Extended synaptotagmin-like protein 2

Overview
NameExtended synaptotagmin-like protein 2
Smed IDSMED30011410
Length (bp)1305
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Extended synaptotagmin-like protein 2 (SMED30011410) t-SNE clustered cells

Violin plots show distribution of expression levels for Extended synaptotagmin-like protein 2 (SMED30011410) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Extended synaptotagmin-like protein 2 (SMED30011410) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Extended synaptotagmin-like protein 2 (SMED30011410) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011410

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30011410h1SMcG0018597 dd_Smed_v4_6587_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30011410h1SMcG0018597 dd_Smed_v4_6587_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30011410h1SMcG0018597 dd_Smed_v4_6587_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30011410h1SMcG0018597 dd_Smed_v4_5158_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011410h1SMcG0018597 dd_Smed_v4_5158_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30011410h1SMcG0018597 dd_Smed_v4_5158_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30011410h1SMcG0018597 dd_Smed_v4_5158_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30011410h1SMcG0018597 dd_Smed_v4_5158_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30011410h1SMcG0018597 dd_Smed_v4_5158_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011410h1SMcG0018597 dd_Smed_v4_5158_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Human
Match: ESYT3 (extended synaptotagmin 3 [Source:HGNC Symbol;Acc:HGNC:24295])

HSP 1 Score: 188.734 bits (478), Expect = 7.143e-54
Identity = 115/360 (31.94%), Postives = 197/360 (54.72%), Query Frame = 1
Query:  244 IWLLGYLQINILWGILGILTFIIYQIS----INEQRQKFKFGVDLSQDIKYTLGTVSNLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXXXXXXX---XDINFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPCGIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMDIRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEVXXXXXXXXXXFLGSVSFDVQSVYDRGIFD 1302
            ++L GYL ++I W +LG L ++ ++ +    +      F+F  +  + I   L    +LP+W+ FPDVE VEW N II + WP +++ M    R+ +  KI++K   L+      + FG   P++ GVK + N   +R  + +D+ I Y+   EI+    +I  G+   +++G LRV +  L+   PF GA+++  LQ PH+   +T    + + PG+       L DL+A  +VLPNR+ +P+KK ++     + +P GV+R++++EA  L   D  +     SDPY  + +G + F+S+TI  NLNP WNE FE +V     Q +E+++   +  ++DDFLGS+   +  V    + D
Sbjct:   49 VYLAGYLGLSITWLLLGALLWMWWRRNRRGKLGRLAAAFEFLDNEREFISRELRG-QHLPAWIHFPDVERVEWANKIISQTWPYLSMIMESKFREKLEPKIREKSIHLRTFTFTKLYFGQKCPRVNGVKAHTN-TCNRRRVTVDLQICYIGDCEISVELQKIQAGVNGIQLQGTLRVILEPLLVDKPFVGAVTVFFLQKPHLQINWTGLTNLLDAPGINDVSDSLLEDLIATHLVLPNRVTVPVKKGLDLTNLRFPLPCGVIRVHLLEAEQLAQKDNFLGLRGKSDPYAKVSIGLQHFRSRTIYRNLNPTWNEVFEFMVYEVPGQDLEVDL-YDEDTDRDDFLGSLQICLGDVMTNRVVD 405          
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Human
Match: ESYT3 (extended synaptotagmin 3 [Source:HGNC Symbol;Acc:HGNC:24295])

HSP 1 Score: 186.808 bits (473), Expect = 3.138e-51
Identity = 115/360 (31.94%), Postives = 197/360 (54.72%), Query Frame = 1
Query:  244 IWLLGYLQINILWGILGILTFIIYQIS----INEQRQKFKFGVDLSQDIKYTLGTVSNLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXXXXXXX---XDINFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPCGIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMDIRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEVXXXXXXXXXXFLGSVSFDVQSVYDRGIFD 1302
            ++L GYL ++I W +LG L ++ ++ +    +      F+F  +  + I   L    +LP+W+ FPDVE VEW N II + WP +++ M    R+ +  KI++K   L+      + FG   P++ GVK + N   +R  + +D+ I Y+   EI+    +I  G+   +++G LRV +  L+   PF GA+++  LQ PH+   +T    + + PG+       L DL+A  +VLPNR+ +P+KK ++     + +P GV+R++++EA  L   D  +     SDPY  + +G + F+S+TI  NLNP WNE FE +V     Q +E+++   +  ++DDFLGS+   +  V    + D
Sbjct:   49 VYLAGYLGLSITWLLLGALLWMWWRRNRRGKLGRLAAAFEFLDNEREFISRELRG-QHLPAWIHFPDVERVEWANKIISQTWPYLSMIMESKFREKLEPKIREKSIHLRTFTFTKLYFGQKCPRVNGVKAHTN-TCNRRRVTVDLQICYIGDCEISVELQKIQAGVNGIQLQGTLRVILEPLLVDKPFVGAVTVFFLQKPHLQINWTGLTNLLDAPGINDVSDSLLEDLIATHLVLPNRVTVPVKKGLDLTNLRFPLPCGVIRVHLLEAEQLAQKDNFLGLRGKSDPYAKVSIGLQHFRSRTIYRNLNPTWNEVFEFMVYEVPGQDLEVDL-YDEDTDRDDFLGSLQICLGDVMTNRVVD 405          
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Human
Match: ESYT2 (extended synaptotagmin 2 [Source:HGNC Symbol;Acc:HGNC:22211])

HSP 1 Score: 186.422 bits (472), Expect = 4.575e-51
Identity = 107/307 (34.85%), Postives = 178/307 (57.98%), Query Frame = 1
Query:  403 NLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXXXXXXX---XDINFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPC--GIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMD--IRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEVXXXXXXXXXXFLGSVSFDVQSVYDRGIFD 1302
            +LP+WV FPD E  EW+N  +  +WP I  F+ K+ R+TI   ++     L       ++ G  P +I GVK+Y  EN+ + +II+D+ I ++   EI+    +  C  G+K+ ++ G +RV +  LI  +P  GA+S+  L+ P +   +T    + ++PGL       ++D++++ +VLPNRI +P+  ++   +  + +P+GVLRI+ IEA  L+  D  ++      SDPY IIRVG + F+S+ I  NL+PKWNE +EA+V     Q +E+E+   +  +KDDFLGS+  D+  V    + D
Sbjct:  106 DLPAWVHFPDTERAEWLNKTVKHMWPFICQFIEKLFRETIEPAVRGANTHLSTFSFTKVDVGQQPLRINGVKVYT-ENVDKRQIILDLQISFVGNCEIDLEIKRYFCRAGVKSIQIHGTMRVILEPLIGDMPLVGALSIFFLRKPLLEINWTGLTNLLDVPGLNGLSDTIILDIISNYLVLPNRITVPLVSEVQIAQLRFPVPKGVLRIHFIEAQDLQGKDTYLKGLVKGKSDPYGIIRVGNQIFQSRVIKENLSPKWNEVYEALVYEHPGQELEIEL-FDEDPDKDDFLGSLMIDLIEVEKERLLD 410          
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Human
Match: ESYT2 (extended synaptotagmin 2 [Source:HGNC Symbol;Acc:HGNC:22211])

HSP 1 Score: 186.037 bits (471), Expect = 4.995e-51
Identity = 107/307 (34.85%), Postives = 178/307 (57.98%), Query Frame = 1
Query:  403 NLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXXXXXXX---XDINFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPC--GIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMD--IRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEVXXXXXXXXXXFLGSVSFDVQSVYDRGIFD 1302
            +LP+WV FPD E  EW+N  +  +WP I  F+ K+ R+TI   ++     L       ++ G  P +I GVK+Y  EN+ + +II+D+ I ++   EI+    +  C  G+K+ ++ G +RV +  LI  +P  GA+S+  L+ P +   +T    + ++PGL       ++D++++ +VLPNRI +P+  ++   +  + +P+GVLRI+ IEA  L+  D  ++      SDPY IIRVG + F+S+ I  NL+PKWNE +EA+V     Q +E+E+   +  +KDDFLGS+  D+  V    + D
Sbjct:  106 DLPAWVHFPDTERAEWLNKTVKHMWPFICQFIEKLFRETIEPAVRGANTHLSTFSFTKVDVGQQPLRINGVKVYT-ENVDKRQIILDLQISFVGNCEIDLEIKRYFCRAGVKSIQIHGTMRVILEPLIGDMPLVGALSIFFLRKPLLEINWTGLTNLLDVPGLNGLSDTIILDIISNYLVLPNRITVPLVSEVQIAQLRFPVPKGVLRIHFIEAQDLQGKDTYLKGLVKGKSDPYGIIRVGNQIFQSRVIKENLSPKWNEVYEALVYEHPGQELEIEL-FDEDPDKDDFLGSLMIDLIEVEKERLLD 410          
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Human
Match: ESYT2 (extended synaptotagmin 2 [Source:HGNC Symbol;Acc:HGNC:22211])

HSP 1 Score: 185.652 bits (470), Expect = 9.724e-51
Identity = 107/307 (34.85%), Postives = 178/307 (57.98%), Query Frame = 1
Query:  403 NLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXXXXXXX---XDINFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPC--GIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMD--IRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEVXXXXXXXXXXFLGSVSFDVQSVYDRGIFD 1302
            +LP+WV FPD E  EW+N  +  +WP I  F+ K+ R+TI   ++     L       ++ G  P +I GVK+Y  EN+ + +II+D+ I ++   EI+    +  C  G+K+ ++ G +RV +  LI  +P  GA+S+  L+ P +   +T    + ++PGL       ++D++++ +VLPNRI +P+  ++   +  + +P+GVLRI+ IEA  L+  D  ++      SDPY IIRVG + F+S+ I  NL+PKWNE +EA+V     Q +E+E+   +  +KDDFLGS+  D+  V    + D
Sbjct:  154 DLPAWVHFPDTERAEWLNKTVKHMWPFICQFIEKLFRETIEPAVRGANTHLSTFSFTKVDVGQQPLRINGVKVYT-ENVDKRQIILDLQISFVGNCEIDLEIKRYFCRAGVKSIQIHGTMRVILEPLIGDMPLVGALSIFFLRKPLLEINWTGLTNLLDVPGLNGLSDTIILDIISNYLVLPNRITVPLVSEVQIAQLRFPVPKGVLRIHFIEAQDLQGKDTYLKGLVKGKSDPYGIIRVGNQIFQSRVIKENLSPKWNEVYEALVYEHPGQELEIEL-FDEDPDKDDFLGSLMIDLIEVEKERLLD 458          
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Celegans
Match: esyt-2 (Extended SYnapTotagmin homolog [Source:UniProtKB/TrEMBL;Acc:O76835])

HSP 1 Score: 202.216 bits (513), Expect = 8.912e-58
Identity = 116/374 (31.02%), Postives = 204/374 (54.55%), Query Frame = 1
Query:  208 KSFIIISVGFSLI----WLLGYLQINILWGILGILTFIIYQ-ISINEQRQKFKFGVDLSQDIKYTLGTVSNLPSWVSFPDVESVEWINTIILRLWPNI----TVFMNKIIRDTIXXXXXXXXXXXXXXDINFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPCGIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMDIRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEVXXXXXXXXXXFLGSVSFDVQSVYDRGIFD 1302
            +S+++  VG +++    + LG    + +W ++ I+  +    +    +R+         ++ +  +  + +LP+WV FPD E VEW+N +I +LWP +      FMN  I   +  ++    K  K   ++ GD+P ++GG+K+Y   N+ RD II+D+D+ Y    +          G+ N +  G LR  +  L+P  P  G +S T L+ P ++F  T    +  +PGL   IR  +   +A   VLPN I +P+  D++  +  +  P+GV+R+ +IEA +L+  DI   +   SDPY  I+VG++ FK++TI+++LNP WNE FEA+VD    Q + +E+ D+D+   ++ LG +S D++ V  +G  D
Sbjct:    4 QSYLVPLVGSAILSTFTFFLGKWDYSFVWVLIIIIASVTKSYLWRKRERRLIALRATALREREVIMAQLQDLPAWVQFPDTERVEWLNKVIHQLWPYVGEYTKTFMNDFIIPQVKAQMPGMFKNFKFTKMDMGDIPCRVGGIKVYTT-NVGRDRIIVDMDVAYAGDADFTVSCCGFTGGMNNIQFSGKLRAILKPLLPYPPMVGGVSGTFLEMPKMDFNLTGMGEMVELPGLIDAIRSVINSQIAALCVLPNEIVVPLAPDVDVTQLYFPEPDGVVRLKIIEAKNLENRDISFIKKGKSDPYAEIQVGSQFFKTRTIDDDLNPIWNEYFEAVVDQADGQKLRIELFDEDQGKDEE-LGRLSVDLKLVQAKGTID 375          
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Celegans
Match: esyt-2 (Extended SYnapTotagmin homolog [Source:UniProtKB/TrEMBL;Acc:O76835])

HSP 1 Score: 202.216 bits (513), Expect = 8.912e-58
Identity = 116/374 (31.02%), Postives = 204/374 (54.55%), Query Frame = 1
Query:  208 KSFIIISVGFSLI----WLLGYLQINILWGILGILTFIIYQ-ISINEQRQKFKFGVDLSQDIKYTLGTVSNLPSWVSFPDVESVEWINTIILRLWPNI----TVFMNKIIRDTIXXXXXXXXXXXXXXDINFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPCGIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMDIRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEVXXXXXXXXXXFLGSVSFDVQSVYDRGIFD 1302
            +S+++  VG +++    + LG    + +W ++ I+  +    +    +R+         ++ +  +  + +LP+WV FPD E VEW+N +I +LWP +      FMN  I   +  ++    K  K   ++ GD+P ++GG+K+Y   N+ RD II+D+D+ Y    +          G+ N +  G LR  +  L+P  P  G +S T L+ P ++F  T    +  +PGL   IR  +   +A   VLPN I +P+  D++  +  +  P+GV+R+ +IEA +L+  DI   +   SDPY  I+VG++ FK++TI+++LNP WNE FEA+VD    Q + +E+ D+D+   ++ LG +S D++ V  +G  D
Sbjct:    4 QSYLVPLVGSAILSTFTFFLGKWDYSFVWVLIIIIASVTKSYLWRKRERRLIALRATALREREVIMAQLQDLPAWVQFPDTERVEWLNKVIHQLWPYVGEYTKTFMNDFIIPQVKAQMPGMFKNFKFTKMDMGDIPCRVGGIKVYTT-NVGRDRIIVDMDVAYAGDADFTVSCCGFTGGMNNIQFSGKLRAILKPLLPYPPMVGGVSGTFLEMPKMDFNLTGMGEMVELPGLIDAIRSVINSQIAALCVLPNEIVVPLAPDVDVTQLYFPEPDGVVRLKIIEAKNLENRDISFIKKGKSDPYAEIQVGSQFFKTRTIDDDLNPIWNEYFEAVVDQADGQKLRIELFDEDQGKDEE-LGRLSVDLKLVQAKGTID 375          
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Fly
Match: Esyt2 (gene:FBgn0266758 transcript:FBtr0084647)

HSP 1 Score: 236.498 bits (602), Expect = 1.007e-69
Identity = 133/377 (35.28%), Postives = 220/377 (58.36%), Query Frame = 1
Query:  196 FFYGKSFIIISVGFSLIWLLGYLQINILWGILG-ILTFIIYQIS-INEQRQKFKFGVDLSQDIKYTLGTVSNLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXXXXXXXXDINF-----GDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPCGIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMDIRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEVXXXXXXXXXXFLGSVSFDVQSVYDRGIFDT 1305
            +  GK   I+      I+L+GY+  ++ W I   IL+    Q++  +E+++       L+ +    L  +  LP+WV FPDVE  EW+N I+ ++WPN   F   ++++TI   +   L   K+    F     G +PP+IGGVKIY+ +N+ R+EII+D+D++Y    +INF    +  GIK+F++ G +RV +  LI  +P  G + +  L NP+++F     +   +MPGL   +R  +V+ + + +VLPN++ I + ++++ V      PEG+LRI+V+EA  L   DI +     SDPY II VGA++FK++ I+NN+NPKW+   EA V  +  Q VE+++ D D + KD+ LG  S D+ SV  +G+ D+
Sbjct:   45 YTLGKKVAIVGS----IYLVGYMGWSVAWLIAPVILSVARDQLAKTSEKKRDIAKASALASEKDVILARIDELPAWVYFPDVERCEWLNKILKQVWPNANHFARTLVKETIEPNVALALANYKMHGFRFDRIILGTIPPRIGGVKIYD-KNVDRNEIIMDLDLFYASDCDINFYLGGMKGGIKDFQIHGWVRVVMKPLIRSMPLVGGLQIFFLNNPNIDFNLVGVIDFMDMPGLSDLLRRIIVEQIGNVMVLPNKLPISLSEEVSAVALKMPEPEGILRIHVVEAKDLMKKDISVLGKGKSDPYAIINVGAQEFKTQIIDNNVNPKWDYWCEATVFIEMGQFVEIQLKDSDDSKKDENLGRASIDIASVIKKGVVDS 416          
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Fly
Match: Esyt2 (gene:FBgn0266758 transcript:FBtr0084648)

