQQFITDNVMSKDANEMKDAFLLYQTCVQPPHFKVIFNQSLYEIPPGRKNLFHCLLVFFYKIYSNE-GNFKWLNLGRSGMNINNIFAK 1709
            EVW R+ ++++LL+    WT   R WI+ TI+  +V EI+ ++ ++  +G  ++ IGE+++ +L+          PTL  ++ +LD + +Q Y+  R+KEL+QG  +  F+W+ G       W   LP D+ +++H+ CTY++ R   H      +TF+ Q         D    ++ F +YQ+ + PPH+++I+ + +Y +P GR N+FH LL+F Y I + E G    +NLG SG+NI  IF +
Sbjct:  317 EVWARVAMNRQLLDHMDSWTAKFRNWINETILVPLVQEIESVSTQMRRMGCPELQIGEASITSLKQAALVKAPLIPTLNTIVQYLDLTPNQEYLFERIKELSQGGCMSSFRWNRGGDFKGRKWDTDLPTDSAIIMHVFCTYLDSRLPPHPKYPDGKTFTSQHFVQTPNKPDVTN-ENVFCIYQSAINPPHYELIYQRHVYNLPKGRNNMFHTLLMFLYIIKTKESGMLGRVNLGLSGVNILWIFGE 561          
BLAST of Transmembrane protein 209 vs. UniProt/SwissProt
Match: sp|Q6GPP7|TM209_XENLA (Transmembrane protein 209 OS=Xenopus laevis OX=8355 GN=tmem209 PE=2 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 3.800e-43
Identity = 84/248 (33.87%), Postives = 141/248 (56.85%), Query Frame = 3
Query:  984 EVWKRLEIDQRL---LNDWTFSLRQWIHGTIINRVVNEIDDINRRLMELGITDVVIGESNVQTLRHLTNQPVTPFPTLGALINFLDCSKDQAYVVNRLKELAQGCSLGKFQWDGGSSDARHPWKEHLPNDTMLVLHMLCTYIEVRYAVHSNLHGVRTF-SQQFITDNVMSKDANEMKDAFLLYQTCVQPPHFKVIFNQSLYEIPPGRKNLFHCLLVFFYKIYSNE-GNFKWLNLGRSGMNINNIFAKL 1712
            EVW ++ +++ L   ++ WT   R WI+ TI+  +V E+D +  ++  LG  D+ IGES++ +L+          PTL  ++ +LD + +Q Y+  RLKEL+ G  +  F+W+ G       W   LP D+ +++H+ CTY++ R   H      +TF SQ F+        +NE  + F ++Q+ + PP++++++ + +Y +P GR NLFH LL+F Y I + E G    +NLG SG+NI  IF  L
Sbjct:  316 EVWAKVIMNRPLQDHMDAWTAKFRNWINETILVPLVYEMDSVKTQMRRLGCPDLQIGESSITSLKQAALVKAPLIPTLHIIVQYLDITPNQEYLYERLKELSHGGCMSSFRWNSGGDFKGRKWDTDLPTDSAIIMHIFCTYLDSRLPPHPKYPDGKTFTSQHFVQAPDKPDISNE--NVFCIHQSSINPPYYELVYQKHIYSLPKGRNNLFHTLLMFLYIIKTKESGMLGRVNLGLSGVNILWIFGDL 561          
BLAST of Transmembrane protein 209 vs. UniProt/SwissProt
Match: sp|Q5M7R3|TM209_XENTR (Transmembrane protein 209 OS=Xenopus tropicalis OX=8364 GN=tmem209 PE=2 SV=2)

HSP 1 Score: 155.606 bits (392), Expect = 2.591e-39
Identity = 82/246 (33.33%), Postives = 140/246 (56.91%), Query Frame = 3
Query:  984 EVWKRLEIDQRLLN---DWTFSLRQWIHGTIINRVVNEIDDINRRLMELGITDVVIGESNVQTLRHLTNQPVTPFPTLGALINFLDCSKDQAYVVNRLKELAQGCSLGKFQWDGGSSDARHPWKEHLPNDTMLVLHMLCTYIEVRYAVHSNLHGVRTF-SQQFITDNVMSKDANEMKDAFLLYQTCVQPPHFKVIFNQSLYEIPPGRKNLFHCLLVFFYKIYSNE-GNFKWLNLGRSGMNINNIFA 1706
            EVW ++ ++++LL+    WT   R W++ TI+  +V+E+D +N ++  LG  ++ IGES++ +L+          PTL  ++ +LD + +Q Y+  RLKEL+ G  +  F+W+ G       W   LP D+ +V+H+ CTY++ R   H      +TF SQ F+        +NE  + F ++Q+ V PP++++++ + + +    R NLFH LL+F Y I + E G    +NLG SG+NI  IF 
Sbjct:  316 EVWGKVTMNRQLLDHMDAWTAKFRNWVNETILVPLVHEVDSVNTQMRRLGCPELQIGESSISSLKQAALVKAPLIPTLHIIVQYLDITPNQEYLYERLKELSHGGCMSSFRWNSGGDFKGRKWDTDLPTDSAIVMHIFCTYLDSRLPPHPKYPDGKTFTSQHFVQTPDKPDTSNE--NVFCIHQSNVNPPYYELVYQKHITB----RNNLFHTLLMFLYIIKTKESGMLGRVNLGLSGVNILWIFG 555          
