Ras family

Overview
NameRas family
Smed IDSMED30011402
Length (bp)1279
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ras family (SMED30011402) t-SNE clustered cells

Violin plots show distribution of expression levels for Ras family (SMED30011402) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ras family (SMED30011402) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ras family (SMED30011402) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011402

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30011402SMESG000007281.1 SmedASXL_012827SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30011402SMESG000007281.1 dd_Smed_v6_13540_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30011402SMESG000007281.1 SMED30011402smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30011402SMESG000007281.1 OX_Smed_1.0.18170ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Category 3 cellSMED30011402SMESG000007281.1 H.18.4ancbi_smed_estsPMID:18786419
Eisenhoffer et al., 2008
whole organism asexual adult cDNA to DNA expression microarray evidence
Category 3 cellSMED30011402SMESG000007281.1 H.18.4asmed_ncbi_20200123PMID:18786419
Eisenhoffer et al., 2008
whole organism asexual adult cDNA to DNA expression microarray evidence
Category 3 cellSMED30011402SMESG000007281.1 H.18.4ancbi_smed_estsPMID:18786419
Eisenhoffer et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
Category 3 cellSMED30011402SMESG000007281.1 H.18.4asmed_ncbi_20200123PMID:18786419
Eisenhoffer et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ras family vs. Ensembl Human
Match: RASL10B (RAS like family 10 member B [Source:HGNC Symbol;Acc:HGNC:30295])

HSP 1 Score: 118.627 bits (296), Expect = 1.144e-30
Identity = 65/204 (31.86%), Postives = 111/204 (54.41%), Query Frame = 1
Query:  430 RIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIELNI----EVPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSRDNNNKPNAARAMHNAFRRNQ 1029
            R+ VLG+  VGK++++ Q +Y     +     V       + P V+ N HV++++++D P    FP ++LQ+W       LR    +IL++D+    SF+++K+IR+QI+E  +    E P++I  NK DL    G+ +   +  +  +V+K WK C  +ECS KYNW +L +F EL++ +         +AA     A RRN+
Sbjct:    6 RVAVLGARGVGKSAIVRQFLY----NEFSEVCVPTTARRLYLPAVVMNGHVHDLQILDFPPISAFPVNTLQEWADTCCRGLRSVHAYILVYDICCFDSFEYVKTIRQQILETRVIGTSETPIIIVGNKRDLQ--RGRVI--PRWNVSHLVRKTWK-CGYVECSAKYNWHILLLFSELLKSVGC-ARCKHVHAALRFQGALRRNR 199          
BLAST of Ras family vs. Ensembl Human
Match: RASL10A (RAS like family 10 member A [Source:HGNC Symbol;Acc:HGNC:16954])

HSP 1 Score: 106.686 bits (265), Expect = 2.439e-26
Identity = 62/206 (30.10%), Postives = 112/206 (54.37%), Query Frame = 1
Query:  424 NLRIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSL---QDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIELNI----EVPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMR--LIDSRDNNNKPNAARAMHNA 1014
            +LR+ VLG+  VGKT++I Q ++    E+ +      + P  + P V+ +  VY++ + D  V    P  S    ++W      +L++   F+L++D+ S  SF ++K++R++I E       E P+++  NK D   +  +F    +R + A+V++ W+ C  +ECS KYNW VL +F+EL+R  L+ +R  +       A+H A
Sbjct:    4 SLRVAVLGAPGVGKTAIIRQFLFGDYPERHR----PTDGPRLYRPAVLLDGAVYDLSIRDGDVAG--PGSSPGGPEEWPDAKDWSLQDTDAFVLVYDICSPDSFDYVKALRQRIAETRPAGAPEAPILVVGNKRDRQRL--RF--GPRRALAALVRRGWR-CGYLECSAKYNWHVLRLFRELLRCALVRARPAHPALRLQGALHPA 198          
BLAST of Ras family vs. Ensembl Human
Match: DIRAS2 (DIRAS family GTPase 2 [Source:HGNC Symbol;Acc:HGNC:19323])

HSP 1 Score: 66.2402 bits (160), Expect = 5.537e-12
Identity = 56/191 (29.32%), Postives = 97/191 (50.79%), Query Frame = 1
Query:  406 LSESSQNLRIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIELNIEV---PMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSR 969
            + E S + R+ V G+  VGK+SL+ + +   T  +S  P V   + TY   ++  ++ +  +++ D     QFP  ++Q  +I  G        FIL++ +TS  S + +K I EQI E+  +V   P+++  NK D      + V++++ E  A   + WK C  +E S K N  V  +F+EL+ L   R
Sbjct:    1 MPEQSNDYRVAVFGAGGVGKSSLVLRFVK-GTFRESYIPTV---EDTYR-QVISCDKSICTLQITDTTGSHQFP--AMQRLSISKG------HAFILVYSITSRQSLEELKPIYEQICEIKGDVESIPIMLVGNKCD--ESPSREVQSSEAEALA---RTWK-CAFMETSAKLNHNVKELFQELLNLEKRR 172          
BLAST of Ras family vs. Ensembl Human
Match: RASD1 (ras related dexamethasone induced 1 [Source:HGNC Symbol;Acc:HGNC:15828])

HSP 1 Score: 67.0106 bits (162), Expect = 8.437e-12
Identity = 51/187 (27.27%), Postives = 90/187 (48.13%), Query Frame = 1
Query:  430 RIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIEL----------NIEVPMVIAANKVDLMSINGKFVRN-NKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRL 957
            R+V+LGSSKVGKT+++ + +     E +  P +      +H         VY + ++D      FP  +++  +IL G        FIL+F + +  SF+ ++ +R+QI++           N++VP+VI  NK D       F R  ++RE+  +V    + C   E S K N  +  +F+ L  +
Sbjct:   26 RMVILGSSKVGKTAIVSRFL-TGRFEDAYTPTIE----DFHRKFYSIRGEVYQLDILDTSGNHPFP--AMRRLSILTG------DVFILVFSLDNRDSFEEVQRLRQQILDTKSCLKNKTKENVDVPLVICGNKGD-----RDFYREVDQREIEQLVGDDPQRCAYFEISAKKNSSLDQMFRALFAM 194          
BLAST of Ras family vs. Ensembl Human
Match: RAP1B (RAP1B, member of RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9857])

HSP 1 Score: 64.6994 bits (156), Expect = 1.119e-11
Identity = 48/189 (25.40%), Postives = 87/189 (46.03%), Query Frame = 1
Query:  430 RIVVLGSSKVGKTSLIEQLM-------YCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIEL--NIEVPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSR 969
            ++VVLGS  VGK++L  Q +       Y  T+E S R  V ++                 + ++D    +QF        T +    ++   GF L++ +T++++F  ++ +REQI+ +    +VPM++  NK DL        R   +E    + + W  C  +E S K    V  +F +L+R I+ +
Sbjct:    5 KLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCM------------LEILDTAGTEQF--------TAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLED-----ERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRK 168          
BLAST of Ras family vs. Ensembl Celegans
Match: ral-1 (RAL (Ras-related GTPase) homolog [Source:UniProtKB/TrEMBL;Acc:Q9N3F8])