HSP 1 Score: 235.728 bits (600), Expect = 3.025e-69
Identity = 133/377 (35.28%), Postives = 220/377 (58.36%), Query Frame = 1
Query:  196 FFYGKSFIIISVGFSLIWLLGYLQINILWGILG-ILTFIIYQIS-INEQRQKFKFGVDLSQDIKYTLGTVSNLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXXXXXXXXDINF-----GDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPCGIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMDIRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEVXXXXXXXXXXFLGSVSFDVQSVYDRGIFDT 1305
            +  GK   I+      I+L+GY+  ++ W I   IL+    Q++  +E+++       L+ +    L  +  LP+WV FPDVE  EW+N I+ ++WPN   F   ++++TI   +   L   K+    F     G +PP+IGGVKIY+ +N+ R+EII+D+D++Y    +INF    +  GIK+F++ G +RV +  LI  +P  G + +  L NP+++F     +   +MPGL   +R  +V+ + + +VLPN++ I + ++++ V      PEG+LRI+V+EA  L   DI +     SDPY II VGA++FK++ I+NN+NPKW+   EA V  +  Q VE+++ D D + KD+ LG  S D+ SV  +G+ D+
Sbjct:   78 YTLGKKVAIVGS----IYLVGYMGWSVAWLIAPVILSVARDQLAKTSEKKRDIAKASALASEKDVILARIDELPAWVYFPDVERCEWLNKILKQVWPNANHFARTLVKETIEPNVALALANYKMHGFRFDRIILGTIPPRIGGVKIYD-KNVDRNEIIMDLDLFYASDCDINFYLGGMKGGIKDFQIHGWVRVVMKPLIRSMPLVGGLQIFFLNNPNIDFNLVGVIDFMDMPGLSDLLRRIIVEQIGNVMVLPNKLPISLSEEVSAVALKMPEPEGILRIHVVEAKDLMKKDISVLGKGKSDPYAIINVGAQEFKTQIIDNNVNPKWDYWCEATVFIEMGQFVEIQLKDSDDSKKDENLGRASIDIASVIKKGVVDS 449          
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Fly
Match: Esyt2 (gene:FBgn0266758 transcript:FBtr0334336)

HSP 1 Score: 233.417 bits (594), Expect = 2.080e-68
Identity = 130/377 (34.48%), Postives = 218/377 (57.82%), Query Frame = 1
Query:  196 FFYGKSFIIISVGFSLIWLLGYLQINILWGILG-ILTFIIYQIS-INEQRQKFKFGVDLSQDIKYTLGTVSNLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXXXXXXXXDINF-----GDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPCGIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMDIRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEVXXXXXXXXXXFLGSVSFDVQSVYDRGIFDT 1305
            +  GK   I+      I+L+GY+  ++ W I   IL+    Q++  +E+++       L+ +    L  +  LP+WV FPDVE  EW+N I+ ++WPN   F   ++++TI   +   L   K+    F     G +PP+IGGVKIY+ +N+ R+EII+D+D++Y    +INF    +  GIK+F++ G +RV +  LI  +P  G + +  L NP+++F     +   +MPGL   +R  +V+ + + +VLPN++ I + ++++ V      PEG+LRI+V+EA  L   DI +     SDPY II VGA++FK++ I+NN+NPKW+   EA+V+      + L + D D+ + D+ LG  S D+ SV  +G+ D+
Sbjct:   78 YTLGKKVAIVGS----IYLVGYMGWSVAWLIAPVILSVARDQLAKTSEKKRDIAKASALASEKDVILARIDELPAWVYFPDVERCEWLNKILKQVWPNANHFARTLVKETIEPNVALALANYKMHGFRFDRIILGTIPPRIGGVKIYD-KNVDRNEIIMDLDLFYASDCDINFYLGGMKGGIKDFQIHGWVRVVMKPLIRSMPLVGGLQIFFLNNPNIDFNLVGVIDFMDMPGLSDLLRRIIVEQIGNVMVLPNKLPISLSEEVSAVALKMPEPEGILRIHVVEAKDLMKKDISVLGKGKSDPYAIINVGAQEFKTQIIDNNVNPKWDYWCEAVVEVSQHAILVLRLFDWDRTSDDESLGRASIDIASVIKKGVVDS 449          
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Fly
Match: Esyt2 (gene:FBgn0266758 transcript:FBtr0306024)

HSP 1 Score: 224.942 bits (572), Expect = 2.465e-65
Identity = 128/381 (33.60%), Postives = 212/381 (55.64%), Query Frame = 1
Query:  196 FFYGKSFIIISVGFSLIWLLGYLQINILWGILG-ILTFIIYQIS-INEQRQKFKFGVDLSQDIKYTLGTVSNLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXXXXXXXXDINF-----GDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPCGIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMDIRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEV----XXXXXXXXXXFLGSVSFDVQSVYDRGIFDT 1305
            +  GK   I+      I+L+GY+  ++ W I   IL+    Q++  +E+++       L+ +    L  +  LP+WV FPDVE  EW+N I+ ++WPN   F   ++++TI   +   L   K+    F     G +PP+IGGVKIY+ +N+ R+EII+D+D++Y    +INF    +  GIK+F++ G +RV +  LI  +P  G + +  L NP+++F     +   +MPGL   +R  +V+ + + +VLPN++ I + ++++ V      PEG+LRI+V+EA  L   DI +     SDPY II VGA++FK++ I+NN+NPKW+   EA + T     +   +            DD LG  S D+ SV  +G+ D+
Sbjct:   78 YTLGKKVAIVGS----IYLVGYMGWSVAWLIAPVILSVARDQLAKTSEKKRDIAKASALASEKDVILARIDELPAWVYFPDVERCEWLNKILKQVWPNANHFARTLVKETIEPNVALALANYKMHGFRFDRIILGTIPPRIGGVKIYD-KNVDRNEIIMDLDLFYASDCDINFYLGGMKGGIKDFQIHGWVRVVMKPLIRSMPLVGGLQIFFLNNPNIDFNLVGVIDFMDMPGLSDLLRRIIVEQIGNVMVLPNKLPISLSEEVSAVALKMPEPEGILRIHVVEAKDLMKKDISVLGKGKSDPYAIINVGAQEFKTQIIDNNVNPKWDYWCEACIFTTIGHYIGFSLWDYDQTMPGVQSDDVLGRASIDIASVIKKGVVDS 453          
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Zebrafish
Match: esyt2b (extended synaptotagmin-like protein 2b [Source:ZFIN;Acc:ZDB-GENE-090615-2])

HSP 1 Score: 200.29 bits (508), Expect = 3.747e-56
Identity = 125/377 (33.16%), Postives = 214/377 (56.76%), Query Frame = 1
Query:  202 YGKSFIIISVGFSLIWLLGYLQINILWGILGILTFIIYQISINEQRQKFKFGV---DLSQDIKYTLGTVSNLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXXXXXXX---XDINFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPC--GIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMDIRI--FEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEVXXXXXXXXXXFLGSVSFDVQSVYDRGIFD 1302
            + K+F++I      I++LGY + +  W ++ +  F  ++ + N +  +    +   D    +K  L   + LPSWV +PDVE VEW+N  + ++WP +  F++K+ ++TI   I++    L       I+ GD P +I GVK+Y+ EN+ + +II+D+ I Y+   EI+    +  C  GIK+ ++ G LRV +  L+  +P  GA SL  L+ P ++  +T    I ++PGL  F  + + D+++  +VLPNRI +P+  ++   +  + +P+GVLRI  IEA +L+  D  +       SDPY ++ V  + F+SKTI   L+PKWNE +EA+V   S Q +E+E+   +  +KDDFLGS+  D+  ++     D
Sbjct:   57 FAKTFVVIFP----IYVLGYFEFSFSWLLIALTIFFFWKRNTNSKNTRLSRAMSIFDPDDAVKQELD-ATELPSWVHYPDVERVEWLNKTVNQMWPYVCQFVDKLFKETIEPAIKESNAHLSTFSFTKIDLGDKPLRINGVKVYS-ENVDKRQIIMDLQISYVGNTEIDVDVKRYYCRAGIKSIQLHGVLRVILEPLLGNMPLVGAFSLFFLKKPLLDINWTGLTNILDIPGLNGFSDQMIQDIISAYMVLPNRITVPLIGEVELAQLRFPMPKGVLRIYFIEAQNLEVKDTYLGGLIKGKSDPYGMLLVSNQLFRSKTIKECLHPKWNEVYEALVYEPSGQHLEIEL-FDEDPDKDDFLGSLMIDLTELHKEQKVD 426          
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Zebrafish
Match: esyt2b (extended synaptotagmin-like protein 2b [Source:ZFIN;Acc:ZDB-GENE-090615-2])

HSP 1 Score: 199.904 bits (507), Expect = 3.944e-56
Identity = 125/377 (33.16%), Postives = 214/377 (56.76%), Query Frame = 1
Query:  202 YGKSFIIISVGFSLIWLLGYLQINILWGILGILTFIIYQISINEQRQKFKFGV---DLSQDIKYTLGTVSNLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXXXXXXX---XDINFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPC--GIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMDIRI--FEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEVXXXXXXXXXXFLGSVSFDVQSVYDRGIFD 1302
            + K+F++I      I++LGY + +  W ++ +  F  ++ + N +  +    +   D    +K  L   + LPSWV +PDVE VEW+N  + ++WP +  F++K+ ++TI   I++    L       I+ GD P +I GVK+Y+ EN+ + +II+D+ I Y+   EI+    +  C  GIK+ ++ G LRV +  L+  +P  GA SL  L+ P ++  +T    I ++PGL  F  + + D+++  +VLPNRI +P+  ++   +  + +P+GVLRI  IEA +L+  D  +       SDPY ++ V  + F+SKTI   L+PKWNE +EA+V   S Q +E+E+   +  +KDDFLGS+  D+  ++     D
Sbjct:   57 FAKTFVVIFP----IYVLGYFEFSFSWLLIALTIFFFWKRNTNSKNTRLSRAMSIFDPDDAVKQELD-ATELPSWVHYPDVERVEWLNKTVNQMWPYVCQFVDKLFKETIEPAIKESNAHLSTFSFTKIDLGDKPLRINGVKVYS-ENVDKRQIIMDLQISYVGNTEIDVDVKRYYCRAGIKSIQLHGVLRVILEPLLGNMPLVGAFSLFFLKKPLLDINWTGLTNILDIPGLNGFSDQMIQDIISAYMVLPNRITVPLIGEVELAQLRFPMPKGVLRIYFIEAQNLEVKDTYLGGLIKGKSDPYGMLLVSNQLFRSKTIKECLHPKWNEVYEALVYEPSGQHLEIEL-FDEDPDKDDFLGSLMIDLTELHKEQKVD 426          
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Zebrafish
Match: esyt1a (extended synaptotagmin-like protein 1a [Source:ZFIN;Acc:ZDB-GENE-090311-55])

HSP 1 Score: 189.119 bits (479), Expect = 3.680e-52
Identity = 115/359 (32.03%), Postives = 202/359 (56.27%), Query Frame = 1
Query:  232 GFSLIWLLGYLQINILWGILGILTFIIYQISINEQRQKFK---FGVDLSQDIKYT--LGTVSNLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXXXXXXX---XDINFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPC--GIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMD--IRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEVXXXXXXXXXXFLGSVSFDV 1272
             F  ++L GY   +I   +LG+L +I ++ S + ++ + +   + ++  QD+  T    +  +LP+WV+FPDVE VEWIN I+ + WP +  ++ K++ +TI   I+     L+      ++ GD   K+ GVK Y      R ++I+D+ I Y    EIN    +  C  G+K  ++ G LRV +  LI  +P  GAI++  ++ P ++  +T    + ++PGL +     ++D +A  +VLPNR+ +P+  +++  +    +P G++RI+++EA +L A D  ++      SDPY ++RVG + F S  ++NNLNP+W E +E IV     Q +ELEV      ++DDFLG +  D+
Sbjct:   48 AFLPVYLAGYFGFSISVVLLGLLVYIGWKHSRDGKKARLQSAMYFLENEQDVTTTRVFRSKRDLPAWVNFPDVEKVEWINKILQQAWPFVGQYLEKLLVETIAPSIRATSAHLQTLSFTKVDLGDRAMKVVGVKAYTE--FDRRQVILDLYISYAGDVEINVEVKKYFCKAGVKGIQLHGKLRVILEPLIGDVPLVGAITMFFIRRPKLDINWTGMTNLLDIPGLNAMSDTMIMDAIASFLVLPNRLTVPLVANLHVAQLRSPLPRGIVRIHLLEAENLPAKDNYMKGVISGKSDPYAVLRVGTQIFTSHHVDNNLNPQWREMYEVIVHEVPGQELELEV-FDKDPDQDDFLGRMKLDL 403          

HSP 2 Score: 66.6254 bits (161), Expect = 3.242e-11
Identity = 36/75 (48.00%), Postives = 46/75 (61.33%), Query Frame = 1
Query:  997 EGVLRINVIEALSLKAMD--IRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEV 1215
            EGVLRI+++EA SL A D  +       SDPY+ IRVG   FKS+ I  NLNP WNE +E I+     Q VE ++
Sbjct:  634 EGVLRIHLVEAQSLVAKDNLMGGMMKGKSDPYVKIRVGGLAFKSQVIKENLNPVWNELYEVILTQLPGQEVEFDL 708          
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Zebrafish
Match: esyt3 (extended synaptotagmin-like protein 3 [Source:ZFIN;Acc:ZDB-GENE-050809-35])

HSP 1 Score: 187.578 bits (475), Expect = 1.035e-51
Identity = 111/361 (30.75%), Postives = 197/361 (54.57%), Query Frame = 1
Query:  244 IWLLGYLQINILWGILGILTFIIYQISINEQRQKFKFGVDLSQDIKYTLGT---VSNLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRD---TIXXXXXXXXXXXXXXDINFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQ-IPCGIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMDIRIFE--HNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEVXXXXXXXXXXFLGSVSFDVQSVY-DRGI 1296
            ++L G   +++ W +L +  + +++ +   + Q+    +D  ++ K  + T     ++P W+ F DVE   WIN I+ + WP   V+M K++ +   T+++ +   LK      ++ G   P I G++ Y +E  +R E+I+D++I Y    +I+   N+ I  GIK  +++G LRV +  LI Q P  G +++  ++ P +   +T    + + PGL      ++VD++A  +VLPNR+C P+   +   +  + +P GV+R++V+EA  L A D  +       SDPY ++RVG + FK+KTI   LNP+WNE +E ++     Q +E+E+   +  + DDFLG  S D   V  DR I
Sbjct:   44 VYLTGTFGLSVSWILLSMFMWTMWKNNRRWKEQRIDTAIDFLENEKDVISTELKAMDMPPWIHFADVEKAAWINKILQQSWPFFGVYMEKLLIENIQTVVRSVHPHLKTFTFTKVHMGQKAPTITGIRAYTDELETR-EVILDLNIVYEADVDIDADVNRAIKVGIKGLQLQGMLRVILEPLIGQAPLVGGVTMFFIRRPALQINWTGVTNVLDGPGLSHLSESAIVDVIASLMVLPNRMCFPLIDQVKVEQMRFPLPRGVVRVHVLEARDLVAKDSHMMGLVKGKSDPYTVLRVGNKHFKTKTIKETLNPRWNEVYEFVIHEAPGQELEVEL-YDEDKDADDFLGRFSMDCGDVRKDREI 402          
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Zebrafish
Match: esyt2a (extended synaptotagmin-like protein 2a [Source:ZFIN;Acc:ZDB-GENE-070912-588])