BLAST of Transmembrane protein 209 vs. TrEMBL
Match: A0A075AAG7 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_01244 PE=4 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 1.930e-56
Identity = 107/258 (41.47%), Postives = 150/258 (58.14%), Query Frame = 3
Query:  939 NRSQPSGLLTEVPINEVWKRLEIDQRLLNDWTFSLRQWIHGTIINRVVNEIDDINRRLMELGITDVVIGESNVQTLRHLTNQPVTPFPTLGALINFLDCSKDQAYVVNRLKELAQGCSLGKFQWDGGSSDARHPWKEHLPNDTMLVLHMLCTYIEVRYAVHSNLHGVRTFSQQFITDNVMSKDANEMKDAF--LLYQTCVQPPHFKVIFNQSLYEIPPGRKNLFHCLLVFFYKIYSNEGNFKWLNLGRSGMNINNIFA 1706
            +R  P     E   +E W   +I    L  WT  LR+W+HGTI+ R+V+EI  +NR   E    +V IG + ++TL+ L +      PTL  L++FL+ SKD  Y+VNRLKELA+G  L  F+WD GS  +  PWKEHLPND++++LH+  TY++ R   H      R FSQ  I   V   D  ++K  F   LYQ  VQPPHFK++ +  +Y   PG  NLFH +L+ F+     +G F+ +NLG SG+N+  IF 
Sbjct:  374 SRQNPREQPMERSSDEYWNENKITASCLAQWTMDLRKWLHGTIVRRLVDEIAAVNRHFNETSGEEVAIGSTTLETLQQLCSTKYQYLPTLPVLLSFLEFSKDHGYLVNRLKELARGSCLEDFRWDSGSRSSSWPWKEHLPNDSLILLHLFATYMDTRMPAHPKCLTGRVFSQLCI---VRHPDKPDLKSKFNSQLYQVTVQPPHFKLVLDGKIYSFQPGPDNLFHVILMCFHHALKLDGKFRSINLGPSGLNMAWIFT 628          
BLAST of Transmembrane protein 209 vs. TrEMBL
Match: A0A4S2M9S2 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001629 PE=4 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 2.060e-55
Identity = 103/244 (42.21%), Postives = 145/244 (59.43%), Query Frame = 3
Query:  981 NEVWKRLEIDQRLLNDWTFSLRQWIHGTIINRVVNEIDDINRRLMELGITDVVIGESNVQTLRHLTNQPVTPFPTLGALINFLDCSKDQAYVVNRLKELAQGCSLGKFQWDGGSSDARHPWKEHLPNDTMLVLHMLCTYIEVRYAVHSNLHGVRTFSQQFITDNVMSKDANEMKDAF--LLYQTCVQPPHFKVIFNQSLYEIPPGRKNLFHCLLVFFYKIYSNEGNFKWLNLGRSGMNINNIFA 1706
            +E W   +I    L  WT  LR+W+HGTI+ R+V+EI  +NR   E    +V IG + ++TL+ L +      PTL  L++FL+ SKD  Y+VNRLKELA+G  L  F+WD GS  +  PWKEHLPND++++LH+  TY++ R   H      R FSQ  I   V   D  ++K  F   LYQ  VQPPHFK++ +  +Y    G  NLFH +L+ F+     +G F+ +NLG SG+N+  IF 
Sbjct:  299 DEYWNENKITASCLAQWTMDLRKWLHGTIVRRLVDEITAVNRHFNETSGEEVAIGSTTLETLQQLCSTKYQYLPTLPVLLSFLEFSKDHGYLVNRLKELARGSCLEDFRWDSGSRSSYWPWKEHLPNDSLILLHLFATYMDTRMPAHPKCLTGRVFSQLCI---VRHPDKPDLKSKFSSQLYQVTVQPPHFKLVLDGKIYTFQQGPDNLFHVILMCFHHALKLDGKFRSINLGPSGLNMAWIFT 539          
BLAST of Transmembrane protein 209 vs. TrEMBL
Match: A0A183TH59 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS15807 PE=4 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 4.413e-55
Identity = 94/251 (37.45%), Postives = 148/251 (58.96%), Query Frame = 3
Query:  963 LTEVPINEVWKRLEIDQRLLNDWTFSLRQWIHGTIINRVVNEIDDINRRLMELGITDVVIGESNVQTLRHLTNQPVTPFPTLGALINFLDCSKDQAYVVNRLKELAQGCSLGKFQWDGGSSDARHPWKEHLPNDTMLVLHMLCTYIEVRYAVHSNLHGVRTFSQQFITDNVMSKDANEMKDAFL--LYQTCVQPPHFKVIFNQSLYEIPPGRKNLFHCLLVFFYKIYSNEGNFKWLNLGRSGMNINNIFAK 1709