HSP 1 Score: 64.3142 bits (155), Expect = 1.065e-11
Identity = 48/192 (25.00%), Postives = 85/192 (44.27%), Query Frame = 1
Query:  430 RIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIEL---NIEVPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSRDNNNKPNAA 996
            +++++G+  VGK++L  Q MY   +E+ +         +Y   +V+  E        +C + D       +D++ +     R   GFI +F +    SF+     REQI+ +   +  VP+V+  NK D+     +  R    E+C    + W GC  +E S K    V  VF +LMR +  R   ++    
Sbjct:   19 KVIMVGTGGVGKSALTLQFMYDEFVEEYE----PTKADSYRKKVVLDGE--------ECSI-DILDTAGQEDYSAIRDNYYRSGEGFICVFSILDMESFEATNEFREQILRVKNSDSSVPIVLVGNKGDM-----RDQRVVSAELCRQRAEQW-GCHYVETSAKRRENVDKVFYDLMREMKRRKGGSQAQTG 191          
BLAST of Ras family vs. Ensembl Celegans
Match: ral-1 (RAL (Ras-related GTPase) homolog [Source:UniProtKB/TrEMBL;Acc:Q9N3F8])

HSP 1 Score: 64.6994 bits (156), Expect = 1.296e-11
Identity = 53/214 (24.77%), Postives = 94/214 (43.93%), Query Frame = 1
Query:  367 DTESINTGVCSKSLSESSQNL-RIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIEL---NIEVPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSRDNNNKPNAA 996
            D E++ +   S +L    Q + +++++G+  VGK++L  Q MY   +E+ +         +Y   +V+  E        +C + D       +D++ +     R   GFI +F +    SF+     REQI+ +   +  VP+V+  NK D+        R    E+C    + W GC  +E S K    V  VF +LMR +  R   ++    
Sbjct:   38 DPEAMASKKASGTLPPQQQVVHKVIMVGTGGVGKSALTLQFMYDEFVEEYE----PTKADSYRKKVVLDGE--------ECSI-DILDTAGQEDYSAIRDNYYRSGEGFICVFSILDMESFEATNEFREQILRVKNSDSSVPIVLVGNKGDMRD-----QRVVSAELCRQRAEQW-GCHYVETSAKRRENVDKVFYDLMREMKRRKGGSQAQTG 232          
BLAST of Ras family vs. Ensembl Celegans
Match: rap-1 (Ras-related protein Rap-1 [Source:UniProtKB/Swiss-Prot;Acc:Q18246])

HSP 1 Score: 60.077 bits (144), Expect = 1.876e-10
Identity = 51/189 (26.98%), Postives = 87/189 (46.03%), Query Frame = 1
Query:  430 RIVVLGSSKVGKTSLIEQLM-------YCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIEL--NIEVPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSR 969
            +IVVLGS  VGK++L  Q +       Y  T+E S R  V ++       I            +D    +QF        T +    ++   GF+L++ +T++++F  +  +R+QI+ +    EVPM++  NK DL   + + V  ++ +  A       G   +E S K    V  VF +L+R I+ R
Sbjct:    5 KIVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDGQQCMLEI------------LDTAGTEQF--------TAMRDLYMKNGQGFVLVYSITAQSTFNDLMDLRDQILRVKDTDEVPMILVGNKCDLE--DERVVGKDQGQNLA----RQFGSAFLETSAKAKINVSEVFYDLVRQINRR 167          
BLAST of Ras family vs. Ensembl Celegans
Match: ssr-2 (Sperm-Specific family, class R [Source:UniProtKB/TrEMBL;Acc:O02139])

HSP 1 Score: 59.3066 bits (142), Expect = 1.367e-9
Identity = 53/186 (28.49%), Postives = 86/186 (46.24%), Query Frame = 1
Query:  421 QNLRIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQ---DWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQII----ELNIEVPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRL 957
            +  R+VVLGS+KVGKT++I + +Y              N+ +  Y   I + H    R+   P+    P D L    ++  +   ++  AS F+L+F V    SF+ +  I ++I     +LN E+P+V+  NK D+   N K      +   A   +       IE S K N R+  VF+ L+ L
Sbjct:    4 ERYRLVVLGSAKVGKTNIIRRYLY--------------NEFSSKYKETIEDLHSREFRIQGVPL----PLDILDTNFNFPDMRRLSIASASAFLLVFSVDDVTSFKEMSDIWQEICSRRSDLN-ELPIVVVGNKCDVE--NKKIYEETAK---AFTNRLSSDVRYIEVSAKDNIRITDVFRTLLEL 165          
BLAST of Ras family vs. Ensembl Celegans
Match: rheb-1 (GTP-binding protein Rheb homolog 1 [Source:UniProtKB/Swiss-Prot;Acc:P34443])

HSP 1 Score: 57.3806 bits (137), Expect = 2.287e-9
Identity = 58/217 (26.73%), Postives = 106/217 (48.85%), Query Frame = 1
Query:  397 SKSLSESSQNL--RIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTIL-GGCNLREASGFILMFDVTSEASFQHIKSIREQIIEL--NIEVPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLID-SRDN---NNKPNAARAMHNAFR 1020
            S SL  + Q+L  ++ V+G   VGK++L+  L +   +   +  +   ++ + H  I  F+   Y++R+ D            Q++T+    C+L + +GFIL++ +    SF+   +I E+I+    +  +P+VI  NK DL +   + VR  + E  A   + W     +E + + + RV  VF+ L+R I+ SR N     +PN      N F+
Sbjct:    2 SSSLQSNRQSLNRKVAVMGYPHVGKSALV--LRFTQNIFPERYESTIEDQHSKH--IAAFHRD-YHLRVTDTA--------GQQEYTVFPRSCSL-DINGFILVYAIDDRKSFEMCSNIYEKIVRTYGDTSIPIVIVGNKTDLST--QRVVRAEEGEELA---RQWD-AKFVEITARESNRVHEVFELLLREIEISRGNLSPTERPNGNSPKRNPFK 198          
BLAST of Ras family vs. Ensembl Fly
Match: CG14669 (gene:FBgn0037326 transcript:FBtr0334742)

HSP 1 Score: 83.9593 bits (206), Expect = 9.917e-18
Identity = 47/181 (25.97%), Postives = 100/181 (55.25%), Query Frame = 1
Query:  427 LRIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPI----VIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIE--LNIEVPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELM 951
            L+   LG++ VGKTS+++Q  Y H   ++       ++ T H  I    ++ +  +  + ++D P   +FP D+  +W       LR    ++L++D+ +  +FQ+ +S+R+QI++   + +  +++  NK D ++   +      +++  +V+K W+ C  +ECS +YN+++  VF+ELM
Sbjct:   95 LKAAFLGATGVGKTSILQQFFY-HDFPRT-------HQTTTHRKIYKNCLVCDTCIRELMVLDVPPQKRFPADNFAEWNNGHPLGLRTVHAYVLVYDMGNLETFQYCRSMRDQILDSFSHRDFSIIVVGNKFDNVT-EAQANSQELKDISTLVRKHWR-CGYVECSAQYNYKIGDVFRELM 265          
BLAST of Ras family vs. Ensembl Fly
Match: CG14669 (gene:FBgn0037326 transcript:FBtr0078679)