HSP 1 Score: 182.57 bits (462), Expect = 5.765e-50
Identity = 126/404 (31.19%), Postives = 219/404 (54.21%), Query Frame = 1
Query:  130 LMDIDNKSETLSDTQSSVKLKVFFYGKSFIIISVGFSLIWLLGYLQINILWGILGILTFIIYQISINEQR------QKFKFGVDLSQDIKYTLGTVSNLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXXXXXXX---XDINFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPC--GIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMDIRI--FEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEVXXXXXXXXXXFLGSVSFDVQSVYDRGIFD 1302
            L D + +S     TQ  +K     + K+F++I   F  I+LLGYL+ +  W ++G+   +++ +  N+        Q   F     + ++ T+ + S LP WV FPDVE VEW+N  + ++WP I  F+ KI ++TI   +Q     L       I+ GD P ++ GVK+Y  EN+ + +II+D+ I ++   EI+    +  C  GIK+ ++ G LRV +  L+  +P  GA+S+  L+ P ++  +T    + ++PG+ S     + D++   +V PN+I IP+  D    K  + +P G+LR++ +E   L + D  +       SDPY +I++  + F+SK I ++LNP+WNE +EAIV     Q V +E+   +  + DDFLGS++ ++  +  +   D
Sbjct:   38 LPDEEPQSSVTEATQMGIK-----FAKTFLLI---FP-IYLLGYLEFSFSWVLIGL--GLVFWLKRNQGSRFARVNQAMAFLEQEERAVRQTIRS-SELPPWVHFPDVERVEWLNKTVQQMWPYICQFVEKIFKETIEPAVQGANTHLSTFTFSKIDMGDKPLRVDGVKVYT-ENVDKRQIIMDLQINFVGNTEIDVDIKKYYCRAGIKSIQLNGVLRVIMEPLLGDMPLVGALSVFFLKKPFLDINWTGLTNMLDIPGVNSLCDNVIQDIINGCLVNPNKITIPLADDALISKLRFPMPRGILRVHFLEGQDLLSKDTYMGGLIKGKSDPYGVIQINNQLFRSKIIKDSLNPRWNEVYEAIVYDGQGQVVFIEL-FDEDTDHDDFLGSLTMEIDEIQKQQKVD 427          
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Xenopus
Match: gdpd5 (glycerophosphodiester phosphodiesterase domain containing 5 [Source:Xenbase;Acc:XB-GENE-5789660])

HSP 1 Score: 201.83 bits (512), Expect = 2.048e-57
Identity = 121/388 (31.19%), Postives = 217/388 (55.93%), Query Frame = 1
Query:  178 SVKLKVFFY--GKSFIIISVGFSLIWLLGYLQINILWGILGILTFIIYQISINEQRQKF----KFGVDLSQDIKYTLGTVSNLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXXXXXXXXD---INFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPC--GIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMD--IRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEVXXXXXXXXXXFLGSVSFDVQSVYDRGIFD 1302
            SV +   FY   K+F++I      +++LGY  ++  W ++ ++  + ++ +   +  +      F     + +K+ + ++ +LP+WV FPD+E  EW+N  +  +WP I  F+ K+ R+TI   ++     L   +   I+ G  P ++ GVK+Y  EN+ + +II+D+ I ++   EI+    +  C  G+K+ ++ G +RV +  LI  +P  GA+S+  L+ P +   +T    + +MPGL       ++D++++ +VLPNRI +P+  D+   +  + IP+GVLRI+ +EA  L   D  ++      SDPY ++R+G + F+SK I  NLNPKWNE +EA+V     Q +E+E+   +  +KDDFLGS+  D+  V    + D
Sbjct:   38 SVDIAGLFYQFSKTFVLIFP----VYVLGYFGLSFSWLLIALVLLVWWRKNKGNKNSRLYRALAFLESEEKSVKHHIASI-DLPAWVHFPDIERAEWLNKTVKHMWPYICQFIEKLFRETIEPAVRGANAHLSTFNFTKIDMGSQPLRVNGVKVYT-ENVDKRQIILDLQISFVGETEIDLEVKRYFCRAGVKSIQLHGTMRVVLEPLIGDVPIVGALSIFFLRKPLLEINWTGLTNMLDMPGLNGLSDTIILDIISNYLVLPNRITVPLVSDVQIAQLRFPIPKGVLRIHFLEAQDLMWKDTYMKGLVKGKSDPYGVVRLGNQVFQSKVIKENLNPKWNEVYEALVHEHPGQELEIEL-FDEDTDKDDFLGSLLIDLVEVEKERVVD 418          
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Xenopus
Match: gdpd5 (glycerophosphodiester phosphodiesterase domain containing 5 [Source:Xenbase;Acc:XB-GENE-5789660])

HSP 1 Score: 201.83 bits (512), Expect = 2.179e-57
Identity = 121/388 (31.19%), Postives = 217/388 (55.93%), Query Frame = 1
Query:  178 SVKLKVFFY--GKSFIIISVGFSLIWLLGYLQINILWGILGILTFIIYQISINEQRQKF----KFGVDLSQDIKYTLGTVSNLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXXXXXXXXD---INFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPC--GIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMD--IRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEVXXXXXXXXXXFLGSVSFDVQSVYDRGIFD 1302
            SV +   FY   K+F++I      +++LGY  ++  W ++ ++  + ++ +   +  +      F     + +K+ + ++ +LP+WV FPD+E  EW+N  +  +WP I  F+ K+ R+TI   ++     L   +   I+ G  P ++ GVK+Y  EN+ + +II+D+ I ++   EI+    +  C  G+K+ ++ G +RV +  LI  +P  GA+S+  L+ P +   +T    + +MPGL       ++D++++ +VLPNRI +P+  D+   +  + IP+GVLRI+ +EA  L   D  ++      SDPY ++R+G + F+SK I  NLNPKWNE +EA+V     Q +E+E+   +  +KDDFLGS+  D+  V    + D
Sbjct:   38 SVDIAGLFYQFSKTFVLIFP----VYVLGYFGLSFSWLLIALVLLVWWRKNKGNKNSRLYRALAFLESEEKSVKHHIASI-DLPAWVHFPDIERAEWLNKTVKHMWPYICQFIEKLFRETIEPAVRGANAHLSTFNFTKIDMGSQPLRVNGVKVYT-ENVDKRQIILDLQISFVGETEIDLEVKRYFCRAGVKSIQLHGTMRVVLEPLIGDVPIVGALSIFFLRKPLLEINWTGLTNMLDMPGLNGLSDTIILDIISNYLVLPNRITVPLVSDVQIAQLRFPIPKGVLRIHFLEAQDLMWKDTYMKGLVKGKSDPYGVVRLGNQVFQSKVIKENLNPKWNEVYEALVHEHPGQELEIEL-FDEDTDKDDFLGSLLIDLVEVEKERVVD 418          
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Xenopus
Match: gdpd5 (glycerophosphodiester phosphodiesterase domain containing 5 [Source:Xenbase;Acc:XB-GENE-5789660])

HSP 1 Score: 199.134 bits (505), Expect = 4.565e-57
Identity = 111/359 (30.92%), Postives = 202/359 (56.27%), Query Frame = 1
Query:  178 SVKLKVFFY--GKSFIIISVGFSLIWLLGYLQINILWGILGILTFIIYQISINEQRQKF----KFGVDLSQDIKYTLGTVSNLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXXXXXXXXD---INFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPC--GIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMD--IRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEV 1215
            SV +   FY   K+F++I      +++LGY  ++  W ++ ++  + ++ +   +  +      F     + +K+ + ++ +LP+WV FPD+E  EW+N  +  +WP I  F+ K+ R+TI   ++     L   +   I+ G  P ++ GVK+Y  EN+ + +II+D+ I ++   EI+    +  C  G+K+ ++ G +RV +  LI  +P  GA+S+  L+ P +   +T    + +MPGL       ++D++++ +VLPNRI +P+  D+   +  + IP+GVLRI+ +EA  L   D  ++      SDPY ++R+G + F+SK I  NLNPKWNE +EA+V     Q +E+E+
Sbjct:   25 SVDIAGLFYQFSKTFVLIFP----VYVLGYFGLSFSWLLIALVLLVWWRKNKGNKNSRLYRALAFLESEEKSVKHHIASI-DLPAWVHFPDIERAEWLNKTVKHMWPYICQFIEKLFRETIEPAVRGANAHLSTFNFTKIDMGSQPLRVNGVKVYT-ENVDKRQIILDLQISFVGETEIDLEVKRYFCRAGVKSIQLHGTMRVVLEPLIGDVPIVGALSIFFLRKPLLEINWTGLTNMLDMPGLNGLSDTIILDIISNYLVLPNRITVPLVSDVQIAQLRFPIPKGVLRIHFLEAQDLMWKDTYMKGLVKGKSDPYGVVRLGNQVFQSKVIKENLNPKWNEVYEALVHEHPGQELEIEL 377          
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Xenopus
Match: gdpd5 (glycerophosphodiester phosphodiesterase domain containing 5 [Source:Xenbase;Acc:XB-GENE-5789660])

HSP 1 Score: 199.519 bits (506), Expect = 7.397e-57
Identity = 111/359 (30.92%), Postives = 202/359 (56.27%), Query Frame = 1
Query:  178 SVKLKVFFY--GKSFIIISVGFSLIWLLGYLQINILWGILGILTFIIYQISINEQRQKF----KFGVDLSQDIKYTLGTVSNLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXXXXXXXXD---INFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPC--GIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMD--IRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEV 1215
            SV +   FY   K+F++I      +++LGY  ++  W ++ ++  + ++ +   +  +      F     + +K+ + ++ +LP+WV FPD+E  EW+N  +  +WP I  F+ K+ R+TI   ++     L   +   I+ G  P ++ GVK+Y  EN+ + +II+D+ I ++   EI+    +  C  G+K+ ++ G +RV +  LI  +P  GA+S+  L+ P +   +T    + +MPGL       ++D++++ +VLPNRI +P+  D+   +  + IP+GVLRI+ +EA  L   D  ++      SDPY ++R+G + F+SK I  NLNPKWNE +EA+V     Q +E+E+
Sbjct:   25 SVDIAGLFYQFSKTFVLIFP----VYVLGYFGLSFSWLLIALVLLVWWRKNKGNKNSRLYRALAFLESEEKSVKHHIASI-DLPAWVHFPDIERAEWLNKTVKHMWPYICQFIEKLFRETIEPAVRGANAHLSTFNFTKIDMGSQPLRVNGVKVYT-ENVDKRQIILDLQISFVGETEIDLEVKRYFCRAGVKSIQLHGTMRVVLEPLIGDVPIVGALSIFFLRKPLLEINWTGLTNMLDMPGLNGLSDTIILDIISNYLVLPNRITVPLVSDVQIAQLRFPIPKGVLRIHFLEAQDLMWKDTYMKGLVKGKSDPYGVVRLGNQVFQSKVIKENLNPKWNEVYEALVHEHPGQELEIEL 377          
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Xenopus
Match: gdpd5 (glycerophosphodiester phosphodiesterase domain containing 5 [Source:Xenbase;Acc:XB-GENE-5789660])

HSP 1 Score: 199.134 bits (505), Expect = 8.125e-57
Identity = 111/359 (30.92%), Postives = 202/359 (56.27%), Query Frame = 1
Query:  178 SVKLKVFFY--GKSFIIISVGFSLIWLLGYLQINILWGILGILTFIIYQISINEQRQKF----KFGVDLSQDIKYTLGTVSNLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXXXXXXXXD---INFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPC--GIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMD--IRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEV 1215
            SV +   FY   K+F++I      +++LGY  ++  W ++ ++  + ++ +   +  +      F     + +K+ + ++ +LP+WV FPD+E  EW+N  +  +WP I  F+ K+ R+TI   ++     L   +   I+ G  P ++ GVK+Y  EN+ + +II+D+ I ++   EI+    +  C  G+K+ ++ G +RV +  LI  +P  GA+S+  L+ P +   +T    + +MPGL       ++D++++ +VLPNRI +P+  D+   +  + IP+GVLRI+ +EA  L   D  ++      SDPY ++R+G + F+SK I  NLNPKWNE +EA+V     Q +E+E+
Sbjct:   38 SVDIAGLFYQFSKTFVLIFP----VYVLGYFGLSFSWLLIALVLLVWWRKNKGNKNSRLYRALAFLESEEKSVKHHIASI-DLPAWVHFPDIERAEWLNKTVKHMWPYICQFIEKLFRETIEPAVRGANAHLSTFNFTKIDMGSQPLRVNGVKVYT-ENVDKRQIILDLQISFVGETEIDLEVKRYFCRAGVKSIQLHGTMRVVLEPLIGDVPIVGALSIFFLRKPLLEINWTGLTNMLDMPGLNGLSDTIILDIISNYLVLPNRITVPLVSDVQIAQLRFPIPKGVLRIHFLEAQDLMWKDTYMKGLVKGKSDPYGVVRLGNQVFQSKVIKENLNPKWNEVYEALVHEHPGQELEIEL 390          
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Mouse
Match: Esyt2 (extended synaptotagmin-like protein 2 [Source:MGI Symbol;Acc:MGI:1261845])

HSP 1 Score: 195.667 bits (496), Expect = 1.247e-54
Identity = 119/363 (32.78%), Postives = 200/363 (55.10%), Query Frame = 1
Query:  244 IWLLGYLQINILWGIL--GILTFIIYQISINEQRQKFKFGVDLSQDIKYTLG-TVSNLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXXXXXXX---XDINFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPC--GIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMD--IRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEVXXXXXXXXXXFLGSVSFDVQSVYDRGIFD 1302
            ++ LGYL ++  W +L  G+L +      +   R      +   ++    LG    +LP+WV FPD E  EW+N  +  +WP I  F+ K+ R+TI   ++     L       ++ G  P ++ GVK+Y  EN+ + +II+D+ I ++   EI+    +  C  G+K+ ++ G +RV +  LI  +P  GA+S+  L+ P +   +T    + ++PGL       ++D++++ +VLPNRI +P+  ++   +  + IP+GVLRI+ IEA  L+  D  ++      SDPY IIRVG + F+SK I  NL+PKWNE +EA+V     Q +E+E+   +  +KDDFLGS+  D+  V    + D
Sbjct:   50 VYALGYLGLSFSWVLLALGLLAWCRRSRGLKASRLCRALALLEDEEQAVRLGVRACDLPAWVHFPDTERAEWLNKTVKHMWPFICQFIEKLFRETIEPAVRGANAHLSTFSFTKVDVGQQPLRVNGVKVYT-ENVDKRQIILDLQISFVGNCEIDLEIKRYFCRAGVKSIQIHGTMRVILEPLIGDMPLVGALSIFFLRKPLLEINWTGLTNLLDIPGLNGLSDTIILDIISNYLVLPNRITVPLVSEVQIAQLRFPIPKGVLRIHFIEAQDLQGKDTYLKGLVKGKSDPYGIIRVGNQIFQSKVIKENLSPKWNEVYEALVYEHPGQELEIEL-FDEDPDKDDFLGSLMIDLIEVEKERLLD 410          
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Mouse
Match: Esyt2 (extended synaptotagmin-like protein 2 [Source:MGI Symbol;Acc:MGI:1261845])

HSP 1 Score: 195.667 bits (496), Expect = 1.247e-54
Identity = 119/363 (32.78%), Postives = 200/363 (55.10%), Query Frame = 1
Query:  244 IWLLGYLQINILWGIL--GILTFIIYQISINEQRQKFKFGVDLSQDIKYTLG-TVSNLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXXXXXXX---XDINFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPC--GIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMD--IRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEVXXXXXXXXXXFLGSVSFDVQSVYDRGIFD 1302
            ++ LGYL ++  W +L  G+L +      +   R      +   ++    LG    +LP+WV FPD E  EW+N  +  +WP I  F+ K+ R+TI   ++     L       ++ G  P ++ GVK+Y  EN+ + +II+D+ I ++   EI+    +  C  G+K+ ++ G +RV +  LI  +P  GA+S+  L+ P +   +T    + ++PGL       ++D++++ +VLPNRI +P+  ++   +  + IP+GVLRI+ IEA  L+  D  ++      SDPY IIRVG + F+SK I  NL+PKWNE +EA+V     Q +E+E+   +  +KDDFLGS+  D+  V    + D
Sbjct:   50 VYALGYLGLSFSWVLLALGLLAWCRRSRGLKASRLCRALALLEDEEQAVRLGVRACDLPAWVHFPDTERAEWLNKTVKHMWPFICQFIEKLFRETIEPAVRGANAHLSTFSFTKVDVGQQPLRVNGVKVYT-ENVDKRQIILDLQISFVGNCEIDLEIKRYFCRAGVKSIQIHGTMRVILEPLIGDMPLVGALSIFFLRKPLLEINWTGLTNLLDIPGLNGLSDTIILDIISNYLVLPNRITVPLVSEVQIAQLRFPIPKGVLRIHFIEAQDLQGKDTYLKGLVKGKSDPYGIIRVGNQIFQSKVIKENLSPKWNEVYEALVYEHPGQELEIEL-FDEDPDKDDFLGSLMIDLIEVEKERLLD 410          
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Mouse
Match: Esyt3 (extended synaptotagmin-like protein 3 [Source:MGI Symbol;Acc:MGI:1098699])