            ++E    + WK   +    L  WT ++R+W+HGTI+ RVV EI  +N +++E      +IG + + TL  L         TL  LI FL+C+KDQ Y+V+RL+ELA+G  L +F+WDGGS     PWKEH+P DT+++LH+L TY++ R   H      R+F Q  +   V   D  ++K  +   LY + +QPP  KV+ + ++Y  P  ++N +H LL+FFY  +  E   + ++LG SG+N++ +F K
Sbjct:   41 ISEQDAQKYWKENGVTSADLERWTINIRRWLHGTIVRRVVEEITSVNSKILETSEDAALIGSTTLNTLEQLAFSKYRHISTLSTLIRFLNCTKDQGYLVSRLRELARGSFLEEFRWDGGSKSTTSPWKEHIPTDTVILLHLLSTYMDCRLPPHPKCLSGRSFDQLHV---VRHPDKPDLKAKYTAQLYISRIQPPVIKVVLDSTIYVFPSDQRNFYHALLMFFYFYHKQEDTIRSISLGASGLNLSWVFEK 288          
BLAST of Transmembrane protein 209 vs. TrEMBL
Match: A0A3Q0KSR0 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 1.550e-54
Identity = 99/243 (40.74%), Postives = 147/243 (60.49%), Query Frame = 3
Query:  981 NEVWKRLEIDQRLLNDWTFSLRQWIHGTIINRVVNEIDDINRRLMELGITDVVIGESNVQTLRHLTNQPVTPFPTLGALINFLDCSKDQAYVVNRLKELAQGCSLGKFQWDGGSSDARHPWKEHLPNDTMLVLHMLCTYIEVRYAVHSNLHGVRTFSQQFITDNVMSKDANEMKDAFLLYQTCVQPPHFKVIFNQSLYEIPPGRKNLFHCLLVFFYKIYSNEGNFKWLNLGRSGMNINNIFAK 1709
            +E W   ++ +  L+ WT +LR+W+HGTII R+VNEID INR L E G    +IG +++ TL+  ++      PTL  L+ FLD  KDQ Y+VNRL ELA+   L +F+WD GS     PWKEHLP+D++++LH+  TY++ R   H      R FSQ  +   +  K   + K     YQ  VQPP FK++ N  +Y +  G KN++H +L+FF+   +    F+ ++LG SG+N+  IF+K
Sbjct:  199 DEYWIENQVSKSDLDRWTLNLRKWLHGTIIRRIVNEIDTINRNLEEAGGDKTLIGSTSLATLQQFSSLKYQYLPTLPVLLAFLDFMKDQGYLVNRLHELARETCLQEFRWDSGSKSTEWPWKEHLPSDSIILLHLFATYMDTRMPPHPKCLSGRVFSQLNVV-RLPDKPDLKSKHNCQFYQVAVQPPQFKLVLNGRIYNLISGPKNIYHAILLFFHYYVTRNEKFRSVSLGPSGLNVAWIFSK 440          
BLAST of Transmembrane protein 209 vs. TrEMBL
Match: A0A5K4EVQ4 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 2.142e-53
Identity = 99/243 (40.74%), Postives = 147/243 (60.49%), Query Frame = 3
Query:  981 NEVWKRLEIDQRLLNDWTFSLRQWIHGTIINRVVNEIDDINRRLMELGITDVVIGESNVQTLRHLTNQPVTPFPTLGALINFLDCSKDQAYVVNRLKELAQGCSLGKFQWDGGSSDARHPWKEHLPNDTMLVLHMLCTYIEVRYAVHSNLHGVRTFSQQFITDNVMSKDANEMKDAFLLYQTCVQPPHFKVIFNQSLYEIPPGRKNLFHCLLVFFYKIYSNEGNFKWLNLGRSGMNINNIFAK 1709
            +E W   ++ +  L+ WT +LR+W+HGTII R+VNEID INR L E G    +IG +++ TL+  ++      PTL  L+ FLD  KDQ Y+VNRL ELA+   L +F+WD GS     PWKEHLP+D++++LH+  TY++ R   H      R FSQ  +   +  K   + K     YQ  VQPP FK++ N  +Y +  G KN++H +L+FF+   +    F+ ++LG SG+N+  IF+K
Sbjct:  317 DEYWIENQVSKSDLDRWTLNLRKWLHGTIIRRIVNEIDTINRNLEEAGGDKTLIGSTSLATLQQFSSLKYQYLPTLPVLLAFLDFMKDQGYLVNRLHELARETCLQEFRWDSGSKSTEWPWKEHLPSDSIILLHLFATYMDTRMPPHPKCLSGRVFSQLNVV-RLPDKPDLKSKHNCQFYQVAVQPPQFKLVLNGRIYNLISGPKNIYHAILLFFHYYVTRNEKFRSVSLGPSGLNVAWIFSK 558          
BLAST of Transmembrane protein 209 vs. Ensembl Cavefish
Match: tmem209 (transmembrane protein 209 [Source:NCBI gene;Acc:103046177])

HSP 1 Score: 176.792 bits (447), Expect = 9.077e-48
Identity = 91/247 (36.84%), Postives = 142/247 (57.49%), Query Frame = 3