HSP 1 Score: 83.9593 bits (206), Expect = 9.917e-18
Identity = 47/181 (25.97%), Postives = 100/181 (55.25%), Query Frame = 1
Query:  427 LRIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPI----VIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIE--LNIEVPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELM 951
            L+   LG++ VGKTS+++Q  Y H   ++       ++ T H  I    ++ +  +  + ++D P   +FP D+  +W       LR    ++L++D+ +  +FQ+ +S+R+QI++   + +  +++  NK D ++   +      +++  +V+K W+ C  +ECS +YN+++  VF+ELM
Sbjct:   95 LKAAFLGATGVGKTSILQQFFY-HDFPRT-------HQTTTHRKIYKNCLVCDTCIRELMVLDVPPQKRFPADNFAEWNNGHPLGLRTVHAYVLVYDMGNLETFQYCRSMRDQILDSFSHRDFSIIVVGNKFDNVT-EAQANSQELKDISTLVRKHWR-CGYVECSAQYNYKIGDVFRELM 265          
BLAST of Ras family vs. Ensembl Fly
Match: CG13375 (gene:FBgn0040370 transcript:FBtr0342963)

HSP 1 Score: 80.1073 bits (196), Expect = 1.338e-16
Identity = 53/177 (29.94%), Postives = 91/177 (51.41%), Query Frame = 1
Query:  430 RIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIE--LNIEVPMVIAANKVDLMSINGKFVRNNKREMC-AIVKKPWKGCVLIECSTKYNWRVLTVFKELM 951
            +IVV+GS+KVGKTS+I Q +Y     K KR    +++  +    V        + ++D     +FP         +   ++  A  FIL++DVT   +F+ +++IR+QI E      VP+V+  NK+DL++ +G+  R  +     ++V   W+    +E S   N  +  VFKEL+
Sbjct:   20 KIVVMGSAKVGKTSIITQFLYNTFSTKYKRTIEEMHQGNFSIAGVSL-----TLDILDTAGSYEFPA--------MRALSISSADAFILVYDVTDATTFEEVRTIRDQIHETKATTAVPIVVVGNKIDLLA-DGETEREVEYATTESVVTVDWENG-FVEASASSNENITQVFKELL 181          
BLAST of Ras family vs. Ensembl Fly
Match: CG13375 (gene:FBgn0040370 transcript:FBtr0070103)

HSP 1 Score: 80.1073 bits (196), Expect = 2.160e-16
Identity = 53/177 (29.94%), Postives = 91/177 (51.41%), Query Frame = 1
Query:  430 RIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIE--LNIEVPMVIAANKVDLMSINGKFVRNNKREMC-AIVKKPWKGCVLIECSTKYNWRVLTVFKELM 951
            +IVV+GS+KVGKTS+I Q +Y     K KR    +++  +    V        + ++D     +FP         +   ++  A  FIL++DVT   +F+ +++IR+QI E      VP+V+  NK+DL++ +G+  R  +     ++V   W+    +E S   N  +  VFKEL+
Sbjct:   49 KIVVMGSAKVGKTSIITQFLYNTFSTKYKRTIEEMHQGNFSIAGVSL-----TLDILDTAGSYEFPA--------MRALSISSADAFILVYDVTDATTFEEVRTIRDQIHETKATTAVPIVVVGNKIDLLA-DGETEREVEYATTESVVTVDWENG-FVEASASSNENITQVFKELL 210          
BLAST of Ras family vs. Ensembl Fly
Match: CG13375 (gene:FBgn0040370 transcript:FBtr0300326)

HSP 1 Score: 80.1073 bits (196), Expect = 2.160e-16
Identity = 53/177 (29.94%), Postives = 91/177 (51.41%), Query Frame = 1
Query:  430 RIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIE--LNIEVPMVIAANKVDLMSINGKFVRNNKREMC-AIVKKPWKGCVLIECSTKYNWRVLTVFKELM 951
            +IVV+GS+KVGKTS+I Q +Y     K KR    +++  +    V        + ++D     +FP         +   ++  A  FIL++DVT   +F+ +++IR+QI E      VP+V+  NK+DL++ +G+  R  +     ++V   W+    +E S   N  +  VFKEL+
Sbjct:   49 KIVVMGSAKVGKTSIITQFLYNTFSTKYKRTIEEMHQGNFSIAGVSL-----TLDILDTAGSYEFPA--------MRALSISSADAFILVYDVTDATTFEEVRTIRDQIHETKATTAVPIVVVGNKIDLLA-DGETEREVEYATTESVVTVDWENG-FVEASASSNENITQVFKELL 210          
BLAST of Ras family vs. Ensembl Zebrafish
Match: rasl10a (RAS-like, family 10, member A [Source:ZFIN;Acc:ZDB-GENE-060526-273])

HSP 1 Score: 106.686 bits (265), Expect = 1.490e-26
Identity = 71/208 (34.13%), Postives = 116/208 (55.77%), Query Frame = 1
Query:  421 QNLRIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHY-PIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIELNI----EVPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSRDNNNKPNAARAMHNAFRRNQ 1029
            + L I V+G+  VGKTS+I Q +Y +   ++  P     +  Y Y P VI N  +Y+++++D P    FP    Q+W       +R A+ +IL++D+    SF+++K IR+QI++  +    EVP+++  +K DL     +F    +R +  +VKK WK C  +ECS KYNW VL +FKEL+ +  SR       + R +  A +RN+
Sbjct:    3 ETLSIAVIGAPGVGKTSIIRQFIY-NDFSETYTP----TQTRYVYRPSVILNGVMYDLKILDVPPISSFPSSPSQEWLDSRCRGVRSANAYILVYDICCVESFEYVKMIRQQIVDNRVGSSSEVPILVVGSKRDLQ--RQRF--TQRRAVSVLVKKTWK-CGYVECSAKYNWHVLLLFKELLGIAVSRGLRPNHTSIR-LQGALQRNR 199          
BLAST of Ras family vs. Ensembl Zebrafish
Match: RASL10B (RAS like family 10 member B [Source:HGNC Symbol;Acc:HGNC:30295])

HSP 1 Score: 75.8702 bits (185), Expect = 6.876e-16
Identity = 35/120 (29.17%), Postives = 69/120 (57.50%), Query Frame = 1
Query:  427 LRIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIELNIEVPMV 786
             RI VLG+  VGKT+++++ ++    +     A+S      H    + N HV+++++ D P    FP  +LQ+W+ +    +R A  ++L++D+    SF+++K++R+QIIE +   P +
Sbjct:   29 FRIAVLGAPGVGKTAIVQRFLH----DDYSEVALSSKTRRVHLSAAVLNGHVHDLQITDYPAISSFPGSTLQEWSDVCCRGIRSAHVYVLVYDICCFDSFEYVKTMRQQIIETSPSFPFL 144          
BLAST of Ras family vs. Ensembl Zebrafish
Match: rap1ab (RAP1A, member of RAS oncogene family b [Source:ZFIN;Acc:ZDB-GENE-040426-2738])