HSP 1 Score: 188.734 bits (478), Expect = 5.274e-52
Identity = 116/360 (32.22%), Postives = 201/360 (55.83%), Query Frame = 1
Query:  244 IWLLGYLQINILWGILGILTFIIYQIS----INEQRQKFKFGVDLSQDIKYTLGTVSNLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXXXXXXX---XDINFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPCGIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMDIRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEVXXXXXXXXXXFLGSVSFDVQSVYDRGIFD 1302
            ++L GYL +++ W +LG L ++ ++ +    +      F+F     + I   L    +LP+W+ FPDVE VEW N II+++WP +++ M   IR+ +  KI++K   L+      + FG   PK+ GVK++ ++  +R ++ +D+ I Y+   EI+    +I  G+   +++G LRV +  L+   PF GA+++  LQ PH+   +T    + +MPG+       L DL+A  +VLPNR+ +P+KK ++       +P GV+R++++EA  L   D  +     SDPY  + +G +  +S+TI  NLNP WNE FE +V     Q +E+++   +  +KDDFLGS+   +  V    + D
Sbjct:   53 VYLAGYLGLSVTWLLLGALLWMWWRRNRRGKLGRLEAAFEFLEHEREFISREL-RGQHLPAWIHFPDVERVEWANKIIIQIWPYLSMIMENKIREKLEPKIREKSIHLRTFTFTKLYFGQKCPKVNGVKVHTDKR-NRRKVTLDLQICYIGDCEISVELQKIRGGVSGVQLQGTLRVILEPLLVDKPFIGAVTVFFLQKPHLQINWTGLTNLLDMPGINELSDSLLEDLIAAHLVLPNRVTVPVKKGLDVTNLRVPLPCGVIRVHLLEAKKLAQKDNFLGLGGKSDPYAKVSIGLQHCRSRTIYKNLNPTWNEVFEFMVYEVPGQDLEVDL-YDEDTDKDDFLGSLQICLGDVMKNRVVD 409          
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Mouse
Match: Esyt1 (extended synaptotagmin-like protein 1 [Source:MGI Symbol;Acc:MGI:1344426])

HSP 1 Score: 176.407 bits (446), Expect = 1.462e-47
Identity = 107/366 (29.23%), Postives = 201/366 (54.92%), Query Frame = 1
Query:  244 IWLLGYLQINILWGILGILTFIIYQISINEQRQKFKFGVDLSQDI-KYTLGTV----SNLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXXXXXXX---XDINFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPC--GIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKV-KFMYHIPEGVLRINVIEALSLKAMD--IRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEVXXXXXXXXXXFLGSVSFDVQSVYDRGIFD 1302
            ++L G   +++ + + G+  ++ ++   + + +  +    L  D  + T  T+      LP+WVSFPDVE  EW+N I+ ++WP +  +M K++ +T+   ++     L+      +  G+ P +I GVK++ ++   +D+I++D+++ Y+   +I+    +  C  G+K  ++ G LRV +  L   +P  GA+S+  ++ P ++  +T    + ++PGL S     ++D +A  +VLPNR+ +P+  D+  V +    +P G++RI+++ A  L + D  ++      SDPY ++RVG + F S+ I+  LNP W ET+E IV     Q +E+EV      +KDDFLG +  DV  V   G+ D
Sbjct:   58 VYLAGAAGLSVGFVLFGLALYLGWRRVRDGKERSLRAARQLLDDEERITAETLYMSHRELPAWVSFPDVEKAEWLNKIVAQVWPFLGQYMEKLLAETVAPAVRGANPHLQTFTFTRVELGEKPLRIIGVKVHPSQR--KDQILLDLNVSYVGDVQIDVEVKKYFCKAGVKGMQLHGVLRVILEPLTGDLPIVGAVSMFFIKRPTLDINWTGMTNLLDIPGLSSLSDTMIMDSIAAFLVLPNRLLVPLVPDLQDVAQLRSPLPRGIIRIHLLAARGLSSKDKYVKGLIEGKSDPYALVRVGTQTFCSRVIDEELNPHWGETYEVIVHEVPGQEIEVEV-FDKDPDKDDFLGRMKLDVGKVLQAGVLD 420          

HSP 2 Score: 62.003 bits (149), Expect = 9.038e-10
Identity = 42/120 (35.00%), Postives = 61/120 (50.83%), Query Frame = 1
Query:  862 NMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMD--IRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEV 1215
             +PG + + RESL       V  P R   P     N     +   E VLRI+V+EA  L A D  +       SDPY+ ++V  + F++  +  +LNP+WNE FE IV +   Q +E+EV
Sbjct:  597 TVPGAQDWDRESLE--TGSSVDAPPR---PYHTTPNS----HFGTENVLRIHVLEAQDLIAKDRFLGGLVKGKSDPYVKLKVAGKSFRTHVVREDLNPRWNEVFEVIVTSIPGQELEIEV 707          
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Mouse
Match: Esyt2 (extended synaptotagmin-like protein 2 [Source:MGI Symbol;Acc:MGI:1261845])

HSP 1 Score: 129.798 bits (325), Expect = 9.943e-34
Identity = 73/260 (28.08%), Postives = 137/260 (52.69%), Query Frame = 1
Query:  244 IWLLGYLQINILWGIL--GILTFIIYQISINEQRQKFKFGVDLSQDIKYTLGT-VSNLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXXXXXXX---XDINFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPC--GIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPE 999
            ++ LGYL ++  W +L  G+L +      +   R      +   ++    LG    +LP+WV FPD E  EW+N  +  +WP I  F+ K+ R+TI   ++     L       ++ G  P ++ GVK+Y  EN+ + +II+D+ I ++   EI+    +  C  G+K+ ++ G +RV +  LI  +P  GA+S+  L+ P +   +T    + ++PGL       ++D++++ +VLPNRI +P+  ++   +  + IP+
Sbjct:   50 VYALGYLGLSFSWVLLALGLLAWCRRSRGLKASRLCRALALLEDEEQAVRLGVRACDLPAWVHFPDTERAEWLNKTVKHMWPFICQFIEKLFRETIEPAVRGANAHLSTFSFTKVDVGQQPLRVNGVKVYT-ENVDKRQIILDLQISFVGNCEIDLEIKRYFCRAGVKSIQIHGTMRVILEPLIGDMPLVGALSIFFLRKPLLEINWTGLTNLLDIPGLNGLSDTIILDIISNYLVLPNRITVPLVSEVQIAQLRFPIPK 308          
BLAST of Extended synaptotagmin-like protein 2 vs. UniProt/SwissProt
Match: sp|Q5M7N9|ESYT3_XENTR (Extended synaptotagmin-3 OS=Xenopus tropicalis OX=8364 GN=esyt3 PE=2 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 3.214e-55
Identity = 114/362 (31.49%), Postives = 204/362 (56.35%), Query Frame = 1
Query:  244 IWLLGYLQINILWGILGILTFIIYQISINEQRQKFKFGVDLSQDIKY--TLGT-VSNLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXXXXXXX---XDINFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINF-VYNQIPCGIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMD--IRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEVXXXXXXXXXXFLGSVSFDVQSVYDRGIFD 1302
            ++L G   ++  W + G+  ++ +  +   +  + +   DL ++ K   T G  +  LP+WV+FPDVE VEW+N ++ ++WP I +++ K+ +D +   ++     LK      ++ G+  P+I GVK Y  +N+ + E+I+D+ + Y    EIN  V      G+K  ++ G LRV +  L+P +PF GA+++  +Q PH++  +T    +  +PG+  F    +VD++A  +VLPNR  +P+   +   +  + +P GVLR+++IEA  L   D  ++      SDPY ++R+G + FKS+TI  NLNPKW E +E +V     Q +E+++   +  +KDDFLGS+   ++ V    + D
Sbjct:   90 VYLCGRFGLSPTWLLFGLFLWMFWTRNKKFKLARIQAAWDLHENEKLGVTRGLYLQQLPAWVNFPDVERVEWLNKVVGQMWPYIGMYVEKMFQDKVEPLVRSSSAHLKAFTFTKVHLGEKFPRINGVKSYT-KNVDKREVILDLQLSYNGDVEINVEVKKMCKAGVKGVQLHGTLRVILAPLLPDLPFVGAVTMFFIQRPHLDINWTGLTNVLEIPGVSDFSDSMIVDMIASHLVLPNRFTVPLSSQVQAAQLRFPLPHGVLRLHLIEAEDLIPKDNYLKGIIRGKSDPYAVLRIGNQNFKSRTIKENLNPKWGEMYEFVVHEVPGQDLEVDL-YDEDPDKDDFLGSLVIGLEGVMQDRVVD 449          
BLAST of Extended synaptotagmin-like protein 2 vs. UniProt/SwissProt
Match: sp|Q3TZZ7|ESYT2_MOUSE (Extended synaptotagmin-2 OS=Mus musculus OX=10090 GN=Esyt2 PE=1 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 8.722e-54
Identity = 119/363 (32.78%), Postives = 200/363 (55.10%), Query Frame = 1
Query:  244 IWLLGYLQINILWGIL--GILTFIIYQISINEQRQKFKFGVDLSQDIKYTLG-TVSNLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXXXXXXX---XDINFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPC--GIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMD--IRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEVXXXXXXXXXXFLGSVSFDVQSVYDRGIFD 1302
            ++ LGYL ++  W +L  G+L +      +   R      +   ++    LG    +LP+WV FPD E  EW+N  +  +WP I  F+ K+ R+TI   ++     L       ++ G  P ++ GVK+Y  EN+ + +II+D+ I ++   EI+    +  C  G+K+ ++ G +RV +  LI  +P  GA+S+  L+ P +   +T    + ++PGL       ++D++++ +VLPNRI +P+  ++   +  + IP+GVLRI+ IEA  L+  D  ++      SDPY IIRVG + F+SK I  NL+PKWNE +EA+V     Q +E+E+   +  +KDDFLGS+  D+  V    + D
Sbjct:   50 VYALGYLGLSFSWVLLALGLLAWCRRSRGLKASRLCRALALLEDEEQAVRLGVRACDLPAWVHFPDTERAEWLNKTVKHMWPFICQFIEKLFRETIEPAVRGANAHLSTFSFTKVDVGQQPLRVNGVKVYT-ENVDKRQIILDLQISFVGNCEIDLEIKRYFCRAGVKSIQIHGTMRVILEPLIGDMPLVGALSIFFLRKPLLEINWTGLTNLLDIPGLNGLSDTIILDIISNYLVLPNRITVPLVSEVQIAQLRFPIPKGVLRIHFIEAQDLQGKDTYLKGLVKGKSDPYGIIRVGNQIFQSKVIKENLSPKWNEVYEALVYEHPGQELEIEL-FDEDPDKDDFLGSLMIDLIEVEKERLLD 410          
BLAST of Extended synaptotagmin-like protein 2 vs. UniProt/SwissProt
Match: sp|Q7ZWU7|EST2B_XENLA (Extended synaptotagmin-2-B OS=Xenopus laevis OX=8355 GN=esyt2-b PE=2 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 2.003e-52
Identity = 110/318 (34.59%), Postives = 185/318 (58.18%), Query Frame = 1
Query:  370 QDIKYTLGTVSNLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXXXXXXX---XDINFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPC--GIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMD--IRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEVXXXXXXXXXXFLGSVSFDVQSVYDRGIFD 1302
            + +K+ + ++ +LP+WV FPD+E  EW+N  +  +WP I  F+ K+ R+TI   ++     L       I+ G  P +I GVK+Y  EN+ + +II+D+ I ++   EI+    +  C  G+K+ ++ G +RV +  LI  +P  GA+S+  L+ P +   +T    + +MPGL       ++D++++ +VLPNRI +P+  D+   +  + IP+GVLRI+ +EA  L   D  ++      SDPY ++R+G + F+SK I  NLNPKWNE +EA+V     Q +E+E+   +  +KDDFLGS+  D+  V    + D
Sbjct:  104 KSVKHHIASI-DLPAWVHFPDIERAEWLNKTVKHMWPYICQFIEKLFRETIEPAVRGANAHLSTFSFTKIDMGSQPLRINGVKVYT-ENVDKRQIILDLQISFVGETEIDLEVKRYFCRAGVKSIQLHGTMRVILEPLIGDVPIVGALSIFFLRKPLLEINWTGLTNMLDMPGLNGLSDTIILDIISNYLVLPNRITVPLVSDVQIAQLRFPIPKGVLRIHFLEAQDLMWKDTYMKGLVKGKSDPYGVVRLGNQVFQSKVIKENLNPKWNEVYEALVHEHPGQELEIEL-FDEDTDKDDFLGSLLIDLVEVEKERVVD 418          
BLAST of Extended synaptotagmin-like protein 2 vs. UniProt/SwissProt
Match: sp|Q5FWL4|EST2A_XENLA (Extended synaptotagmin-2-A OS=Xenopus laevis OX=8355 GN=esyt2-a PE=2 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 6.098e-52
Identity = 110/318 (34.59%), Postives = 185/318 (58.18%), Query Frame = 1
Query:  370 QDIKYTLGTVSNLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXXXXXXX---XDINFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPC--GIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMD--IRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEVXXXXXXXXXXFLGSVSFDVQSVYDRGIFD 1302
            + +K+ + + ++LP+WV FPD+E  EW+N  +  +WP I  F+ K+ R+TI   ++     L       I+ G  P +I GVK+Y  EN+ + +II+D+ I ++   EI+    +  C  G+K+ ++ G +RV +  LI  +P  GA+S+  L+ P +   +T    + +MPGL       ++D++++ +VLPNRI +P+  D+   +  + IP+GVLRI+ +EA  L   D  ++      SDPY ++R+G + F+SK I  NLNPKWNE +EA+V     Q +E+E+   +  +KDDFLGS+  D+  V    + D
Sbjct:  100 KSVKHHIAS-TDLPAWVHFPDIERAEWLNKTVKHMWPYICQFIEKLFRETIEPAVRGANAHLSTFNFTKIDMGSQPLRINGVKVYT-ENVDKRQIILDLQISFVGETEIDLEVKRYFCRAGVKSIQLHGTMRVILEPLIGDVPIVGALSIFFLRKPLLEINWTGLTNMLDMPGLNGLSDTIILDIISNYLVLPNRITVPLVSDVQIAQLRFPIPKGVLRIHFLEAQDLMWKDTYMKGLVKGKSDPYGVVRLGNQVFQSKVIKENLNPKWNEVYEALVHEHPGQELEIEL-FDEDTDKDDFLGSLLIDLVEVEKERVVD 414          
BLAST of Extended synaptotagmin-like protein 2 vs. UniProt/SwissProt
Match: sp|Q5DTI8|ESYT3_MOUSE (Extended synaptotagmin-3 OS=Mus musculus OX=10090 GN=Esyt3 PE=2 SV=2)

HSP 1 Score: 188.734 bits (478), Expect = 3.689e-51
Identity = 116/360 (32.22%), Postives = 201/360 (55.83%), Query Frame = 1
Query:  244 IWLLGYLQINILWGILGILTFIIYQIS----INEQRQKFKFGVDLSQDIKYTLGTVSNLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXXXXXXX---XDINFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPCGIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMDIRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEVXXXXXXXXXXFLGSVSFDVQSVYDRGIFD 1302
            ++L GYL +++ W +LG L ++ ++ +    +      F+F     + I   L    +LP+W+ FPDVE VEW N II+++WP +++ M   IR+ +  KI++K   L+      + FG   PK+ GVK++ ++  +R ++ +D+ I Y+   EI+    +I  G+   +++G LRV +  L+   PF GA+++  LQ PH+   +T    + +MPG+       L DL+A  +VLPNR+ +P+KK ++       +P GV+R++++EA  L   D  +     SDPY  + +G +  +S+TI  NLNP WNE FE +V     Q +E+++   +  +KDDFLGS+   +  V    + D
Sbjct:   53 VYLAGYLGLSVTWLLLGALLWMWWRRNRRGKLGRLEAAFEFLEHEREFISREL-RGQHLPAWIHFPDVERVEWANKIIIQIWPYLSMIMENKIREKLEPKIREKSIHLRTFTFTKLYFGQKCPKVNGVKVHTDKR-NRRKVTLDLQICYIGDCEISVELQKIRGGVSGVQLQGTLRVILEPLLVDKPFIGAVTVFFLQKPHLQINWTGLTNLLDMPGINELSDSLLEDLIAAHLVLPNRVTVPVKKGLDVTNLRVPLPCGVIRVHLLEAKKLAQKDNFLGLGGKSDPYAKVSIGLQHCRSRTIYKNLNPTWNEVFEFMVYEVPGQDLEVDL-YDEDTDKDDFLGSLQICLGDVMKNRVVD 409          
BLAST of Extended synaptotagmin-like protein 2 vs. TrEMBL
Match: A0A564YV52 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS9901 PE=4 SV=1)