Query:  984 EVWKRLEIDQRLLND----WTFSLRQWIHGTIINRVVNEIDDINRRLMELGITDVVIGESNVQTLRHLTNQPVTPFPTLGALINFLDCSKDQAYVVNRLKELAQGCSLGKFQWDGGSSDARHPWKEHLPNDTMLVLHMLCTYIEVRYAVHSNLHGVRTF-SQQFITDNVMSKDANEMKDAFLLYQTCVQPPHFKVIFNQSLYEIPPGRKNLFHCLLVFFYKIYSNE-GNFKWLNLGRSGMNINNIFA 1706
            EVW R+    RL+ D    WT  LR WI+ TI+  +V EID IN +L  +G  ++ IGE+++ +L+          PTL A++ +LD + +Q Y+V R+KELA    +  F+W+GG +     W   LP D+ +++H+LCTY++ R   H      +TF SQ FI        +NE  + F ++Q+   PPH+++I+   +Y +P GR NLFH +L+F + I + E G    +NLG SG+N+  IF 
Sbjct:  312 EVWARITTS-RLVTDSIDSWTAKLRNWINDTILVHLVKEIDSINSQLRRMGCPELQIGEASISSLKQAAVVKACAIPTLNAIVQYLDITPNQEYLVERIKELAHSGCMSSFRWNGGGNLKNRKWDTDLPTDSAILMHILCTYLDSRLPPHPKYPDGKTFTSQHFIQTPHKPDLSNE--NLFCIHQSSTNPPHYQLIYQGHIYSLPKGRNNLFHTVLMFLFIIKTKESGMLGRVNLGLSGVNVLWIFG 555          
BLAST of Transmembrane protein 209 vs. Ensembl Cavefish
Match: tmem209 (transmembrane protein 209 [Source:NCBI gene;Acc:103046177])

HSP 1 Score: 166.777 bits (421), Expect = 2.685e-44
Identity = 82/229 (35.81%), Postives = 130/229 (56.77%), Query Frame = 3
Query:  984 EVWKRLEIDQRLLND----WTFSLRQWIHGTIINRVVNEIDDINRRLMELGITDVVIGESNVQTLRHLTNQPVTPFPTLGALINFLDCSKDQAYVVNRLKELAQGCSLGKFQWDGGSSDARHPWKEHLPNDTMLVLHMLCTYIEVRYAVHSNLHGVRTF-SQQFITDNVMSKDANEMKDAFLLYQTCVQPPHFKVIFNQSLYEIPPGRKNLFHCLLVFFYKIYSNEGNF 1655
            EVW R+    RL+ D    WT  LR WI+ TI+  +V EID IN +L  +G  ++ IGE+++ +L+          PTL A++ +LD + +Q Y+V R+KELA    +  F+W+GG +     W   LP D+ +++H+LCTY++ R   H      +TF SQ FI        +NE  + F ++Q+   PPH+++I+   +Y +P GR NLFH +L+F + I + E   
Sbjct:  312 EVWARITTS-RLVTDSIDSWTAKLRNWINDTILVHLVKEIDSINSQLRRMGCPELQIGEASISSLKQAAVVKACAIPTLNAIVQYLDITPNQEYLVERIKELAHSGCMSSFRWNGGGNLKNRKWDTDLPTDSAILMHILCTYLDSRLPPHPKYPDGKTFTSQHFIQTPHKPDLSNE--NLFCIHQSSTNPPHYQLIYQGHIYSLPKGRNNLFHTVLMFLFIIKTKESGM 537          
BLAST of Transmembrane protein 209 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001410.1 (pep scaffold:Pmarinus_7.0:GL501105:148750:151320:-1 gene:ENSPMAG00000001274.1 transcript:ENSPMAT00000001410.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.908 bits (250), Expect = 2.307e-25
Identity = 48/149 (32.21%), Postives = 81/149 (54.36%), Query Frame = 3
Query: 1266 LKELAQGCSLGKFQWDGGSSDARHPWKEHLPNDTMLVLHMLCTYIEVRYAVHSNLHGVRTFSQQFITDNVMSKDANEMKDAFLLYQTCVQPPHFKVIFNQSLYEIPPGRKNLFHCLLVFFYKIYSNE-GNFKWLNLGRSGMNINNIFAK 1709
            + +LA G  +  F+W+GG       W   LP D ++V+HMLCTY++ R   +      +TF+ Q    +    DA+  +    ++Q    P +++++++ +  E+P GR NLFH +L+F Y + + E G     NLG SG+NI  IF +
Sbjct:    1 VADLADGGCMSAFRWNGGGDYRGRKWDADLPTDAVMVMHMLCTYLDSRLPPNPRYPDGKTFTSQHFQRSPNKPDASSQQQGLYIHQISTNPANYQLVYHGTALELPKGRNNLFHTILMFLYIVKTKESGMLGRANLGMSGVNILWIFGE 149          
BLAST of Transmembrane protein 209 vs. Ensembl Nematostella
Match: EDO44341 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW31])

HSP 1 Score: 157.532 bits (397), Expect = 3.590e-44
Identity = 80/243 (32.92%), Postives = 134/243 (55.14%), Query Frame = 3