HSP 1 Score: 67.781 bits (164), Expect = 7.070e-13
Identity = 50/189 (26.46%), Postives = 87/189 (46.03%), Query Frame = 1
Query:  430 RIVVLGSSKVGKTSLIEQLM-------YCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIEL--NIEVPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSR 969
            ++VVLGS  VGK++L  Q +       Y  T+E S R  V ++       I            +D    +QF        T +    ++   GF L++ +T++++F  ++ +REQI+ +    +VPM++  NK DL        R   +E    + + W  C  +E S K    VL +F +L+R I+ +
Sbjct:    5 KLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDGQQCMLEI------------LDTAGTEQF--------TAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKCDLED-----ERVVGKEQGQNLARQWNNCAFLESSAKSKINVLDIFYDLVRQINRK 168          
BLAST of Ras family vs. Ensembl Zebrafish
Match: rap1ab (RAP1A, member of RAS oncogene family b [Source:ZFIN;Acc:ZDB-GENE-040426-2738])

HSP 1 Score: 67.781 bits (164), Expect = 7.070e-13
Identity = 50/189 (26.46%), Postives = 87/189 (46.03%), Query Frame = 1
Query:  430 RIVVLGSSKVGKTSLIEQLM-------YCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIEL--NIEVPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSR 969
            ++VVLGS  VGK++L  Q +       Y  T+E S R  V ++       I            +D    +QF        T +    ++   GF L++ +T++++F  ++ +REQI+ +    +VPM++  NK DL        R   +E    + + W  C  +E S K    VL +F +L+R I+ +
Sbjct:    5 KLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDGQQCMLEI------------LDTAGTEQF--------TAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKCDLED-----ERVVGKEQGQNLARQWNNCAFLESSAKSKINVLDIFYDLVRQINRK 168          
BLAST of Ras family vs. Ensembl Zebrafish
Match: rap1ab (RAP1A, member of RAS oncogene family b [Source:ZFIN;Acc:ZDB-GENE-040426-2738])

HSP 1 Score: 67.781 bits (164), Expect = 7.070e-13
Identity = 50/189 (26.46%), Postives = 87/189 (46.03%), Query Frame = 1
Query:  430 RIVVLGSSKVGKTSLIEQLM-------YCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIEL--NIEVPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSR 969
            ++VVLGS  VGK++L  Q +       Y  T+E S R  V ++       I            +D    +QF        T +    ++   GF L++ +T++++F  ++ +REQI+ +    +VPM++  NK DL        R   +E    + + W  C  +E S K    VL +F +L+R I+ +
Sbjct:    5 KLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDGQQCMLEI------------LDTAGTEQF--------TAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKCDLED-----ERVVGKEQGQNLARQWNNCAFLESSAKSKINVLDIFYDLVRQINRK 168          
BLAST of Ras family vs. Ensembl Xenopus
Match: RASL10B (RAS like family 10 member B [Source:NCBI gene;Acc:100489153])

HSP 1 Score: 121.324 bits (303), Expect = 1.015e-31
Identity = 70/206 (33.98%), Postives = 110/206 (53.40%), Query Frame = 1
Query:  424 NLRIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIELNI----EVPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSRDNNNKPNAARAMHNAFRRNQ 1029
              +I VLG+  VGKT+++ Q MY     +     V         P V+ N HV+ ++++D P    FP ++LQ+W       LR A  +IL++D+    SF++IK++R+QI+E  +    E P++I  NK DL    G+ +   +  +  +VKK WK C  IECS KYNW +L +F EL++ +      +   A R    A RRN+
Sbjct:    4 TFKIAVLGAQGVGKTAIVRQFMY----NEFSEACVPTKGRRVFLPAVVMNGHVHELQIMDFPPITSFPVNTLQEWADSCCRGLRSAHAYILVYDICCFDSFEYIKTLRQQILETRVIGTNETPIIIVGNKRDLQ--RGRVI--PRWNVSHLVKKTWK-CGYIECSAKYNWHILLLFSELLKSVGCARCKHVHAAIR-FQGALRRNR 199          
BLAST of Ras family vs. Ensembl Xenopus
Match: rasl10a (RAS like family 10 member A [Source:NCBI gene;Acc:448561])

HSP 1 Score: 96.2857 bits (238), Expect = 1.370e-22
Identity = 55/190 (28.95%), Postives = 97/190 (51.05%), Query Frame = 1
Query:  424 NLRIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIELNIEVPM-VIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSRDNNNKPN 990
             +++ VLG+  VGKTS++ + +     E+     +       H    + +  +Y + ++D P   ++P  + Q+W       LR +  FIL+FD+ S  SF H+K +R+QI++   + P+ V+  NK D      K     +  +  +VKK WK C  +ECS + NW +L +FKEL+    +R  +  P+
Sbjct:    4 TVQVAVLGAPGVGKTSIVRRFVAQEFPEE----YIPTEHRELHRASAVLSGRLYELHILDVPNMQRYPGTAGQEWMDPRFRGLRNSRAFILVFDICSPESFHHVKLLRQQILDSTNKSPLIVVVGNKRD----QQKHRFAPRHVLSVLVKKSWK-CGYLECSARSNWHILLLFKELLISATTRGRSTSPS 184          
BLAST of Ras family vs. Ensembl Xenopus
Match: rasl10a (RAS like family 10 member A [Source:NCBI gene;Acc:448561])

HSP 1 Score: 96.6709 bits (239), Expect = 1.686e-22
Identity = 55/190 (28.95%), Postives = 97/190 (51.05%), Query Frame = 1
Query:  424 NLRIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIELNIEVPM-VIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSRDNNNKPN 990
             +++ VLG+  VGKTS++ + +     E+     +       H    + +  +Y + ++D P   ++P  + Q+W       LR +  FIL+FD+ S  SF H+K +R+QI++   + P+ V+  NK D      K     +  +  +VKK WK C  +ECS + NW +L +FKEL+    +R  +  P+
Sbjct:    4 TVQVAVLGAPGVGKTSIVRRFVAQEFPEEY----IPTEHRELHRASAVLSGRLYELHILDVPNMQRYPGTAGQEWMDPRFRGLRNSRAFILVFDICSPESFHHVKLLRQQILDSTNKSPLIVVVGNKRD----QQKHRFAPRHVLSVLVKKSWK-CGYLECSARSNWHILLLFKELLISATTRGRSTSPS 184          
BLAST of Ras family vs. Ensembl Xenopus
Match: pnp (purine nucleoside phosphorylase [Source:Xenbase;Acc:XB-GENE-1011598])