HSP 1 Score: 258.84 bits (660), Expect = 9.669e-77
Identity = 146/395 (36.96%), Postives = 226/395 (57.22%), Query Frame = 1
Query:  139 IDNKSETLSDTQSSVKLKVFFYGKSFIIISVGFSLIWLLGYLQINILWGILGILTFIIYQISINEQRQKF------KFGVDLSQDIKYTLGTVSNLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXXXXXXXXDI----NFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPCGIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMDIRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEVXXXXXXXXXXFLGSVSFDVQSVYDRG 1293
            +D   +     + S+   +    ++++ I   +  IW LGY + +  W  L  + ++ Y  +   +++KF          D  Q I   +G+   LP+WV FPDVE  EW+N +I R+WP IT ++NKI+ +T+  K+   L       I    + GD PP+IGGVK+Y  E+I RDEI++DVD+       I     +I  G+K+FE++G LRV I  L+P+IPF GA+++  L NP++NF  T    I  MPGL+  +  ++ D+V+   VLPNRI + +  D+   +  +   +GV+RI +I A  L A D+ +   +TSDPY I+RVGAEK+ +K +N  LNP WNE FE IVD +  Q++ +EV D+D + +DD LG  +  V+ VY  G
Sbjct:    1 MDKDQDEPEPEKKSISFDILSTIRTYVKIITAWVAIWGLGYYKFSPSWVALAAIGYMGYARAY--EKRKFVGLIMKAISEDEKQSIIKNIGS-HQLPTWVYFPDVERAEWLNKVIQRMWPYITEYVNKILVETVQPKVNASLPSSLQPFIFLRTDLGDAPPRIGGVKVYTEESIRRDEIVMDVDLMLYSDARIKVAVGKIVAGVKDFELRGTLRVLIKPLVPKIPFVGAVTVCFLDNPYINFLLTHLGNIMTMPGLQQTLYRTVQDVVSSLCVLPNRISVSLVDDVMLGQIKFPSAQGVVRIEIISASDLVAADVNLTGKSTSDPYCIVRVGAEKYTTKVMNKTLNPTWNECFETIVDQRMGQSIIIEVWDRDNSTRDDELGLTTIPVEDVYLSG 392          
BLAST of Extended synaptotagmin-like protein 2 vs. TrEMBL
Match: A0A267DBI2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023705g1 PE=4 SV=1)

HSP 1 Score: 262.307 bits (669), Expect = 3.702e-76
Identity = 138/359 (38.44%), Postives = 220/359 (61.28%), Query Frame = 1
Query:  244 IWLLGYLQINILWGILGILTFIIYQISINEQRQ-KFKFGVDLSQDIKYTLGTVSNLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXX----XXXXXXXXDINFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPCGIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMDIRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEVXXXXXXXXXXFLGSVSFDVQSVYDRGIFDT 1305
            +WL+GYL  ++ W ++ +L +II    I EQR+ + K    L++D +  L  V NLPSWV FPDVE  EW+N+II + WP +  +   II   I+  ++      ++ L+   ++ GD+ P+ GGVK+Y  +N  R EI++D+D+ Y    +I      I  GIK+ E++G LRV I+ LIP+IP    +++T L  P++NF+ TD   I ++PGLR  + + + D ++ ++V+PNR+ +P+  D++     + +P+GVLR  V+EA  LK  D+ +     SDPY I+ VG++K+ +K I N+LNP WN  FEA VD +  Q +++E+ D+D  +KDD LGS   D+ SV   G+ DT
Sbjct:   34 VWLIGYLGFSVTWLVVAVLAYIITSY-IKEQRKVRTKAFQALARDERQFLANVENLPSWVFFPDVERAEWLNSIIKQAWPFVKDYAVSIIEKQIMPGVRDNLPGVIQDLRFSRLDLGDIAPRFGGVKVYTGDNTRRSEIVMDMDLIYYGDAKIEMKTKGIKAGIKSIELRGILRVVISPLIPRIPIAACVTVTFLSVPYLNFDLTDLGNILDLPGLRQMLVKVVSDQISAQLVVPNRLLVPLAGDVDLTAMKWILPQGVLRFKVVEARDLKRSDVGLIRSGKSDPYAIVTVGSQKYTTKAIANSLNPVWNAAFEAAVDVRQGQLLDIELFDEDAGSKDDELGSAKVDLGSVAREGVLDT 391          
BLAST of Extended synaptotagmin-like protein 2 vs. TrEMBL
Match: A0A158R8K6 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS5632 PE=4 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 4.242e-76
Identity = 140/388 (36.08%), Postives = 228/388 (58.76%), Query Frame = 1
Query:  166 DTQSSVKLKVFFYGKSFIIISVGFSLIWLLGYLQINILWGILGILTFIIYQISINEQRQKFKFGVDLSQDIKYT----LGTVSNLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXXXXXXXXDI----NFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPCGIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMDIRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEVXXXXXXXXXXFLGSVSFDVQSVYDRGIFDT 1305
            + ++ +K  +F   +++I +   +  IW LGY + +  W   G + ++ Y  +  ++         +++D K +    +G+   LP+WV FPDVE  EW+N ++ R+WP IT ++NK++ +T+   +   L       I    + GD PP+IGG+K+Y  E+I RDE+++DVD+       I     +I  G+K+FE++G LR+ +  L+ QIPF GA+++  L NP++NF  T    I  MPGL+  +  ++ D V+   VLPNRI +P+  D+   +  +   +G +R+ VI A  L + D+     ++SDPY ++RVGAEKF +K IN  LNP WNE FEA+VD K  Q+V +EV DKD ++KDD LG  +  ++ VY RGI ++
Sbjct:   22 NEKTGIKFDIFSTARTYIKLIGCWIAIWGLGYYKFSPSWVAFGAIGYMAYLRAYEKRSLVSSVMRTITEDEKSSVINNIGS-HELPAWVYFPDVERAEWLNKVMQRMWPYITEYVNKVLVETVQPAVNANLPSSLHPFIFMRTDLGDTPPRIGGIKVYVEESIHRDEVVMDVDLMLYSDARIKVSVGKIVAGVKDFELRGTLRILMKPLVSQIPFVGAVTVCFLDNPYINFLLTHMGNILTMPGLQQTLYRTVQDAVSSLCVLPNRISVPLVNDVILEQIRFPSAQGAIRVEVISASDLVSADVNPIGKSSSDPYCVVRVGAEKFVTKVINKTLNPTWNECFEAVVDQKMGQSVIIEVWDKDASSKDDELGLTTIPIEEVYLRGIINS 408          
BLAST of Extended synaptotagmin-like protein 2 vs. TrEMBL
Match: A0A267EI81 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026219g2 PE=4 SV=1)

HSP 1 Score: 261.536 bits (667), Expect = 6.430e-76
Identity = 137/359 (38.16%), Postives = 219/359 (61.00%), Query Frame = 1
Query:  244 IWLLGYLQINILWGILGILTFIIYQISINEQRQ-KFKFGVDLSQDIKYTLGTVSNLPSWVSFPDVESVEWINTIILRLWPNIT----VFMNKIIRDTIXXXXXXXXXXXXXXDINFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPCGIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMDIRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEVXXXXXXXXXXFLGSVSFDVQSVYDRGIFDT 1305
            +WL+GYL  ++ W ++ +L +II    I EQR+ + K    L++D +  L  V NLPSWV FPDVE  EW+N+II + WP +     + + K I   +   +   ++ L+   ++ GD+ P+ GGVK+Y  +N  R EI++D+D+ Y    +I      I  GIK+ E++G LRV I+ LIP+IP    +++T L  P++NF+ TD   I ++PGLR  + + + D ++ ++V+PNR+ +P+  D++     + +P+GVLR  V+EA  LK  D+ +     SDPY I+ VG++K+ +K I N+LNP WN  FEA VD +  Q +++E+ D+D  +KDD LGS   D+ SV   G+ DT
Sbjct:   34 VWLIGYLGFSVTWLVVAVLAYIITSY-IKEQRKVRTKAFQALARDERQFLANVENLPSWVFFPDVERAEWLNSIIKQAWPFVKDYAVLIIEKQIMPGVRDNLPGVIQDLRFSRLDLGDIAPRFGGVKVYTGDNTRRSEIVMDMDLIYYGDAKIEMKTKGIKAGIKSIELRGILRVVISPLIPRIPIAACVTVTFLSVPYLNFDLTDLGNILDLPGLRQMLVKVVSDQISAQLVVPNRLLVPLAGDVDLTAMKWILPQGVLRFKVVEARDLKRSDVGLIRSGKSDPYAIVTVGSQKYTTKAIANSLNPVWNAAFEAAVDVRQGQLLDIELFDEDAGSKDDELGSAKVDLGSVAREGVLDT 391          
BLAST of Extended synaptotagmin-like protein 2 vs. TrEMBL
Match: A7STM9 (Predicted protein OS=Nematostella vectensis OX=45351 GN=v1g247335 PE=4 SV=1)

HSP 1 Score: 260.381 bits (664), Expect = 1.748e-75
Identity = 143/366 (39.07%), Postives = 229/366 (62.57%), Query Frame = 1
Query:  229 VGFSL-IWLLGYLQINILWGILGILTFIIYQISINEQRQKFKFGVDLSQDIKYT---LGTVSNLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXX----XXXXXXDINFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPCGIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMDIRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEVXXXXXXXXXXFLGSVSFDVQSVYDRGIFD 1302
            VG +L IW +G++ ++ +W + G+L F +++++   Q  K K    L + +K     +  + +LP+WV FPDVE  EW+N +I++LWP I   + KI+++T+  +IQK +    K +   +I+ G+ PP+IGG+K Y   N+ R EII+DVD+ Y    +I      I  GI++ +++G LRV ++ L+P  P  G IS+  L  P ++F+ T+ + I ++PGL   +R  + D+VA  VVLPNRICIP+  D++  K  Y +P+GVLRI V EA  L A DI +F+  TSDPY +++VGA+ F+++T    LNPKWNE FE  VD    Q +++++ D+D+ + D+ LGSV  D+ +V  +G  D
Sbjct:   56 VGVALGIWFMGWMGLSYVWVLCGLLVFTMWKLN---QEDKSKRRAKLQEVMKTDSEIVAKMDDLPAWVFFPDVERAEWLNKMIVQLWPFINDMVVKIMKETVEPEIQKNVPGFLKSIHFAEISLGNQPPRIGGIKTYTR-NVKRSEIIMDVDLIYAGDADIQLSVKGISVGIEDLQLRGTLRVIMSPLVPSAPLVGGISVFFLNRPDIDFDLTNLLNILDIPGLSDILRGVVGDVVASFVVLPNRICIPLT-DVDPYKLKYPLPDGVLRIEVTEAKDLVAKDIAVFKKGTSDPYAMVKVGAQTFRTETKKETLNPKWNEVFEVFVDNSQGQKIKIQLFDEDRASDDEALGSVEADISTVVQQGSAD 416          
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Cavefish
Match: esyt2a (extended synaptotagmin-2 [Source:NCBI gene;Acc:103022077])

HSP 1 Score: 194.126 bits (492), Expect = 2.392e-54
Identity = 114/349 (32.66%), Postives = 201/349 (57.59%), Query Frame = 1
Query:  202 YGKSFIIISVGFSLIWLLGYLQINILWGILGILTFIIYQISINEQRQ------KFKFGVDLSQDIKYTLGTVSNLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXXXXXXX---XDINFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPC--GIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMD--IRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVEL 1209
            + KSF+++      I++LGYL+ +  W +LG+   +++ +  N+  +         F     Q ++ +L T + LP WV FPDVE VEW+N  + ++WP I  F++K+ R+TI   ++     L       I+ GD P ++ GVK+Y  EN+ + +II+D+ I ++   EI+    +  C  GIK+ ++ G LRV +  L+  +P  GA+SL  L+ P ++  +T    + ++PGL       + D+++  +VLPN+I +P+  D    +  + IP+GVLR++ +EA +L A D  ++      SDPY ++++G + F+SK I + LNPKWNE +EA+V+ +  Q +E+
Sbjct:   53 FAKSFLLVLP----IYVLGYLEFSFSWILLGLA--VLFWLRRNQAARFPQVTRALAFFEHEEQLVRQSLPT-TELPPWVHFPDVERVEWLNKTVHQMWPYICQFVDKLFRETIEPAVKGANAHLSSFCFSKIDMGDKPLRVNGVKVYT-ENVDKRQIIMDLQISFIGNTEIDVEIRKYYCKAGIKSIQLHGVLRVVMEPLLGDMPLIGALSLFFLKKPTLDINWTGLTNMLDIPGLNGLCDGVIEDIISSNLVLPNKITVPLVGDAQLAQLRFPIPKGVLRVHFLEAQNLLAKDKFLKGLIKGKSDPYGVVKIGNQLFQSKVIKDCLNPKWNEVYEALVNDQ--QNIEI 391          
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Cavefish
Match: esyt2a (extended synaptotagmin-2 [Source:NCBI gene;Acc:103022077])

HSP 1 Score: 194.512 bits (493), Expect = 3.930e-54
Identity = 114/349 (32.66%), Postives = 201/349 (57.59%), Query Frame = 1
Query:  202 YGKSFIIISVGFSLIWLLGYLQINILWGILGILTFIIYQISINEQRQ------KFKFGVDLSQDIKYTLGTVSNLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXXXXXXX---XDINFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPC--GIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMD--IRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVEL 1209
            + KSF+++      I++LGYL+ +  W +LG+   +++ +  N+  +         F     Q ++ +L T + LP WV FPDVE VEW+N  + ++WP I  F++K+ R+TI   ++     L       I+ GD P ++ GVK+Y  EN+ + +II+D+ I ++   EI+    +  C  GIK+ ++ G LRV +  L+  +P  GA+SL  L+ P ++  +T    + ++PGL       + D+++  +VLPN+I +P+  D    +  + IP+GVLR++ +EA +L A D  ++      SDPY ++++G + F+SK I + LNPKWNE +EA+V+ +  Q +E+
Sbjct:   53 FAKSFLLVLP----IYVLGYLEFSFSWILLGLA--VLFWLRRNQAARFPQVTRALAFFEHEEQLVRQSLPT-TELPPWVHFPDVERVEWLNKTVHQMWPYICQFVDKLFRETIEPAVKGANAHLSSFCFSKIDMGDKPLRVNGVKVYT-ENVDKRQIIMDLQISFIGNTEIDVEIRKYYCKAGIKSIQLHGVLRVVMEPLLGDMPLIGALSLFFLKKPTLDINWTGLTNMLDIPGLNGLCDGVIEDIISSNLVLPNKITVPLVGDAQLAQLRFPIPKGVLRVHFLEAQNLLAKDKFLKGLIKGKSDPYGVVKIGNQLFQSKVIKDCLNPKWNEVYEALVNDQ--QNIEI 391          
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Cavefish
Match: esyt2a (extended synaptotagmin-2 [Source:NCBI gene;Acc:103022077])

HSP 1 Score: 194.512 bits (493), Expect = 4.605e-54
Identity = 114/349 (32.66%), Postives = 201/349 (57.59%), Query Frame = 1
Query:  202 YGKSFIIISVGFSLIWLLGYLQINILWGILGILTFIIYQISINEQRQ------KFKFGVDLSQDIKYTLGTVSNLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXXXXXXX---XDINFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPC--GIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMD--IRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVEL 1209
            + KSF+++      I++LGYL+ +  W +LG+   +++ +  N+  +         F     Q ++ +L T + LP WV FPDVE VEW+N  + ++WP I  F++K+ R+TI   ++     L       I+ GD P ++ GVK+Y  EN+ + +II+D+ I ++   EI+    +  C  GIK+ ++ G LRV +  L+  +P  GA+SL  L+ P ++  +T    + ++PGL       + D+++  +VLPN+I +P+  D    +  + IP+GVLR++ +EA +L A D  ++      SDPY ++++G + F+SK I + LNPKWNE +EA+V+ +  Q +E+
Sbjct:   53 FAKSFLLVLP----IYVLGYLEFSFSWILLGLA--VLFWLRRNQAARFPQVTRALAFFEHEEQLVRQSLPT-TELPPWVHFPDVERVEWLNKTVHQMWPYICQFVDKLFRETIEPAVKGANAHLSSFCFSKIDMGDKPLRVNGVKVYT-ENVDKRQIIMDLQISFIGNTEIDVEIRKYYCKAGIKSIQLHGVLRVVMEPLLGDMPLIGALSLFFLKKPTLDINWTGLTNMLDIPGLNGLCDGVIEDIISSNLVLPNKITVPLVGDAQLAQLRFPIPKGVLRVHFLEAQNLLAKDKFLKGLIKGKSDPYGVVKIGNQLFQSKVIKDCLNPKWNEVYEALVNDQ--QNIEI 391          
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Cavefish
Match: esyt2a (extended synaptotagmin-2 [Source:NCBI gene;Acc:103022077])