Query:  984 EVWKRLEIDQRLLNDWTFSLRQWIHGTIINRVVNEIDDINRRLMELGITDVVIGESNVQTLRHLTNQPVTPFPTLGALINFLDCSKDQAYVVNRLKELAQGCSLGKFQWDGGSSDARHPWKEHLPNDTMLVLHMLCTYIEVRYAVHSNLHGVRTFSQQFITDNVMSKDANEMKDAFLLYQTCVQPPHFKVIFNQSLYEIPPGRKNLFHCLLVFFYKIYSNE-GNFKWLNLGRSGMNINNIFAK 1709
            ++W +L I +  L+ WT + R+W+  TI+ R+V +ID +N  L  +G  ++ IG  ++ +LR +        P L A+I +L+ S +Q Y+V R++EL++G  LG ++W+ G      PW++ L  D+ +V+H+ CTY++ R          RTF+          K A+  K    +Y   + PPH+K++    +Y+IP GR NLFH ++ F + I +   G    +NLG SG+NI  I  K
Sbjct:    1 QIWNKLGITRADLDHWTENCRKWLCQTILVRLVEQIDSVNDVLCRIGCQELQIGTISLSSLRQVAVTKADQVPQLRAIIPYLEASTNQEYLVQRIRELSKGGCLGVYRWNSGGMFRGKPWEQDLFADSQIVMHLFCTYMDSRLPADPRFPDGRTFTGLHFL-KTPDKPADARKSDLSIYMARLHPPHYKIVVKDEVYDIPKGRNNLFHAIIFFLHHIKTEHYGMLGRVNLGLSGVNIMCIMNK 242          
BLAST of Transmembrane protein 209 vs. Ensembl Medaka
Match: tmem209 (transmembrane protein 209 [Source:NCBI gene;Acc:101169503])

HSP 1 Score: 175.637 bits (444), Expect = 2.165e-47
Identity = 82/244 (33.61%), Postives = 139/244 (56.97%), Query Frame = 3
Query:  984 EVWKRLEIDQRLLN---DWTFSLRQWIHGTIINRVVNEIDDINRRLMELGITDVVIGESNVQTLRHLTNQPVTPFPTLGALINFLDCSKDQAYVVNRLKELAQGCSLGKFQWDGGSSDARHPWKEHLPNDTMLVLHMLCTYIEVRYAVHSNLHGVRTFSQQFITDNVMSKDANEMKDAFLLYQTCVQPPHFKVIFNQSLYEIPPGRKNLFHCLLVFFYKIYSNE-GNFKWLNLGRSGMNINNIF 1703
            EVW R+   + +++    WT  LR WI  TI++ +V E+D +N +L  +G  ++ IGE+++ +L+       +  PTL +++ +LD + +Q Y+V+R+KELA    +  F+W+GG       W   LP D  +++H+ CTY++ R   H      +TF+ Q         D  + ++ F ++Q+   PPH+++I+   +Y +P GR NLFH +L+F Y I + E G    +NLG SG+NI  IF
Sbjct:  314 EVWARITTSRAVMDRIDSWTAKLRNWISDTILDPLVKEMDSVNSQLRRMGCPELQIGEASISSLKQAAVMKASSIPTLTSIVQYLDITPNQEYLVDRIKELAHSGCMSSFRWNGGGDLKNRKWDTDLPTDCAVLMHVFCTYLDSRLPPHPKYPDGKTFTSQHFRHTPDKPDVTK-ENVFCIHQSSTSPPHYQLIYQGHIYSLPKGRNNLFHTVLMFLYVIKTKESGMLGRVNLGLSGVNILWIF 556          
BLAST of Transmembrane protein 209 vs. Planmine SMEST
Match: SMESG000020027.1 (SMESG000020027.1)

HSP 1 Score: 1027.7 bits (2656), Expect = 0.000e+0
Identity = 556/556 (100.00%), Postives = 556/556 (100.00%), Query Frame = 3
Query:   48 MSSCRVIWSSPEIHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEIYFNLLQKILSFDKQYFNRYKLICKTLLTINLFFLICYAYQIIHAKFTIYAISHENKLLSMLKSILFDIMPQLKSYHEVFIQSKIYLRLFKKSTYSDEEKERARLNEERRKMLTKSYFPSMIMHQHNNNFNDRYVHRPDDHQASAMDPNPNPNYHHHRSCSPSGFHNNENEFKSLSSTPFNNMRVGSINFGGDITPIHSPGGQLELRTVPCMPAFRQXXXXXXXXXXXXXXXXRXXXXXXXARYSPGGIFINRSQPSGLLTEVPINEVWKRLEIDQRLLNDWTFSLRQWIHGTIINRVVNEIDDINRRLMELGITDVVIGESNVQTLRHLTNQPVTPFPTLGALINFLDCSKDQAYVVNRLKELAQGCSLGKFQWDGGSSDARHPWKEHLPNDTMLVLHMLCTYIEVRYAVHSNLHGVRTFSQQFITDNVMSKDANEMKDAFLLYQTCVQPPHFKVIFNQSLYEIPPGRKNLFHCLLVFFYKIYSNEGNFKWLNLGRSGMNINNIFAKLP 1715