HSP 1 Score: 65.0846 bits (157), Expect = 1.109e-11
Identity = 53/198 (26.77%), Postives = 96/198 (48.48%), Query Frame = 1
Query:  406 LSESSQNLRIVVLGSSKVGKTSLIEQLM-------YCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIELNIE---VPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSR 969
            + E S + R+VV G++ VGK+SL+ + +       Y  T+E + R  +S +K            ++  +++ D     QFP  ++Q  +I  G        FIL++ VTS+ S + ++ I EQI ++  +   +P+++  NK D      + +R  +      +   WK C  +E S K N+ V  +F+EL+ L   R
Sbjct:    1 MPEPSNDYRVVVFGAAGVGKSSLVLRFVRGTFRETYIPTIEDTYRQVISCDK------------NICTLQITDTTGSHQFP--AMQRLSISKG------HAFILVYSVTSKQSMEELQPIYEQICQIKGDTQNIPIMLVGNKSD------ETLREVQASEGECLANKWK-CSFMETSAKLNYNVQELFQELLNLEKRR 171          
BLAST of Ras family vs. Ensembl Xenopus
Match: rap1b (RAP1B, member of RAS oncogene family [Source:NCBI gene;Acc:493557])

HSP 1 Score: 64.6994 bits (156), Expect = 1.183e-11
Identity = 46/182 (25.27%), Postives = 89/182 (48.90%), Query Frame = 1
Query:  430 RIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIEL--NIEVPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSR 969
            ++VVLGS  VGK++L  Q +    +EK   P +   + +Y   + +  +    + ++D    +QF        T +    ++   GF L++ +T++++F  ++ +REQI+ +    +VPM++  NK DL        R   +E    + + W  C  +E S K    V  +F +L+R I+ +
Sbjct:    5 KLVVLGSGGVGKSALTVQFVQGIFVEKYD-PTI---EDSYRKQVEVDGQQCM-LEILDTAGTEQF--------TAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLED-----ERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRK 168          
BLAST of Ras family vs. Ensembl Mouse
Match: Rasl10b (RAS-like, family 10, member B [Source:MGI Symbol;Acc:MGI:2685575])

HSP 1 Score: 118.242 bits (295), Expect = 8.442e-31
Identity = 65/204 (31.86%), Postives = 111/204 (54.41%), Query Frame = 1
Query:  430 RIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIELNI----EVPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSRDNNNKPNAARAMHNAFRRNQ 1029
            R+ VLG+  VGK++++ Q +Y     +     V       + P V+ N HV++++++D P    FP ++LQ+W       LR    +IL++D+    SF+++K+IR+QI+E  +    E P++I  NK DL    G+ +   +  +  +V+K WK C  +ECS KYNW +L +F EL++ +         +AA     A RRN+
Sbjct:    6 RVAVLGARGVGKSAIVRQFLY----NEFSEVCVPTTTRRLYLPAVVMNGHVHDLQILDFPPISAFPVNTLQEWADACCRGLRSVHAYILVYDICCFDSFEYVKTIRQQILETRVIGTSETPIIIVGNKRDLQ--RGRVI--PRWNVSHLVRKTWK-CGYVECSAKYNWHILLLFSELLKSVGC-ARCKHVHAALRFQGALRRNR 199          
BLAST of Ras family vs. Ensembl Mouse
Match: Rasl10b (RAS-like, family 10, member B [Source:MGI Symbol;Acc:MGI:2685575])

HSP 1 Score: 118.242 bits (295), Expect = 8.442e-31
Identity = 65/204 (31.86%), Postives = 111/204 (54.41%), Query Frame = 1
Query:  430 RIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIELNI----EVPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSRDNNNKPNAARAMHNAFRRNQ 1029
            R+ VLG+  VGK++++ Q +Y     +     V       + P V+ N HV++++++D P    FP ++LQ+W       LR    +IL++D+    SF+++K+IR+QI+E  +    E P++I  NK DL    G+ +   +  +  +V+K WK C  +ECS KYNW +L +F EL++ +         +AA     A RRN+
Sbjct:    6 RVAVLGARGVGKSAIVRQFLY----NEFSEVCVPTTTRRLYLPAVVMNGHVHDLQILDFPPISAFPVNTLQEWADACCRGLRSVHAYILVYDICCFDSFEYVKTIRQQILETRVIGTSETPIIIVGNKRDLQ--RGRVI--PRWNVSHLVRKTWK-CGYVECSAKYNWHILLLFSELLKSVGC-ARCKHVHAALRFQGALRRNR 199          
BLAST of Ras family vs. Ensembl Mouse
Match: Rasl10b (RAS-like, family 10, member B [Source:MGI Symbol;Acc:MGI:2685575])

HSP 1 Score: 118.242 bits (295), Expect = 8.442e-31
Identity = 65/204 (31.86%), Postives = 111/204 (54.41%), Query Frame = 1
Query:  430 RIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIELNI----EVPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSRDNNNKPNAARAMHNAFRRNQ 1029
            R+ VLG+  VGK++++ Q +Y     +     V       + P V+ N HV++++++D P    FP ++LQ+W       LR    +IL++D+    SF+++K+IR+QI+E  +    E P++I  NK DL    G+ +   +  +  +V+K WK C  +ECS KYNW +L +F EL++ +         +AA     A RRN+
Sbjct:    6 RVAVLGARGVGKSAIVRQFLY----NEFSEVCVPTTTRRLYLPAVVMNGHVHDLQILDFPPISAFPVNTLQEWADACCRGLRSVHAYILVYDICCFDSFEYVKTIRQQILETRVIGTSETPIIIVGNKRDLQ--RGRVI--PRWNVSHLVRKTWK-CGYVECSAKYNWHILLLFSELLKSVGC-ARCKHVHAALRFQGALRRNR 199          
BLAST of Ras family vs. Ensembl Mouse
Match: Rasl10a (RAS-like, family 10, member A [Source:MGI Symbol;Acc:MGI:1922918])

HSP 1 Score: 105.916 bits (263), Expect = 3.074e-26
Identity = 61/204 (29.90%), Postives = 111/204 (54.41%), Query Frame = 1
Query:  424 NLRIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCD-SLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIE----LNIEVPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMR--LIDSRDNNNKPNAARAMHNA 1014
            +LR+ VLG+  VGKT++I Q ++    E+ +      + P  + P V+ +  VY++ + D  V        SL++W      +L++   F+L++D+ S  SF ++K++R++I E       E P+++  NK D   +  +F    +R +  +V++ W+ C  +ECS KYNW VL +F+EL+R  L+ +R  +       A+H A
Sbjct:    4 SLRVAVLGAPGVGKTAIIRQFLFGDYPERHR----PTDSPCLYRPAVLLDGAVYDLSIRDGDVAGPGSSPRSLEEWPDPKDWSLQDTDAFVLVYDICSPDSFDYVKALRQRIAENRPAGAPEAPILVVGNKRDRQRL--RF--GPRRALATLVRRGWR-CGYLECSAKYNWHVLRLFRELLRCALVRTRPAHPTLRLQGALHPA 198          
BLAST of Ras family vs. Ensembl Mouse
Match: Rasl10b (RAS-like, family 10, member B [Source:MGI Symbol;Acc:MGI:2685575])