HSP 1 Score: 194.126 bits (492), Expect = 4.708e-54
Identity = 114/349 (32.66%), Postives = 201/349 (57.59%), Query Frame = 1
Query:  202 YGKSFIIISVGFSLIWLLGYLQINILWGILGILTFIIYQISINEQRQ------KFKFGVDLSQDIKYTLGTVSNLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXXXXXXX---XDINFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPC--GIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMD--IRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVEL 1209
            + KSF+++      I++LGYL+ +  W +LG+   +++ +  N+  +         F     Q ++ +L T + LP WV FPDVE VEW+N  + ++WP I  F++K+ R+TI   ++     L       I+ GD P ++ GVK+Y  EN+ + +II+D+ I ++   EI+    +  C  GIK+ ++ G LRV +  L+  +P  GA+SL  L+ P ++  +T    + ++PGL       + D+++  +VLPN+I +P+  D    +  + IP+GVLR++ +EA +L A D  ++      SDPY ++++G + F+SK I + LNPKWNE +EA+V+ +  Q +E+
Sbjct:   53 FAKSFLLVLP----IYVLGYLEFSFSWILLGLA--VLFWLRRNQAARFPQVTRALAFFEHEEQLVRQSLPT-TELPPWVHFPDVERVEWLNKTVHQMWPYICQFVDKLFRETIEPAVKGANAHLSSFCFSKIDMGDKPLRVNGVKVYT-ENVDKRQIIMDLQISFIGNTEIDVEIRKYYCKAGIKSIQLHGVLRVVMEPLLGDMPLIGALSLFFLKKPTLDINWTGLTNMLDIPGLNGLCDGVIEDIISSNLVLPNKITVPLVGDAQLAQLRFPIPKGVLRVHFLEAQNLLAKDKFLKGLIKGKSDPYGVVKIGNQLFQSKVIKDCLNPKWNEVYEALVNDQ--QNIEI 391          
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Cavefish
Match: esyt2a (extended synaptotagmin-2 [Source:NCBI gene;Acc:103022077])

HSP 1 Score: 194.126 bits (492), Expect = 5.959e-54
Identity = 114/349 (32.66%), Postives = 201/349 (57.59%), Query Frame = 1
Query:  202 YGKSFIIISVGFSLIWLLGYLQINILWGILGILTFIIYQISINEQRQ------KFKFGVDLSQDIKYTLGTVSNLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXXXXXXX---XDINFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPC--GIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMD--IRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVEL 1209
            + KSF+++      I++LGYL+ +  W +LG+   +++ +  N+  +         F     Q ++ +L T + LP WV FPDVE VEW+N  + ++WP I  F++K+ R+TI   ++     L       I+ GD P ++ GVK+Y  EN+ + +II+D+ I ++   EI+    +  C  GIK+ ++ G LRV +  L+  +P  GA+SL  L+ P ++  +T    + ++PGL       + D+++  +VLPN+I +P+  D    +  + IP+GVLR++ +EA +L A D  ++      SDPY ++++G + F+SK I + LNPKWNE +EA+V+ +  Q +E+
Sbjct:   53 FAKSFLLVLP----IYVLGYLEFSFSWILLGLA--VLFWLRRNQAARFPQVTRALAFFEHEEQLVRQSLPT-TELPPWVHFPDVERVEWLNKTVHQMWPYICQFVDKLFRETIEPAVKGANAHLSSFCFSKIDMGDKPLRVNGVKVYT-ENVDKRQIIMDLQISFIGNTEIDVEIRKYYCKAGIKSIQLHGVLRVVMEPLLGDMPLIGALSLFFLKKPTLDINWTGLTNMLDIPGLNGLCDGVIEDIISSNLVLPNKITVPLVGDAQLAQLRFPIPKGVLRVHFLEAQNLLAKDKFLKGLIKGKSDPYGVVKIGNQLFQSKVIKDCLNPKWNEVYEALVNDQ--QNIEI 391          
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Sea Lamprey
Match: esyt1b (extended synaptotagmin-like protein 1b [Source:ZFIN;Acc:ZDB-GENE-040724-209])

HSP 1 Score: 198.364 bits (503), Expect = 6.761e-56
Identity = 124/381 (32.55%), Postives = 214/381 (56.17%), Query Frame = 1
Query:  193 VFFYGKSFIIISVGFSLIWLLGYLQINILWGILGILTFIIYQISINEQRQKFKFGVDLS--QDIKYTLG-TVSNLPSW-VSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXXXXXXX---XDINFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPC--GIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMD--IRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEVXXXXXXXXXXFLGSVSFDVQSVYDRGIFD 1302
            +F + ++F+ +       +L GYL ++  W +LG++ ++ Y+     ++Q    G  LS  +++    G    +LP+W V FPDVE VEW+N +++++WP    +M  + R  I   ++     LK      ++FG+ P K+ G+K Y+ +N+ + +II+D+ I Y+   +IN    +  C  G K  ++ G LRV +  LI Q+PFFGA++   ++ P +N  +T    + ++PGL +     + D +A+ +VLPNR  +PI  D+   +  + IP+GVLRI++  A  L+  D  ++      SDPY ++ VG ++F+SKTI  NL+P WNE +EAIV     Q +E  +   +  +KDDFLGS++ D+  V    + D
Sbjct:   63 LFAFARTFLCLFP----TYLAGYLGMSFSWILLGVVVWLGYKRIRASKKQLLLKGEQLSSFEELCIRSGIKHQDLPAWWVQFPDVERVEWLNKVLVQVWPFFGRYMEGVFRQAIEPAVRGSTDYLKTFTFTKLHFGEKPFKVTGIKTYS-QNVDKRQIILDLQISYVGDCDINVEIPKYFCNAGAKQVQLHGSLRVILEPLISQVPFFGALTFFFIRRPQLNINWTGLTNLLDIPGLNNMSDSMITDQIANLMVLPNRFTVPIVGDLELAQLRFPIPKGVLRIHLKGARDLERKDNLLKGMIKGKSDPYTVLHVGPQRFQSKTIQKNLDPIWNEVYEAIVHEVPGQELEATL-FDEDPDKDDFLGSLTIDLNEVAKERVVD 437          

HSP 2 Score: 65.4698 bits (158), Expect = 1.282e-11
Identity = 42/110 (38.18%), Postives = 64/110 (58.18%), Query Frame = 1
Query:  979 FMYHIPEGVLRINVIEALSLKAMD--IRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEVXXXXXXXXXXFLGSVSFDVQSVYDRGIFD 1302
            + Y   +GVLRI++  A  L+  D  ++      SDPY ++ VG ++F+SKTI  NL+P WNE +EAIV     Q +E  +   +  +KDDFLGS++ D+  V    + D
Sbjct:  662 YGYSHLQGVLRIHLKGARDLQRKDNLLKGMIKGKSDPYTVLHVGPQRFQSKTIPENLHPVWNEIYEAIVHEVPGQELEATL-FDEDPDKDDFLGSLTIDLNEVAKERVVD 770          
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006160.1 (pep scaffold:Pmarinus_7.0:GL476688:98794:160173:1 gene:ENSPMAG00000005536.1 transcript:ENSPMAT00000006160.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.0618 bits (118), Expect = 8.352e-7
Identity = 24/54 (44.44%), Postives = 34/54 (62.96%), Query Frame = 1
Query: 1006 LRINVIEALSLKAMDIRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETF 1167
            L I V+ A  L+A D    +  +SDPY+ ++VG  K ++KTI  NLNP W+E F
Sbjct: 1180 LTITVVSAQGLQAKD----KTGSSDPYVTVQVGKTKKRTKTIYGNLNPVWDEKF 1229          
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004337.1 (pep scaffold:Pmarinus_7.0:GL478852:175856:252872:1 gene:ENSPMAG00000003926.1 transcript:ENSPMAT00000004337.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.9062 bits (115), Expect = 1.643e-6
Identity = 25/52 (48.08%), Postives = 32/52 (61.54%), Query Frame = 1
Query: 1012 INVIEALSLKAMDIRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETF 1167
            INV  A  L+A D    +   SDPY+ ++VG  K ++KTI NNLNP W E F
Sbjct:  199 INVHSAQGLQAKD----KTGASDPYVTVQVGKTKKRTKTIYNNLNPVWEEKF 246          
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Yeast
Match: TCB2 (ER protein involved in ER-plasma membrane tethering; one of 6 proteins (Ist2p, Scs2p, Scs22p, Tcb1p, Tcb2p, Tcb3p) that connect ER to plasma membrane (PM) and regulate PM phosphatidylinositol-4-phosphate (PI4P) levels by controlling access of Sac1p phosphatase to its substrate PI4P in the PM; contains 3 calcium and lipid binding domains; mRNA is targeted to bud; TCB2 has a paralog, TCB1, that arose from the whole genome duplication [Source:SGD;Acc:S000005031])

HSP 1 Score: 60.8474 bits (146), Expect = 2.256e-10
Identity = 88/359 (24.51%), Postives = 161/359 (44.85%), Query Frame = 1
Query:  199 FYGKSF----IIISVGFSLIWLLGYLQINILWGILGILTF-IIYQISINEQRQKFKFGVDLSQDIKYTLGTVSNLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXXXXXX------XXDINFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEI---------NFVYNQIPCGIKNFEVKGHLRVQ----------INSLIPQIPFFGAISLTLLQNPHVNF-EFTDAVAIFN-----MPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMDIRIFEHNTSDPYIIIRVGAEKF-KSKTINNNLNPKWNET 1164
            FYG  +    I+I  G    ++LGY + ++   ++ +LT  ++Y+ S  + R+  +   DL+Q  +    TV  + S     D ESVEW+NT + + WP I   +++ I D     + + +   K      L     G  PP+I  +K +  +N   D +++DV + +  P ++         N+V + +    K F +   + V              L+  +P    I++ LL+ P V+F       ++FN     +PGL   I++     ++  ++ P  + + I + ++K      +P GVL I V  A  L+ +   I    T DPY+   +  +   K+K   N+ NP WNE+
Sbjct:   95 FYGDWYHEVAILIIAGL-CSFVLGYFKFSLASVLIVMLTTGMLYRTSSKKYRESLR---DLAQKEQ----TVEKITS-----DYESVEWLNTFLDKYWPIIEPSVSQQIVDGTNTALSENVAIPKFIKAIWLDQFTLGVKPPRIDAIKTF--QNTKSDVVVMDVCLSF-TPHDMSDLDAKQCRNYVNSNVVLKAKIFGMDIPVSVADIFFQVFVRFRFQLMTTLPLVETINIQLLEVPEVDFISRLLGNSVFNWEILAIPGLMRLIQKMAFKYLSPVLLPPFSLQLNIPQLLSKT----GLPIGVLEIKVKNAHGLRKLVGMI--KKTVDPYLTFELSGKIVGKTKVFKNSANPVWNES 431          
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Yeast
Match: TCB1 (Lipid-binding ER protein involved in ER-plasma membrane tethering; one of 6 proteins (Ist2p, Scs2p, Scs22p, Tcb1p, Tcb2p, Tcb3p) that connect ER to plasma membrane and regulate PI4P levels by controlling access of Sac1p phosphatase to its substrate PI4P in PM; contains 3 calcium and lipid binding domains; non-tagged protein also localizes to mitochondria; C-termini of Tcb1p, Tcb2p and Tcb3p interact; TCB1 has a paralog, TCB2, that arose from the whole genome duplication [Source:SGD;Acc:S000005612])

HSP 1 Score: 59.6918 bits (143), Expect = 5.938e-10
Identity = 82/364 (22.53%), Postives = 164/364 (45.05%), Query Frame = 1
Query:  295 ILTFIIYQISINEQRQKFKFGVDLSQDIKYTLGTVSNLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXXXXXX------XXDINFGDVPPKIGGVKIYNNENISRDEIIIDVDIYY----LCPGEINFVYN---------------QIPCGIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTD-AVAIFN-----MPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMDIRIFEHNTSDPYIIIRVGAEKF-KSKTINNNLNPKWNETFEAIVDTKSCQTVELEVXXXXXXXXXXFLGSVSFDVQSVYDR 1290
            ++T ++Y+ S  + R   +   +L Q  ++T+  V N        D ES+EW+N  + + WP +   ++++I     +++       K      + ++  G  PP++  VK +  +N + D +++D  I +    LC      V N                IP  + +   K H RV+   + P  P    +++ LL+ P  +F  T    +IFN     +PGL + I++ +       ++LP      ++ +I ++    ++  G+L I V  A  LK     + E  + DPY+          K++T+ + LNP W+ET   ++++     + + V DK    KD  LG + +++ +++D+
Sbjct:  139 VITSLLYRTSAKKYRGSIR---ELVQK-EFTVQKVEN--------DYESLEWLNAFLDKYWPILEPSVSQLIVQQANEQMATNEAIPKFITQLWIDELTLGVKPPRVDLVKTF--QNTASDVVVMDWGISFTPHDLCDMSAKQVRNYVNELAVVKAKIFGITIPVSVSDIAFKAHARVKFKLMTP-FPHVETVNIQLLKVPDFDFVATLFGRSIFNWEILAIPGLMTLIQK-MAKKYMGPILLP---PFSLQLNIPQLLSGSNLSIGILEITVKNAKGLKRTSSILNE--SIDPYLSFEFNDISIAKTRTVRDTLNPVWDETLYVLLNS-FTDPLTISVYDKRAKLKDKVLGRIQYNLNTLHDK 480          
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Yeast
Match: TCB3 (Cortical ER protein involved in ER-plasma membrane tethering; one of 6 proteins (Ist2p, Scs2p, Scs22p, Tcb1p, Tcb2p, Tcb3p) that connect ER to the plasma membrane (PM) and regulate PM phosphatidylinositol-4-phosphate (PI4P) levels by controlling access of Sac1p phosphatase to its substrate PI4P in the PM; localized to the bud via specific mRNA transport; non-tagged protein detected in a phosphorylated state in mitochondria; C-termini of Tcb1p, Tcb2p and Tcb3p interact [Source:SGD;Acc:S000004537])

HSP 1 Score: 58.9214 bits (141), Expect = 9.315e-10
Identity = 68/290 (23.45%), Postives = 125/290 (43.10%), Query Frame = 1
Query:  433 VESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXX-----XXXXXXDINFGDVPPKIGGVKIYNNENISRDEI-----IIDVDIYYLCPGEI----------------NFVYNQIPCGIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFT----DAVAIFNM---PGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMDIRIFEHNTSDPYIIIRV-----GAEKFKSKTINNNL-NPKWNETFEAIVDT 1185
            VES  W+N+ + + W      +++ ++D +  ++           L + +   G   P I G+K Y     +  E+         D+  +   E                 +FV   +P  +++  V G +R+++       P    +SL LL+ P ++F       D + +  M   PGL+SF++  +   +   +  PN + I ++ DI   +    I  GVL + +  A SLK  D   F  NT DPYI++       G ++    +I +N+ NP+WNET   +++T
Sbjct:  273 VESTTWLNSFLSKFWVIYMPVLSQQVKDNVNPQLAGVAPGYGIDALAIDEFTLGSKAPTIKGIKSYTKTGKNTVEMDWSFAFTPSDVSDMTATEAREKINPKISLGVTLGKSFVSKTMPILVEDINVAGKMRIKV-EFGKAFPNIKIVSLQLLEPPLIDFALKPIGGDTLGLDVMSFLPGLKSFVKNIINSNIGPMLFPPNHLDINVE-DIMAAQSKEAI--GVLAVTIASADSLKGSD---FITNTVDPYIVMTTEDAVPGTDEEVRTSIKSNVKNPRWNETKYLLLNT 555          
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Nematostella
Match: EDO32931 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STM9])