            MSSCRVIWSSPEIHKKNKLKNAKLMNDLSSQLLKFQVLFFVFLIFEIYFNLLQKILSFDKQYFNRYKLICKTLLTINLFFLICYAYQIIHAKFTIYAISHENKLLSMLKSILFDIMPQLKSYHEVFIQSKIYLRLFKKSTYSDEEKERARLNEERRKMLTKSYFPSMIMHQHNNNFNDRYVHRPDDHQASAMDPNPNPNYHHHRSCSPSGFHNNENEFKSLSSTPFNNMRVGSINFGGDITPIHSPGGQLELRTVPCMPAFRQPLAAAAVATATLSPPPRIITTTTTARYSPGGIFINRSQPSGLLTEVPINEVWKRLEIDQRLLNDWTFSLRQWIHGTIINRVVNEIDDINRRLMELGITDVVIGESNVQTLRHLTNQPVTPFPTLGALINFLDCSKDQAYVVNRLKELAQGCSLGKFQWDGGSSDARHPWKEHLPNDTMLVLHMLCTYIEVRYAVHSNLHGVRTFSQQFITDNVMSKDANEMKDAFLLYQTCVQPPHFKVIFNQSLYEIPPGRKNLFHCLLVFFYKIYSNEGNFKWLNLGRSGMNINNIFAKLP
Sbjct:    1 MSSCRVIWSSPEIHKKNKLKNAKLMNDLSSQLLKFQVLFFVFLIFEIYFNLLQKILSFDKQYFNRYKLICKTLLTINLFFLICYAYQIIHAKFTIYAISHENKLLSMLKSILFDIMPQLKSYHEVFIQSKIYLRLFKKSTYSDEEKERARLNEERRKMLTKSYFPSMIMHQHNNNFNDRYVHRPDDHQASAMDPNPNPNYHHHRSCSPSGFHNNENEFKSLSSTPFNNMRVGSINFGGDITPIHSPGGQLELRTVPCMPAFRQPLAAAAVATATLSPPPRIITTTTTARYSPGGIFINRSQPSGLLTEVPINEVWKRLEIDQRLLNDWTFSLRQWIHGTIINRVVNEIDDINRRLMELGITDVVIGESNVQTLRHLTNQPVTPFPTLGALINFLDCSKDQAYVVNRLKELAQGCSLGKFQWDGGSSDARHPWKEHLPNDTMLVLHMLCTYIEVRYAVHSNLHGVRTFSQQFITDNVMSKDANEMKDAFLLYQTCVQPPHFKVIFNQSLYEIPPGRKNLFHCLLVFFYKIYSNEGNFKWLNLGRSGMNINNIFAKLP 556          
The following BLAST results are available for this feature:
BLAST of Transmembrane protein 209 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
TMEM2091.580e-4532.93transmembrane protein 209 [Source:HGNC Symbol;Acc:... [more]
TMEM2091.651e-4532.93transmembrane protein 209 [Source:HGNC Symbol;Acc:... [more]
TMEM2093.462e-3028.46transmembrane protein 209 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Transmembrane protein 209 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
B0464.61.733e-1223.89pep chromosome:WBcel235:III:9462989:9465965:-1 gen... [more]
B0464.61.733e-1223.89pep chromosome:WBcel235:III:9462989:9465477:-1 gen... [more]
back to top
BLAST of Transmembrane protein 209 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG64799.704e-2530.52gene:FBgn0036710 transcript:FBtr0075245[more]
CG64799.891e-2530.52gene:FBgn0036710 transcript:FBtr0331847[more]
CG64799.919e-2530.52gene:FBgn0036710 transcript:FBtr0075246[more]
back to top
BLAST of Transmembrane protein 209 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tmem2097.651e-4834.96transmembrane protein 209 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Transmembrane protein 209 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmem2094.110e-4534.55transmembrane protein 209 [Source:NCBI gene;Acc:49... [more]
tmem2092.270e-4132.89transmembrane protein 209 [Source:NCBI gene;Acc:49... [more]
tmem2092.405e-4132.89transmembrane protein 209 [Source:NCBI gene;Acc:49... [more]
tmem2093.128e-4132.89transmembrane protein 209 [Source:NCBI gene;Acc:49... [more]
tmem2093.558e-4132.89transmembrane protein 209 [Source:NCBI gene;Acc:49... [more]
back to top
BLAST of Transmembrane protein 209 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tmem2091.099e-4833.46transmembrane protein 209 [Source:MGI Symbol;Acc:M... [more]