HSP 1 Score: 76.2554 bits (186), Expect = 3.079e-16
Identity = 35/111 (31.53%), Postives = 64/111 (57.66%), Query Frame = 1
Query:  430 RIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIE 762
            R+ VLG+  VGK++++ Q +Y     +     V       + P V+ N HV++++++D P    FP ++LQ+W       LR    +IL++D+    SF+++K+IR+QI+E
Sbjct:    6 RVAVLGARGVGKSAIVRQFLY----NEFSEVCVPTTTRRLYLPAVVMNGHVHDLQILDFPPISAFPVNTLQEWADACCRGLRSVHAYILVYDICCFDSFEYVKTIRQQILE 112          
BLAST of Ras family vs. UniProt/SwissProt
Match: sp|Q96S79|RSLAB_HUMAN (Ras-like protein family member 10B OS=Homo sapiens OX=9606 GN=RASL10B PE=1 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 5.495e-30
Identity = 65/204 (31.86%), Postives = 111/204 (54.41%), Query Frame = 1
Query:  430 RIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIELNI----EVPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSRDNNNKPNAARAMHNAFRRNQ 1029
            R+ VLG+  VGK++++ Q +Y     +     V       + P V+ N HV++++++D P    FP ++LQ+W       LR    +IL++D+    SF+++K+IR+QI+E  +    E P++I  NK DL    G+ +   +  +  +V+K WK C  +ECS KYNW +L +F EL++ +         +AA     A RRN+
Sbjct:    6 RVAVLGARGVGKSAIVRQFLY----NEFSEVCVPTTARRLYLPAVVMNGHVHDLQILDFPPISAFPVNTLQEWADTCCRGLRSVHAYILVYDICCFDSFEYVKTIRQQILETRVIGTSETPIIIVGNKRDLQ--RGRVI--PRWNVSHLVRKTWK-CGYVECSAKYNWHILLLFSELLKSVGC-ARCKHVHAALRFQGALRRNR 199          
BLAST of Ras family vs. UniProt/SwissProt
Match: sp|Q5SSG5|RSLAB_MOUSE (Ras-like protein family member 10B OS=Mus musculus OX=10090 GN=Rasl10b PE=1 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 5.905e-30
Identity = 65/204 (31.86%), Postives = 111/204 (54.41%), Query Frame = 1
Query:  430 RIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIELNI----EVPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSRDNNNKPNAARAMHNAFRRNQ 1029
            R+ VLG+  VGK++++ Q +Y     +     V       + P V+ N HV++++++D P    FP ++LQ+W       LR    +IL++D+    SF+++K+IR+QI+E  +    E P++I  NK DL    G+ +   +  +  +V+K WK C  +ECS KYNW +L +F EL++ +         +AA     A RRN+
Sbjct:    6 RVAVLGARGVGKSAIVRQFLY----NEFSEVCVPTTTRRLYLPAVVMNGHVHDLQILDFPPISAFPVNTLQEWADACCRGLRSVHAYILVYDICCFDSFEYVKTIRQQILETRVIGTSETPIIIVGNKRDLQ--RGRVI--PRWNVSHLVRKTWK-CGYVECSAKYNWHILLLFSELLKSVGC-ARCKHVHAALRFQGALRRNR 199          
BLAST of Ras family vs. UniProt/SwissProt
Match: sp|Q92737|RSLAA_HUMAN (Ras-like protein family member 10A OS=Homo sapiens OX=9606 GN=RASL10A PE=1 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 1.171e-25
Identity = 62/206 (30.10%), Postives = 112/206 (54.37%), Query Frame = 1
Query:  424 NLRIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSL---QDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIELNI----EVPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMR--LIDSRDNNNKPNAARAMHNA 1014
            +LR+ VLG+  VGKT++I Q ++    E+ +      + P  + P V+ +  VY++ + D  V    P  S    ++W      +L++   F+L++D+ S  SF ++K++R++I E       E P+++  NK D   +  +F    +R + A+V++ W+ C  +ECS KYNW VL +F+EL+R  L+ +R  +       A+H A
Sbjct:    4 SLRVAVLGAPGVGKTAIIRQFLFGDYPERHR----PTDGPRLYRPAVLLDGAVYDLSIRDGDVAG--PGSSPGGPEEWPDAKDWSLQDTDAFVLVYDICSPDSFDYVKALRQRIAETRPAGAPEAPILVVGNKRDRQRL--RF--GPRRALAALVRRGWR-CGYLECSAKYNWHVLRLFRELLRCALVRARPAHPALRLQGALHPA 198          
BLAST of Ras family vs. UniProt/SwissProt
Match: sp|Q8K5A4|RSLAA_MOUSE (Ras-like protein family member 10A OS=Mus musculus OX=10090 GN=Rasl10a PE=2 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 2.150e-25
Identity = 61/204 (29.90%), Postives = 111/204 (54.41%), Query Frame = 1
Query:  424 NLRIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCD-SLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIE----LNIEVPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMR--LIDSRDNNNKPNAARAMHNA 1014
            +LR+ VLG+  VGKT++I Q ++    E+ +      + P  + P V+ +  VY++ + D  V        SL++W      +L++   F+L++D+ S  SF ++K++R++I E       E P+++  NK D   +  +F    +R +  +V++ W+ C  +ECS KYNW VL +F+EL+R  L+ +R  +       A+H A
Sbjct:    4 SLRVAVLGAPGVGKTAIIRQFLFGDYPERHR----PTDSPCLYRPAVLLDGAVYDLSIRDGDVAGPGSSPRSLEEWPDPKDWSLQDTDAFVLVYDICSPDSFDYVKALRQRIAENRPAGAPEAPILVVGNKRDRQRL--RF--GPRRALATLVRRGWR-CGYLECSAKYNWHVLRLFRELLRCALVRTRPAHPTLRLQGALHPA 198          
BLAST of Ras family vs. UniProt/SwissProt
Match: sp|P48555|RALA_DROME (Ras-related protein Ral-a OS=Drosophila melanogaster OX=7227 GN=Rala PE=1 SV=2)