HSP 1 Score: 260.381 bits (664), Expect = 2.417e-79
Identity = 143/366 (39.07%), Postives = 229/366 (62.57%), Query Frame = 1
Query:  229 VGFSL-IWLLGYLQINILWGILGILTFIIYQISINEQRQKFKFGVDLSQDIKYT---LGTVSNLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXX----XXXXXXDINFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPCGIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMDIRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEVXXXXXXXXXXFLGSVSFDVQSVYDRGIFD 1302
            VG +L IW +G++ ++ +W + G+L F +++++   Q  K K    L + +K     +  + +LP+WV FPDVE  EW+N +I++LWP I   + KI+++T+  +IQK +    K +   +I+ G+ PP+IGG+K Y   N+ R EII+DVD+ Y    +I      I  GI++ +++G LRV ++ L+P  P  G IS+  L  P ++F+ T+ + I ++PGL   +R  + D+VA  VVLPNRICIP+  D++  K  Y +P+GVLRI V EA  L A DI +F+  TSDPY +++VGA+ F+++T    LNPKWNE FE  VD    Q +++++ D+D+ + D+ LGSV  D+ +V  +G  D
Sbjct:   56 VGVALGIWFMGWMGLSYVWVLCGLLVFTMWKLN---QEDKSKRRAKLQEVMKTDSEIVAKMDDLPAWVFFPDVERAEWLNKMIVQLWPFINDMVVKIMKETVEPEIQKNVPGFLKSIHFAEISLGNQPPRIGGIKTYTR-NVKRSEIIMDVDLIYAGDADIQLSVKGISVGIEDLQLRGTLRVIMSPLVPSAPLVGGISVFFLNRPDIDFDLTNLLNILDIPGLSDILRGVVGDVVASFVVLPNRICIPLT-DVDPYKLKYPLPDGVLRIEVTEAKDLVAKDIAVFKKGTSDPYAMVKVGAQTFRTETKKETLNPKWNEVFEVFVDNSQGQKIKIQLFDEDRASDDEALGSVEADISTVVQQGSAD 416          
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Nematostella
Match: EDO33842 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR21])

HSP 1 Score: 211.46 bits (537), Expect = 4.563e-66
Identity = 111/255 (43.53%), Postives = 163/255 (63.92%), Query Frame = 1
Query:  418 VSFPDVESVEWINTIILRLWPNITVFMNKIIRDT----IXXXXXXXXXXXXXXDINFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPCGIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMDIRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFE 1170
            V FPDVE  EW+N +I++LWP I   + KI+++T    I K +   LK +   +I+ G+ PP+IGG+K Y   N+ R EII+DVD+ Y    +I      I  GI++ +++G LRV ++ L+P  P  G IS+  L  P ++F+ T+ + I ++PGL   +R  + D+VA  VVLPNRICIP+  D++  K  Y +P+GVLRI V EA  L A DI +F+  TSDPY +++VGA+ F+++T    LNPKWNE FE
Sbjct:    1 VFFPDVERAEWLNKMIVQLWPFINDMVVKIMKETVEPEIQKNVPGFLKSIHFAEISLGNQPPRIGGIKTYT-RNVKRSEIIMDVDLIYAGDADIQLSVKGISVGIEDLQLRGTLRVIMSPLVPSAPLVGGISVFFLNRPDIDFDLTNLLNILDIPGLSDILRGVVGDVVASFVVLPNRICIPL-TDVDPYKLKYPLPDGVLRIEVTEAKDLVAKDIAVFKKGTSDPYAMVKVGAQTFRTETKKETLNPKWNEVFE 253          
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Nematostella
Match: EDO46351 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQE8])

HSP 1 Score: 203.371 bits (516), Expect = 3.259e-58
Identity = 118/357 (33.05%), Postives = 196/357 (54.90%), Query Frame = 1
Query:  244 IWLLGYLQINILWGILGILTFIIYQISINEQRQKFKFGVDLSQDIKYTLGTVSNLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXXXXXXXX----DINFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPCGIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMDIRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEVXXXXXXXXXXFLGSVSFDVQSVYDRGIFD 1302
            +WL+GY+  +  W ++ ++ F+ +Q  I E++ K +  +  +    Y +  + N PSWV F D E  EWIN ++L++WP +      I+++T+  ++QK L           I  G+ PP I  V  Y+ +   + E I+D+D+ Y    ++      +  G+  F++ G LRV    L+      G +++  L  P   F+ T+ + + + PGL S +R  + D +A  VVLPNR+ IP+ + ++     Y IP+GVLR+ V+EA  L A D  + +   SDPY I+ +GA+KF++K   N+LNP WNETFEA VD    Q +++ + D+DK  KD  LG +S  + S  ++G  D
Sbjct:   42 LWLVGYMHFSFAWIVMILMIFVSWQFEI-EKKTKHRENMVQAHMSSY-IDKIQNPPSWVYFSDKEHAEWINKMLLQMWPYVGDMAVDILKNTVEPEMQKNLPKSLNTLYFDKITLGNQPPIIQNVVSYDGDE-KKGEFILDLDLKYEGDAQVKLSVKNVKLGLTKFKLNGILRVIFKPLVSLYNPIGGVTVFFLNRPKTKFDLTNLLNVLDFPGLNSTLRRIVDDTIASFVVLPNRVAIPLAEGVDASDLQYPIPQGVLRVKVVEARDLVAKDFGVVKKGKSDPYAILEIGAQKFRTKVKKNDLNPTWNETFEAFVDNSEGQDIDMFLWDEDKAGKDSKLGFLSTQIASAVEQGQRD 395          
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Nematostella
Match: EDO46277 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQE7])

HSP 1 Score: 177.948 bits (450), Expect = 3.504e-49
Identity = 107/360 (29.72%), Postives = 185/360 (51.39%), Query Frame = 1
Query:  241 LIWLLGYLQINILWGILGILTFIIYQIS--INEQRQKFKFGVDLSQDIKYTLGTVSNLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDT----IXXXXXXXXXXXXXXDINFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPCGIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMDIRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEVXXXXXXXXXXFLGSVSFDVQSVYDRGIFD 1302
            + W  G L ++  W +L +      Q    +   ++K    +    D+K       N+PSW+ F + E   W+N I+ ++WP +   +  I++ +    I   +   L+ L  + +  G  P  I  +K Y  +   + E I+D+D+ Y           ++  GI + ++ G LRV +  L+      G +++  L  P ++F+ T+ +++ ++PGL+  + + + D+VA  VVLPNRI +P+   ++     Y IP+GVLR+ VIEA  L A D+ +    TSDPY I+ VGA+K+++KT  +N +P W ETFEA +D    Q +  +V D+D   KD  +G V   V S ++ G  D
Sbjct:   31 IAWAFGALHLSFAWLVLFLFIGAFLQSGHLLKSNKRKIHRVIKQENDVKKVW---PNMPSWIYFSEEEHALWLNRILDQMWPYVEDMVQGILKHSVEPAIQSYLPAPLQSLCFEKMALGQTPLYITNIKTYKAKKRDK-EFIMDLDVVYNGDAHFTLGIKKVQLGISDLKIHGPLRVILKPLLSDYNPVGGVTVFFLNRPKISFDLTNLLSVLDIPGLKGTLLDIVEDVVASFVVLPNRIAVPLSASVDAGDLQYPIPDGVLRVEVIEAKDLIAADMALLSKPTSDPYCIVEVGAQKYRTKTKKSNCDPVWKETFEAFIDNTEGQELFCKVYDEDIAGKDTEIGEVDVQVASAFENGKTD 386          
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Nematostella
Match: EDO45740 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RS41])

HSP 1 Score: 48.1358 bits (113), Expect = 5.890e-6
Identity = 28/83 (33.73%), Postives = 43/83 (51.81%), Query Frame = 1
Query:  967 NKVKFMYHIPEGVLRINVIEALSLKAMDIRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEV 1215
            N  K    + +G++ I ++E   +  MD   F    SDPY   R+G EK+KSK     LNP+W+E F+  +   S   +E+ V
Sbjct:  146 NDPKIPSQLWDGIVSIILVEGKKMIPMDDSGF----SDPYCRFRLGNEKYKSKACKETLNPQWSEQFDLKMYPDSPMVLEITV 224          
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Medaka
Match: esyt2b (extended synaptotagmin 2 [Source:NCBI gene;Acc:101155552])

HSP 1 Score: 209.92 bits (533), Expect = 7.303e-60
Identity = 122/377 (32.36%), Postives = 215/377 (57.03%), Query Frame = 1
Query:  202 YGKSFIIISVGFSLIWLLGYLQINILWGILGILTFIIYQISINEQRQKFKFGVDL--SQDIKYTLG-TVSNLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXXXXXXX---XDINFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPC--GIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMD--IRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEVXXXXXXXXXXFLGSVSFDVQSVYDRGIFD 1302
            + K+F+ I      ++ LGY + +  W ++G++ F +++ +   +  +    +     +++    G T S+LP WV FPDVE VEW+N  + ++WP I  F+ K+ R+TI   +++    L       I+ GD P +I GVK+Y  EN+ + +II+D+ I ++   EI+    +  C  GIK+ ++ G LRV +  L+ ++P  GA+SL  L+ P ++  +T    I ++PGL  F    + D++   +VLPNR+ +P+  ++   K  + +P+GVLRI+ +EA  L+  D  +       SDPY ++++G + F+SKT+   LNPKWNE +EA+V   S + +E+E+   +  +KDDFLGS+  D+  ++     D
Sbjct:   59 FAKTFVFIFP----VYALGYFEFSFSWLLIGLMIFFLWRRNTGGKHSRLSRALAFFDQEELTAKPGLTTSDLPPWVHFPDVERVEWLNKTVKQMWPYICQFVEKLFRETIEPAVKETHAHLSTFCFTKIDMGDKPLRINGVKVYT-ENVDKRQIIMDLQISFVGNTEIDVDVKRYYCKAGIKSIQIHGVLRVVMEPLLGEMPLIGALSLFFLKKPLLDINWTGLTNILDIPGLHGFSDSLIQDIICSYLVLPNRVTVPLVSEMELAKLRFPVPKGVLRIHFLEAQDLEGKDKFLGGLIMGKSDPYGVLQIGNQVFQSKTVKQTLNPKWNEVYEALVYEHSGEHLEIEL-FDEDPDKDDFLGSLMIDLAELHKHQRVD 429          
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Medaka
Match: esyt3 (extended synaptotagmin-3 [Source:NCBI gene;Acc:101163370])

HSP 1 Score: 197.208 bits (500), Expect = 2.151e-55
Identity = 113/348 (32.47%), Postives = 196/348 (56.32%), Query Frame = 1
Query:  217 IIISVGFSLI-----WLLGYLQINILWGILGILTFIIYQISINEQRQKFKFGVDL----SQDIKYTLGTVSNLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXXXXXXX---XDINFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQ-IPCGIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMD--IRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEV 1215
            ++ISVG +L+     +L GYL ++I W +L +L    ++ +  ++  +    +D      Q I   L     + SWV F DVE V+W+N ++ + WP   ++M K+++++I   I+     LK+     ++FG   PKI G++ Y  E +   E+++D++I +    EI+   N  I  G+K   ++G LRV +  LI Q P  G I+L  ++ P +   +T    + + P   S   ++++D++A  +VLPNR+CIP+   +   +  + +P GV+R++V+EA +L A D  +R      SDPY I+RVG + FK+KTI+N L+PKWNE +E +V     Q +E+E+
Sbjct:   29 LLISVGKTLVVVYPVYLTGYLGLSISWVLLCMLMVTWWRKNRVQKFSRIGSAIDFVDNEKQVIDTELSGSLQMASWVHFDDVEKVQWLNKVLEQAWPFFGMYMEKLLKESIQPTIRLTNSALKMFTFSKVHFGHKAPKITGIRAYTQE-VDHREVVLDLNINFESDMEIDAAVNSAITAGVKGVRIQGTLRVILEPLISQAPLVGGITLFFIRRPTLGINWTGMTNLLDSPAFNSLSDDAIMDIIASLMVLPNRMCIPLIDQVKVDQMRFPLPRGVVRVHVLEARNLVAKDTYLRGLVKGKSDPYTIVRVGNQHFKTKTIDNCLDPKWNEVYEFVVHEAPGQELEVEL 375          
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Medaka
Match: esyt2a (extended synaptotagmin-2 [Source:NCBI gene;Acc:101155225])

HSP 1 Score: 181.03 bits (458), Expect = 1.928e-49
Identity = 121/371 (32.61%), Postives = 207/371 (55.80%), Query Frame = 1
Query:  202 YGKSFIIISVGFSLIWLLGYLQINILWGILGILTFIIYQISINEQRQKFKFGVDLS------QDIKYTLGTVSNLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXXXXXXX---XDINFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPC--GIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMDIRIFE---HNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEVXXXXXXXXXXFLGSVSFDV 1272
            + KSF +I      I++LGY + +  W ++G+   +++    N  ++ ++    L+      + +K +L T + +P WV +PDVE VEW+N  + ++WP I  F++K+ R+TI   ++     L       I+ GD P ++ GVK+Y  ENI + ++I+D+ I ++   EI+    +  C  GIK+ ++ G LRV +  L+  +P  GA+++  LQ P ++  +T    I ++PGL       + D++   +V+PN+I IP+  +    +  +  P+ VLRI+ IEA  L + D R+        SDPY +I+VG   F+SK IN +LNPKWNE +EA++       V+ E+     NN+DDFLG +S D+
Sbjct:   53 FAKSFAVIFP----IYVLGYFEFSFSWILIGLA--MVFYWKKNYGKRDYRINRALAYLEHKDKVVKLSLPT-TEMPPWVHYPDVERVEWLNKTVKQMWPFICQFVDKLFRETIEPAVKGANPHLSSFCFTKIDMGDKPLRVNGVKVYT-ENIDKRQVIMDLQISFVGNTEIDVDIKKYYCRAGIKSIQLHGTLRVVMEPLLGDMPLIGALTVFFLQKPLLDINWTGLTNILDIPGLNGLCDGIIQDIIQGYLVMPNQIRIPLVGEAELSRIRFPTPKAVLRIHFIEAQELMSKD-RLLGGLIKGKSDPYGVIQVGTVLFQSKIINESLNPKWNEVYEALIYDNMPNEVKFEL-FDKDNNQDDFLGGLSLDL 413          
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Medaka
Match: esyt1b (extended synaptotagmin-1 [Source:NCBI gene;Acc:101160647])

HSP 1 Score: 176.022 bits (445), Expect = 1.611e-47
Identity = 105/365 (28.77%), Postives = 202/365 (55.34%), Query Frame = 1
Query:  244 IWLLGYLQINILWGILGILTFIIYQISINEQRQKFKFGVDLSQD-IKYTLGTVS----NLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXXXXXXXXD---INFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPC--GIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMD--IRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEVXXXXXXXXXXFLGSVSFDVQSVYDRGIFD 1302
            ++L GY +++    + G++ +  ++     + ++ +  + L  D   Y    +S    +LP+WV+FPDVE VEW+N ++ ++WP +  ++ K++ +TI   I+     L+  +   ++ GD   K+ G+K +   +  + ++++D+ I Y+   EIN    +  C  G+K  ++ G +RV +  LI  +P  GA+++  ++ P ++  +T    +F++PG+ +     ++D +A  +VLPNR+ +P+  D++  +    +P GV+RI+++EA +L A D  ++      SDPY ++RVG + F SK I+N   PKW E +E IV     Q +E+EV      ++DDFLG    D+  V +  + D
Sbjct:   52 VYLAGYYRVSTSLLVFGMMVYTGWKHVREAKEERLRSAMQLLSDGDDYASSRLSKIKRDLPAWVNFPDVEKVEWLNKVLQQVWPFVGQYLEKLLVETIAPSIRASTTHLQTFNFTKVDMGDKAMKVVGIKAHTEND--KGQVLLDLYISYVGNVEINVEVKRYFCKAGVKGIQLHGMMRVILEPLIGDVPIVGAVTMFFIRRPKLDINWTGLTNLFDIPGVNAKSDSMIMDAIASFLVLPNRLVVPLVPDLHLAQLRCPLPRGVVRIHLLEAQNLPAKDHNVKGVMAGLSDPYAVLRVGPQTFTSKHIDNTDCPKWGEMYEVIVHEVPGQELEVEV-YDKDRDQDDFLGRTKLDLGVVKNSIVVD 413          

HSP 2 Score: 65.855 bits (159), Expect = 4.621e-11
Identity = 32/72 (44.44%), Postives = 44/72 (61.11%), Query Frame = 1
Query:  997 EGVLRINVIEALSLKAMDIRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELE 1212
            EGVLRI+++EA +L A DI +     SDPY+ I +G   FKS  I  NLNP WNE +E ++     Q ++ E
Sbjct: 1399 EGVLRIHLLEAKNLVAKDI-VLGKGKSDPYVKINIGGFMFKSHVIKENLNPTWNEMYEVVLSGNHDQDIKFE 1469          