Tmem2091.099e-4833.46transmembrane protein 209 [Source:MGI Symbol;Acc:M... [more]
Tmem2094.090e-4733.20transmembrane protein 209 [Source:MGI Symbol;Acc:M... [more]
Tmem2094.541e-4733.20transmembrane protein 209 [Source:MGI Symbol;Acc:M... [more]
Tmem2094.541e-4733.20transmembrane protein 209 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Transmembrane protein 209 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q68FR5|TM209_RAT3.177e-4633.07Transmembrane protein 209 OS=Rattus norvegicus OX=... [more]
sp|Q8BRG8|TM209_MOUSE3.177e-4633.20Transmembrane protein 209 OS=Mus musculus OX=10090... [more]
sp|Q96SK2|TM209_HUMAN7.586e-4532.93Transmembrane protein 209 OS=Homo sapiens OX=9606 ... [more]
sp|Q6GPP7|TM209_XENLA3.800e-4333.87Transmembrane protein 209 OS=Xenopus laevis OX=835... [more]
sp|Q5M7R3|TM209_XENTR2.591e-3933.33Transmembrane protein 209 OS=Xenopus tropicalis OX... [more]
back to top
BLAST of Transmembrane protein 209 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A075AAG71.930e-5641.47Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A4S2M9S22.060e-5542.21Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A183TH594.413e-5537.45Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A3Q0KSR01.550e-5440.74Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A5K4EVQ42.142e-5340.74Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
back to top
BLAST of Transmembrane protein 209 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tmem2099.077e-4836.84transmembrane protein 209 [Source:NCBI gene;Acc:10... [more]
tmem2092.685e-4435.81transmembrane protein 209 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Transmembrane protein 209 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000001410.12.307e-2532.21pep scaffold:Pmarinus_7.0:GL501105:148750:151320:-... [more]
back to top
BLAST of Transmembrane protein 209 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 209 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO443413.590e-4432.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transmembrane protein 209 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tmem2092.165e-4733.61transmembrane protein 209 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Transmembrane protein 209 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000020027.10.000e+0100.00SMESG000020027.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011415 ID=SMED30011415|Name=Transmembrane protein 209|organism=Schmidtea mediterranea sexual|type=transcript|length=1841bp
AAATATTTACCATTGTAATAAATTACATTTAAAAAGCTTCATTATATATG
TCTAGTTGTAGAGTTATTTGGTCTAGTCCAGAAATACATAAAAAGAACAA
GTTAAAAAATGCTAAGTTAATGAATGATTTATCATCCCAATTACTAAAAT
TTCAAGTGCTGTTTTTCGTCTTTTTAATATTTGAAATATATTTCAATTTA
TTGCAAAAAATTTTAAGTTTTGACAAACAATACTTCAATAGATATAAACT