HSP 1 Score: 70.8626 bits (172), Expect = 6.135e-13
Identity = 55/206 (26.70%), Postives = 94/206 (45.63%), Query Frame = 1
Query:  430 RIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIEL--NIEVPMVIAANKVDLMSINGKFVRNNKREM----CAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSRD-NNNKPNAARAMHNAFRRN 1026
            +++++GS  VGK++L  Q MY   +E  +         +Y   +V+  E V  I ++D            +D+  +     R   GF+ +F +T + SFQ  +  REQI+ +  +  +P ++  NK DL         N+KR++    C +  + W     +E S K    V  VF +LMR I SR   ++K  + RA     +R 
Sbjct:   13 KVIMVGSGGVGKSALTLQFMYDEFVEDYE----PTKADSYRKKVVLDGEEV-QIDILDTA--------GQEDYAAIRDNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDESIPFLLVGNKCDL---------NDKRKVPLSECQLRAQQW-AVPYVETSAKTRENVDKVFFDLMREIRSRKTEDSKATSGRAKDRCKKRR 195          
BLAST of Ras family vs. TrEMBL
Match: G7Y7Y2 (Ras-like family 10 member B (Fragment) OS=Clonorchis sinensis OX=79923 GN=CLF_102444 PE=4 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 1.305e-52
Identity = 100/314 (31.85%), Postives = 174/314 (55.41%), Query Frame = 1
Query:  178 TKRKPNVRLKISSHNNPNCCHKSESNILLSNYMLDSNQTDINNYTNDNDPNPFKTTNIPSGTNDTESINTGVCSKSLSESSQNLRIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCP-VFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIELNIEVPMVIAANKVDLM-----------------------------SINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSRDNNNKPNAARAMHNAFRRNQ 1029
            TKR P+   K+SS+ +   C  ++     S ++      D+    +     P  ++ + + T + +  +   C+  L       RI ++GS   GKTSL+ Q ++C  +     P  ++ +P Y+  ++ FN+ ++++R+IDCP +  ++P  S ++W    G  LR AS F+L+FD+TS+ SFQ+ + +R+QI+  + ++P+++ ANK+D                               S++   + N +RE+ A+VKK WKG VL+ECS KYNW V+TVFKELM+L+++++ ++KP AARA+ N  RRNQ
Sbjct:   54 TKRSPHETEKLSSNQSARSCCSAKRGSEASEWVPLKKIADVTAPISAIARVPNGSSYLLNATPEKDEFSAVECASVL-------RIPIVGSRHSGKTSLVRQFVHCVDVVN---PTPTLTRPEYYDRVITFNDRLFSLRIIDCPPIMGRYPTTSAEEWLHYRGWGLRSASAFVLVFDITSDQSFQYTRHLRDQIVSEHADIPVLLVANKIDKFHITEPNSCATQCSPQTTASTALTTLAGTDSLSRHTISNLRREVAALVKKQWKGTVLVECSAKYNWHVVTVFKELMKLLETKEQSHKPTAARAVQNVLRRNQ 357          
BLAST of Ras family vs. TrEMBL
Match: A0A183A6Q3 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS2638 PE=4 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 1.311e-52
Identity = 104/264 (39.39%), Postives = 155/264 (58.71%), Query Frame = 1
Query:  325 PNPFKTTNIPSGTNDTESI---NTGVCSKSLSESSQNLRIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFD-QFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIELNIEVPMVIAANKVD-------------------LMSINGKFVR------NNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSRD-NNNKPNAARAMHNAFRRN 1026
            P P  +   PS  N   SI   +    S + + +    R+ VLGS + GKT+L++Q +YC     S  PA +  +P Y+ P+V FN+ +Y++R+IDCP  D ++P  S ++W    G  LR A+ F+L+FDVTSE SFQ+I+ +R+QII    + P+++ ANKVD                   ++S N           N +RE+  +VKK WKG VL+ECS KYNW VLTVFKELM+L+++++  +++P AARA+ N  RRN
Sbjct:  134 PGPIFSALKPSNGNLPSSIVLESEDSVSSATTPTVTLTRVPVLGSRRCGKTTLVKQFVYC---TGSFNPAPTTFEPEYYDPVVTFNDRIYHLRIIDCPALDGKYPSSSFEEWAEYRGWCLRSAAAFLLVFDVTSEKSFQYIRKLRDQIISECPDTPVLLVANKVDGIPSTNTVTLPIVNYGATTMLSCNDAVAASTTTRMNIRREIALLVKKQWKGTVLVECSAKYNWHVLTVFKELMKLLENKEQQSHRPTAARAVQNVLRRN 394          
BLAST of Ras family vs. TrEMBL
Match: A0A1S8XA17 (GTP-binding domain protein OS=Opisthorchis viverrini OX=6198 GN=X801_00533 PE=4 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 1.865e-52
Identity = 89/239 (37.24%), Postives = 148/239 (61.92%), Query Frame = 1
Query:  403 SLSESSQNLRIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCP-VFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIELNIEVPMVIAANKVDLM-----------------------------SINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSRDNNNKPNAARAMHNAFRRNQ 1029
            S  E +  LRI ++GS   GKTSL+ Q ++C  +     P  ++ +P Y+  ++ FN+ ++N+R+IDCP +  ++P  S ++W+   G  LR AS F+L+FD+TS+ SFQ+ + +R+QI+  + ++P+++ ANK+D +                             S++   + N +RE+ A+VKK WKG VL+ECS +YNW V+TVFKELM+L+++++ ++KP AARA+ N  RRNQ
Sbjct:  184 SAVECASVLRIPIVGSRHSGKTSLVRQFVHCADVVN---PTPTLTRPEYYDRVITFNDRLFNLRMIDCPSIMGRYPTTSAEEWSHYRGWGLRSASAFVLVFDITSDQSFQYTRHLRDQIVSEHADIPVLLVANKIDKLHITEPNSCATHCSPQSTAPTALTTLAGTDSLSRHTISNLRREVAALVKKQWKGTVLVECSARYNWHVVTVFKELMKLLETKEQSHKPTAARAVQNVLRRNQ 419          
BLAST of Ras family vs. TrEMBL
Match: A0A074Z526 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_09665 PE=4 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 2.768e-52
Identity = 89/239 (37.24%), Postives = 148/239 (61.92%), Query Frame = 1
Query:  403 SLSESSQNLRIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCP-VFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIELNIEVPMVIAANKVDLM-----------------------------SINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSRDNNNKPNAARAMHNAFRRNQ 1029
            S  E +  LRI ++GS   GKTSL+ Q ++C  +     P  ++ +P Y+  ++ FN+ ++N+R+IDCP +  ++P  S ++W+   G  LR AS F+L+FD+TS+ SFQ+ + +R+QI+  + ++P+++ ANK+D +                             S++   + N +RE+ A+VKK WKG VL+ECS +YNW V+TVFKELM+L+++++ ++KP AARA+ N  RRNQ
Sbjct:  170 SAVECASVLRIPIVGSRHSGKTSLVRQFVHCVDVVN---PTPTLTRPEYYDRVITFNDRLFNLRMIDCPSIMGRYPTTSAEEWSHYRGWGLRSASAFVLVFDITSDQSFQYTRHLRDQIVSEHADIPVLLVANKIDKLHITEPNSCATHCSPQSTAPTALTTLAGTDSLSRHTISNLRREVAALVKKQWKGTVLVECSARYNWHVVTVFKELMKLLETKEQSHKPTAARAVQNVLRRNQ 405          
BLAST of Ras family vs. TrEMBL
Match: A0A3R7FIT8 (Ras-like protein family member 10B OS=Clonorchis sinensis OX=79923 GN=Rasl10b PE=4 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 3.058e-52
Identity = 101/314 (32.17%), Postives = 174/314 (55.41%), Query Frame = 1
Query:  178 TKRKPNVRLKISSHNNPNCCHKSESNILLSNYMLDSNQTDINNYTNDNDPNPFKTTNIPSGTNDTESINTGVCSKSLSESSQNLRIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCP-VFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIELNIEVPMVIAANKVDLM-----------------------------SINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSRDNNNKPNAARAMHNAFRRNQ 1029
            TKR P+   K+SS+ +   C  ++     S ++      D+    +     P  ++ + + T + +  +   C+  L       RI ++GS   GKTSL+ Q ++C  +     P  ++ +P Y+  ++ FN+ ++N+R+IDCP +  ++P  S ++W    G  LR AS F+L+FD+TS+ SFQ+ + +R+QI+  + ++P+++ ANK+D                               S++   + N +RE+ A+VKK WKG VL+ECS KYNW V+TVFKELM+L+++++ ++KP AARA+ N  RRNQ
Sbjct:  145 TKRSPHETEKLSSNQSARSCCSAKRGSEASEWVPLKKIADVTAPISAIARVPNGSSYLLNATPEKDEFSAVECASVL-------RIPIVGSRHSGKTSLVRQFVHCVDVVN---PTPTLTRPEYYDRVITFNDRLFNLRIIDCPPIMGRYPTTSAEEWLHYRGWGLRSASAFVLVFDITSDQSFQYTRHLRDQIVSEHADIPVLLVANKIDKFHITEPNSCATQCSPQTTASTALTTLAGTDSLSRHTISNLRREVAALVKKQWKGTVLVECSAKYNWHVVTVFKELMKLLETKEQSHKPTAARAVQNVLRRNQ 448          
BLAST of Ras family vs. Ensembl Cavefish
Match: rasl10a (RAS-like, family 10, member A [Source:ZFIN;Acc:ZDB-GENE-060526-273])