HSP 3 Score: 63.929 bits (154), Expect = 2.202e-10
Identity = 42/99 (42.42%), Postives = 59/99 (59.60%), Query Frame = 1
Query:  997 EGVLRINVIEALSLKAMD--IRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEVXXXXXXXXXXFLGSVSFDVQSVYD 1287
            EG+LRI+++   +L   D  I       SDPY+ I +G E F S+TI  NLNP WNE +E I+     Q + LEV DKD + KDDF+G +  D++ + D
Sbjct:  617 EGLLRIHLLAGQNLVPKDNWIGSMLKGKSDPYVKISIGGETFTSQTIKENLNPTWNEMYEVILTQLPGQELHLEVFDKDMDMKDDFMGRLRIDLKDIID 715          

HSP 4 Score: 62.3882 bits (150), Expect = 6.317e-10
Identity = 34/76 (44.74%), Postives = 47/76 (61.84%), Query Frame = 1
Query:  997 EGVLRINVIEALSLKAMDIRIFEH---NTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEV 1215
            EG+LRI ++EA  L A D R F H     SDPY +I VG   FKS  +  NL+P WNE +E ++  +S Q V++E+
Sbjct:  979 EGLLRIILLEAQDLIAKDNR-FGHMVKGKSDPYAVISVGEFLFKSNVVEENLSPVWNEMYEVVLRPQSGQEVQVEL 1053          
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Medaka
Match: esyt1a (extended synaptotagmin-1 [Source:NCBI gene;Acc:101173223])

HSP 1 Score: 166.392 bits (420), Expect = 1.454e-44
Identity = 109/338 (32.25%), Postives = 187/338 (55.33%), Query Frame = 1
Query:  244 IWLLGYLQINILWGILGILTFIIYQISINEQRQKFKFGVDLSQDIK-YTLGTV----SNLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXXXXXXX---XDINFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPG--EINFVYNQIPC--GIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMD--IRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEV 1215
            ++L GY   +I   +LG++ +I ++    E+  + K  + L ++ + +T   V     +LP WV+FPDVE VEW   I+ + WP I  ++ K++ +TI   I+     L+      +N GD   K+ GVK +   +  + ++++D+   YL  G  EIN    +  C  G+K  ++ G LRV +  LI  +P  GAI++  ++ P ++  +T    + ++PGL S     ++D +A  +VLPNR+ IP+  +++  +    +P GV+RI+++EA  L A D  I+      SDPY +IRVG + F S  +++NLNP+W E +E IV     Q +E+EV
Sbjct:   24 VYLAGYYGFSISLVLLGLMLYIGWKHGRMEKVMRLKSAMYLLENEREFTTEKVFRAKRDLPPWVNFPDVEKVEW--QILQQAWPFIGQYLEKLLVETIAPAIRTSSIHLQTLSFTKVNIGDKALKVVGVKAHTEHD--KKQVMLDL---YLYAGDVEINVEIKKYFCKAGVKGVQLYGKLRVILEPLIGDVPLVGAITMFFIRRPKLDINWTGLTNLLDIPGL-SMSDTMIMDAIASHLVLPNRLTIPLVANLHVAQLRSPLPRGVVRIHLLEAEDLTAKDTVIKGLIDGKSDPYAVIRVGTQIFTSHHVDSNLNPQWREMYEVIVHEVPGQELEVEV 353          

HSP 2 Score: 58.151 bits (139), Expect = 1.038e-8
Identity = 31/74 (41.89%), Postives = 44/74 (59.46%), Query Frame = 1
Query: 1000 GVLRINVIEALSLKAMD--IRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEV 1215
            GVLRI+++EA +L A D  +       SDPY+ I+V    F+S TI  NLNP WNE +E I+     Q ++ E+
Sbjct:  541 GVLRIHLVEAQNLIAKDNFMGGMVKGKSDPYVKIKVAGITFRSHTIKENLNPVWNELYEVILTQLPGQEIQFEL 614          
BLAST of Extended synaptotagmin-like protein 2 vs. Planmine SMEST
Match: SMESG000026412.1 (SMESG000026412.1)

HSP 1 Score: 733.791 bits (1893), Expect = 0.000e+0
Identity = 391/391 (100.00%), Postives = 391/391 (100.00%), Query Frame = 1
Query:  133 MDIDNKSETLSDTQSSVKLKVFFYGKSFIIISVGFSLIWLLGYLQINILWGILGILTFIIYQISINEQRQKFKFGVDLSQDIKYTLGTVSNLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTIXXXXXXXXXXXXXXDINFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPCGIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMDIRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEVXXXXXXXXXXFLGSVSFDVQSVYDRGIFDT 1305
            MDIDNKSETLSDTQSSVKLKVFFYGKSFIIISVGFSLIWLLGYLQINILWGILGILTFIIYQISINEQRQKFKFGVDLSQDIKYTLGTVSNLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTILKKIQKKLKGLKLKDINFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPCGIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMDIRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEVNDKDKNNKDDFLGSVSFDVQSVYDRGIFDT
Sbjct:    1 MDIDNKSETLSDTQSSVKLKVFFYGKSFIIISVGFSLIWLLGYLQINILWGILGILTFIIYQISINEQRQKFKFGVDLSQDIKYTLGTVSNLPSWVSFPDVESVEWINTIILRLWPNITVFMNKIIRDTILKKIQKKLKGLKLKDINFGDVPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPCGIKNFEVKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRSFIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEALSLKAMDIRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVDTKSCQTVELEVNDKDKNNKDDFLGSVSFDVQSVYDRGIFDT 391          
The following BLAST results are available for this feature:
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ESYT37.143e-5431.94extended synaptotagmin 3 [Source:HGNC Symbol;Acc:H... [more]
ESYT33.138e-5131.94extended synaptotagmin 3 [Source:HGNC Symbol;Acc:H... [more]
ESYT24.575e-5134.85extended synaptotagmin 2 [Source:HGNC Symbol;Acc:H... [more]
ESYT24.995e-5134.85extended synaptotagmin 2 [Source:HGNC Symbol;Acc:H... [more]
ESYT29.724e-5134.85extended synaptotagmin 2 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
esyt-28.912e-5831.02Extended SYnapTotagmin homolog [Source:UniProtKB/... [more]
esyt-28.912e-5831.02Extended SYnapTotagmin homolog [Source:UniProtKB/... [more]
back to top
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Esyt21.007e-6935.28gene:FBgn0266758 transcript:FBtr0084647[more]
Esyt23.025e-6935.28gene:FBgn0266758 transcript:FBtr0084648[more]
Esyt22.080e-6834.48gene:FBgn0266758 transcript:FBtr0334336[more]
Esyt22.465e-6533.60gene:FBgn0266758 transcript:FBtr0306024[more]
back to top
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
esyt2b3.747e-5633.16extended synaptotagmin-like protein 2b [Source:ZFI... [more]
esyt2b3.944e-5633.16extended synaptotagmin-like protein 2b [Source:ZFI... [more]
esyt1a3.680e-5232.03extended synaptotagmin-like protein 1a [Source:ZFI... [more]
esyt31.035e-5130.75extended synaptotagmin-like protein 3 [Source:ZFIN... [more]
esyt2a5.765e-5031.19extended synaptotagmin-like protein 2a [Source:ZFI... [more]
back to top
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gdpd52.048e-5731.19glycerophosphodiester phosphodiesterase domain con... [more]
gdpd52.179e-5731.19glycerophosphodiester phosphodiesterase domain con... [more]
gdpd54.565e-5730.92glycerophosphodiester phosphodiesterase domain con... [more]
gdpd57.397e-5730.92glycerophosphodiester phosphodiesterase domain con... [more]
gdpd58.125e-5730.92glycerophosphodiester phosphodiesterase domain con... [more]
back to top
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Esyt21.247e-5432.78extended synaptotagmin-like protein 2 [Source:MGI ... [more]
Esyt21.247e-5432.78extended synaptotagmin-like protein 2 [Source:MGI ... [more]
Esyt35.274e-5232.22extended synaptotagmin-like protein 3 [Source:MGI ... [more]
Esyt11.462e-4729.23extended synaptotagmin-like protein 1 [Source:MGI ... [more]
Esyt29.943e-3428.08extended synaptotagmin-like protein 2 [Source:MGI ... [more]
back to top
BLAST of Extended synaptotagmin-like protein 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5M7N9|ESYT3_XENTR3.214e-5531.49Extended synaptotagmin-3 OS=Xenopus tropicalis OX=... [more]
sp|Q3TZZ7|ESYT2_MOUSE8.722e-5432.78Extended synaptotagmin-2 OS=Mus musculus OX=10090 ... [more]
sp|Q7ZWU7|EST2B_XENLA2.003e-5234.59Extended synaptotagmin-2-B OS=Xenopus laevis OX=83... [more]
sp|Q5FWL4|EST2A_XENLA6.098e-5234.59Extended synaptotagmin-2-A OS=Xenopus laevis OX=83... [more]
sp|Q5DTI8|ESYT3_MOUSE3.689e-5132.22Extended synaptotagmin-3 OS=Mus musculus OX=10090 ... [more]
back to top
BLAST of Extended synaptotagmin-like protein 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A564YV529.669e-7736.96Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A267DBI23.702e-7638.44Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A158R8K64.242e-7636.08Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A267EI816.430e-7638.16Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A7STM91.748e-7539.07Predicted protein OS=Nematostella vectensis OX=453... [more]
back to top
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
esyt2a2.392e-5432.66extended synaptotagmin-2 [Source:NCBI gene;Acc:103... [more]
esyt2a3.930e-5432.66extended synaptotagmin-2 [Source:NCBI gene;Acc:103... [more]
esyt2a4.605e-5432.66extended synaptotagmin-2 [Source:NCBI gene;Acc:103... [more]
esyt2a4.708e-5432.66extended synaptotagmin-2 [Source:NCBI gene;Acc:103... [more]
esyt2a5.959e-5432.66extended synaptotagmin-2 [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
esyt1b6.761e-5632.55extended synaptotagmin-like protein 1b [Source:ZFI... [more]
ENSPMAT00000006160.18.352e-744.44pep scaffold:Pmarinus_7.0:GL476688:98794:160173:1 ... [more]
ENSPMAT00000004337.11.643e-648.08pep scaffold:Pmarinus_7.0:GL478852:175856:252872:1... [more]
back to top
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
TCB22.256e-1024.51ER protein involved in ER-plasma membrane tetherin... [more]
TCB15.938e-1022.53Lipid-binding ER protein involved in ER-plasma mem... [more]
TCB39.315e-1023.45Cortical ER protein involved in ER-plasma membrane... [more]
back to top
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO329312.417e-7939.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO338424.563e-6643.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO463513.259e-5833.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO462773.504e-4929.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO457405.890e-633.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Extended synaptotagmin-like protein 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
esyt2b7.303e-6032.36extended synaptotagmin 2 [Source:NCBI gene;Acc:101... [more]
esyt32.151e-5532.47extended synaptotagmin-3 [Source:NCBI gene;Acc:101... [more]
esyt2a1.928e-4932.61extended synaptotagmin-2 [Source:NCBI gene;Acc:101... [more]
esyt1b1.611e-4728.77extended synaptotagmin-1 [Source:NCBI gene;Acc:101... [more]
esyt1a1.454e-4432.25extended synaptotagmin-1 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Extended synaptotagmin-like protein 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000026412.10.000e+0100.00SMESG000026412.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011410 ID=SMED30011410|Name=Extended synaptotagmin-like protein 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1305bp
AGAATTTATACAGAATAACTCTTTAGTTTTATAATTAGTTTCAATCAATT
ATAAATTGTATCAGTCAGAATAATTAATTAGTAAAATTTTATTCAATTTT
CTCACGAAAGCCTCTTTCGTGTAATAATTTTAATGGACATTGATAATAAA
TCAGAGACATTATCTGACACTCAATCAAGTGTTAAACTTAAAGTGTTCTT
CTATGGGAAATCTTTTATTATAATTTCCGTCGGATTTTCATTGATTTGGC
TTTTGGGTTATTTGCAAATTAATATATTATGGGGAATCCTAGGAATTCTG
ACATTTATTATTTATCAAATTTCAATAAATGAACAACGCCAGAAATTTAA
ATTTGGAGTAGATTTATCACAAGATATTAAATATACTTTGGGTACGGTTT
CGAATTTGCCGTCTTGGGTATCTTTTCCTGATGTTGAAAGTGTTGAATGG
ATCAATACAATTATTTTGCGTTTATGGCCAAACATTACTGTTTTTATGAA
TAAAATAATACGAGACACTATTCTGAAGAAAATTCAAAAAAAACTAAAAG
GATTAAAGTTGAAAGATATTAATTTCGGAGATGTTCCTCCCAAAATTGGT
GGAGTAAAAATTTATAACAATGAAAACATCAGTCGAGATGAGATCATCAT
AGATGTGGACATATACTATCTCTGTCCAGGGGAGATTAATTTTGTTTATA
ATCAAATTCCATGTGGTATCAAAAACTTTGAGGTAAAGGGACATCTGAGA
GTTCAAATTAATTCTCTGATTCCTCAAATTCCGTTTTTCGGCGCTATTAG
TCTCACTTTATTGCAAAATCCGCATGTAAATTTCGAATTCACTGATGCGG
TAGCTATTTTCAACATGCCTGGACTAAGGAGTTTCATAAGAGAGTCCTTA
GTCGATTTAGTAGCAGATGAGGTGGTTTTACCTAACAGAATCTGTATTCC
TATTAAAAAAGATATTAATAAAGTGAAATTTATGTATCATATTCCCGAAG
GTGTTTTACGAATCAATGTAATTGAGGCATTATCGTTGAAGGCCATGGAT
ATTCGAATTTTTGAGCACAATACATCGGATCCCTACATAATTATACGGGT
GGGAGCCGAAAAGTTTAAATCAAAAACTATTAATAACAATTTAAATCCAA
AATGGAATGAAACTTTTGAAGCTATTGTCGATACAAAATCTTGCCAAACT
GTAGAATTAGAAGTTAATGATAAAGATAAAAATAATAAAGATGACTTTCT
GGGAAGTGTATCATTTGATGTTCAATCAGTCTACGATCGAGGAATATTTG
ACACA
back to top

protein sequence of SMED30011410-orf-1

>SMED30011410-orf-1 ID=SMED30011410-orf-1|Name=SMED30011410-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=391bp
MDIDNKSETLSDTQSSVKLKVFFYGKSFIIISVGFSLIWLLGYLQINILW
GILGILTFIIYQISINEQRQKFKFGVDLSQDIKYTLGTVSNLPSWVSFPD
VESVEWINTIILRLWPNITVFMNKIIRDTILKKIQKKLKGLKLKDINFGD
VPPKIGGVKIYNNENISRDEIIIDVDIYYLCPGEINFVYNQIPCGIKNFE
VKGHLRVQINSLIPQIPFFGAISLTLLQNPHVNFEFTDAVAIFNMPGLRS
FIRESLVDLVADEVVLPNRICIPIKKDINKVKFMYHIPEGVLRINVIEAL
SLKAMDIRIFEHNTSDPYIIIRVGAEKFKSKTINNNLNPKWNETFEAIVD
TKSCQTVELEVNDKDKNNKDDFLGSVSFDVQSVYDRGIFDT
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006869lipid transport
GO:0061817endoplasmic reticulum-plasma membrane tethering
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR035892C2_domain_sf
IPR039010Synaptotagmin_SMP
IPR000008C2_dom
IPR031468SMP_LBD
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008289lipid binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000008C2 domainSMARTSM00239C2_3ccoord: 291..391
e-value: 2.8E-15
score: 66.7
IPR000008C2 domainPFAMPF00168C2coord: 290..384
e-value: 5.8E-23
score: 81.1
IPR000008C2 domainPROSITEPS50004C2coord: 292..377
score: 16.273
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 267..391
e-value: 3.5E-32
score: 113.2
IPR039010Synaptotagmin, SMP domainPFAMPF17047SMP_LBDcoord: 100..274
e-value: 9.7E-28
score: 96.8
NoneNo IPR availablePANTHERPTHR45761FAMILY NOT NAMEDcoord: 11..390
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 281..385
NoneNo IPR availableTMHMMTMhelixcoord: 21..43
NoneNo IPR availableTMHMMTMhelixcoord: 48..65
IPR031468Synaptotagmin-like mitochondrial-lipid-binding domainPROSITEPS51847SMPcoord: 100..275
score: 15.843