AATCTGCAAAACATTGTTAACAATTAACTTATTCTTTTTGATATGTTATG
CATATCAAATAATCCATGCAAAATTTACAATTTATGCAATCAGCCATGAA
AATAAATTACTATCAATGCTAAAGTCGATTTTATTTGACATTATGCCGCA
ATTAAAATCCTATCACGAAGTATTTATCCAAAGTAAAATTTATTTACGAT
TATTTAAAAAGTCAACATATTCCGATGAAGAAAAAGAGAGAGCTAGACTG
AATGAAGAAAGAAGGAAAATGTTGACGAAATCTTATTTCCCGTCGATGAT
AATGCACCAGCATAACAACAATTTCAATGACAGATACGTCCACCGGCCGG
ATGACCACCAGGCATCTGCGATGGACCCTAATCCAAATCCCAATTATCAT
CATCATCGGTCTTGTTCTCCATCCGGGTTTCATAACAATGAAAATGAATT
CAAATCTTTATCATCAACGCCATTTAATAACATGAGAGTGGGCTCGATCA
ATTTCGGAGGAGATATAACCCCGATTCATTCACCCGGGGGTCAGCTGGAG
CTCCGTACTGTGCCATGCATGCCGGCATTTAGGCAGCCGTTGGCGGCAGC
GGCGGTGGCCACTGCTACATTATCACCACCACCGAGAATTATCACCACCA
CCACCACTGCCAGATATTCACCCGGTGGAATATTTATCAACAGGTCACAA
CCGTCGGGATTGCTAACCGAGGTGCCGATTAATGAGGTATGGAAGCGTTT
GGAAATTGATCAGCGGCTGCTGAATGACTGGACCTTTAGTTTGAGGCAGT
GGATCCACGGCACAATCATCAACCGAGTAGTCAATGAGATAGACGATATC
AACCGCAGGCTCATGGAATTGGGCATCACAGATGTCGTCATCGGCGAATC
CAACGTGCAAACCCTTCGGCATTTGACCAATCAGCCAGTGACGCCCTTCC
CGACTCTGGGAGCCCTCATCAACTTCCTGGACTGCTCAAAGGACCAAGCC
TATGTGGTGAACAGATTGAAAGAGCTGGCGCAAGGCTGCAGCCTCGGCAA
ATTCCAGTGGGACGGCGGCTCATCCGATGCCAGGCATCCGTGGAAGGAAC
ATCTGCCCAATGATACAATGCTCGTGCTCCACATGCTCTGCACTTATATC
GAGGTGCGATACGCAGTGCACTCCAACCTGCACGGGGTGAGGACGTTCAG
TCAGCAGTTCATCACCGATAATGTCATGAGCAAAGACGCCAATGAGATGA
AGGACGCCTTCCTGCTCTATCAGACTTGTGTGCAACCGCCGCATTTCAAG
GTGATTTTCAATCAATCGCTATATGAGATTCCTCCGGGACGGAAAAACCT
ATTCCACTGCTTGCTGGTGTTCTTCTACAAGATCTACAGCAACGAGGGCA
ATTTCAAGTGGCTCAACCTCGGCCGCTCAGGAATGAACATTAACAATATA
TTCGCCAAATTGCCGTGACCTTGAGCACCGCAACTGCATTGTATATGTGT
GTGTGTGTAGCAGTGCTGATGTGCCACTGCTGCGGCCTGCGTGGAGATTT
ATTGATGTTTTGTCTGTGCTAATATATCGATTTACTGAAAA
back to top

protein sequence of SMED30011415-orf-1

>SMED30011415-orf-1 ID=SMED30011415-orf-1|Name=SMED30011415-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=557bp
MSSCRVIWSSPEIHKKNKLKNAKLMNDLSSQLLKFQVLFFVFLIFEIYFN
LLQKILSFDKQYFNRYKLICKTLLTINLFFLICYAYQIIHAKFTIYAISH
ENKLLSMLKSILFDIMPQLKSYHEVFIQSKIYLRLFKKSTYSDEEKERAR
LNEERRKMLTKSYFPSMIMHQHNNNFNDRYVHRPDDHQASAMDPNPNPNY
HHHRSCSPSGFHNNENEFKSLSSTPFNNMRVGSINFGGDITPIHSPGGQL
ELRTVPCMPAFRQPLAAAAVATATLSPPPRIITTTTTARYSPGGIFINRS
QPSGLLTEVPINEVWKRLEIDQRLLNDWTFSLRQWIHGTIINRVVNEIDD
INRRLMELGITDVVIGESNVQTLRHLTNQPVTPFPTLGALINFLDCSKDQ
AYVVNRLKELAQGCSLGKFQWDGGSSDARHPWKEHLPNDTMLVLHMLCTY
IEVRYAVHSNLHGVRTFSQQFITDNVMSKDANEMKDAFLLYQTCVQPPHF
KVIFNQSLYEIPPGRKNLFHCLLVFFYKIYSNEGNFKWLNLGRSGMNINN
IFAKLP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR019176Cytochrome_B561-rel
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 141..161
NoneNo IPR availableTMHMMTMhelixcoord: 35..52
NoneNo IPR availableTMHMMTMhelixcoord: 73..90
IPR019176Cytochrome B561-relatedPFAMPF09786CytochromB561_Ncoord: 325..552
e-value: 1.4E-47
score: 163.0
IPR019176Cytochrome B561-relatedPANTHERPTHR21780UNCHARACTERIZEDcoord: 31..553