HSP 1 Score: 116.316 bits (290), Expect = 3.474e-30
Identity = 71/207 (34.30%), Postives = 116/207 (56.04%), Query Frame = 1
Query:  421 QNLRIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHY-PIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIEL---NIEVPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSRDNNNKPNAARAMHNAFRRNQ 1029
            + L I V+G+  VGKTS+I + +Y +   +S  P     +  Y Y P VI N  +Y+++++D P    FP    Q+W       +R AS +IL++D+    SF+++K IR+QI++    + EVP+++  +K DL     +F    +R +  +VKK WK C  +EC  KYNW VL +FKEL+ +  +R   N   + R +  A +RN+
Sbjct:    3 ETLSIAVIGAPGVGKTSIIRRFVY-NDFSESYNP----TQERYVYRPSVILNGVMYDLKILDVPPIASFPSSPSQEWLDSRCRGVRNASAYILVYDICCVESFEYVKMIRQQIVDYEGSSSEVPILVVGSKRDLQ--RHRF--TQRRAVSVLVKKTWK-CGYVECCAKYNWHVLLLFKELLGIAVARGLRNNHTSIR-LQGALQRNR 198          
BLAST of Ras family vs. Ensembl Cavefish
Match: RASL10B (RAS like family 10 member B [Source:NCBI gene;Acc:103040296])

HSP 1 Score: 110.538 bits (275), Expect = 9.130e-28
Identity = 61/181 (33.70%), Postives = 103/181 (56.91%), Query Frame = 1
Query:  427 LRIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIELN----IEVPMVIAANKVDLMSINGKFV-RNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMR 954
             RI VLG+  VGKT+++++ ++    +     A S      H    + N HV+++++ D P    FP  SLQ+W+ +    +R A  +IL++D+    SF+++K++R+QI+E       E P++I  NK DL    G+ + R+N  ++   V+K WK C  +ECS K+NW VL +F E +R
Sbjct:   29 FRIAVLGAQGVGKTAIVQRFLH----DDYSDVAASSRTRRVHLSAAVLNGHVHDLQITDYPAISSFPGSSLQEWSDVCCRGIRSAHVYILVYDICCFDSFEYVKTMRQQILETRGMGATETPILIVGNKRDLQ--RGRVIPRHNVSDL---VRKSWK-CGYVECSAKFNWHVLLLFGEALR 199          
BLAST of Ras family vs. Ensembl Cavefish
Match: rap1ab (ras-related protein Rap-1A [Source:NCBI gene;Acc:103022868])

HSP 1 Score: 67.0106 bits (162), Expect = 1.006e-12
Identity = 50/189 (26.46%), Postives = 87/189 (46.03%), Query Frame = 1
Query:  430 RIVVLGSSKVGKTSLIEQLM-------YCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIEL--NIEVPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSR 969
            ++VVLGS  VGK++L  Q +       Y  T+E S R  V ++       I            +D    +QF        T +    ++   GF L++ +T++++F  ++ +REQI+ +    +VPM++  NK DL        R   +E    + + W  C  +E S K    VL +F +L+R I+ +
Sbjct:    5 KLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDGQQCMLEI------------LDTAGTEQF--------TAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKCDLED-----ERVVGKEQGQNLARQWNHCAFLESSAKSKINVLDIFYDLVRQINRK 168          
BLAST of Ras family vs. Ensembl Cavefish
Match: rasd4 (ras-related protein Rap-1b-like [Source:NCBI gene;Acc:103035404])

HSP 1 Score: 66.6254 bits (161), Expect = 2.441e-12
Identity = 52/188 (27.66%), Postives = 89/188 (47.34%), Query Frame = 1
Query:  397 SKSLSESSQNLRIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIELNIE--VPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMR 954
            S  + E    +R+V +G++ VGKT+LI++ +      K +R    ++   Y    V        I ++D      FP  +++  +I  G        F L++ V    S   +KS+RE+I+E+  +   P+V+  NK D +       R +  ++ A V+  W  C L E S K N  VL VF+EL++
Sbjct:    2 SLDVKEEKTEIRLVFMGAAGVGKTALIQRFLQDSFEPKHRRTVEELHSKEYEVGGV-----KVTINIMDTSGSYSFP--AMRKLSIQNG------DAFALVYSVDDPESLDAVKSLREEILEVKEDKFTPIVVVGNKTDRLGER----RVSADDVLATVELDWNNCFL-EASAKENNNVLEVFRELLQ 171          
BLAST of Ras family vs. Ensembl Cavefish
Match: rap1aa (RAP1A, member of RAS oncogene family [Source:NCBI gene;Acc:103047011])

HSP 1 Score: 65.4698 bits (158), Expect = 3.332e-12
Identity = 48/192 (25.00%), Postives = 92/192 (47.92%), Query Frame = 1
Query:  430 RIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIELN--IEVPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSRDNNNKPNAAR 999
            ++VVLGS  VGK++L  Q +    +EK   P +   + +Y   + +  +    + ++D    +QF        T +    ++   GF L++ +T++++F  ++ +REQI+ +    +VPM++  NK DL        R   +E    + + W  C  +E S K    V  +F +L+R I+ +    K  A +
Sbjct:    5 KLVVLGSGGVGKSALTVQFVQGIFVEKYD-PTI---EDSYRKQVEVDGQQCM-LEILDTAGTEQF--------TAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKCDLED-----ERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVEKKKAKK 178          
BLAST of Ras family vs. Ensembl Sea Lamprey
Match: rasl10a (RAS-like, family 10, member A [Source:ZFIN;Acc:ZDB-GENE-060526-273])

HSP 1 Score: 75.0998 bits (183), Expect = 7.524e-17
Identity = 38/123 (30.89%), Postives = 67/123 (54.47%), Query Frame = 1
Query:  421 QNLRIVVLGSSKVGKTSLIEQLM---YCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIELNIEVP 780
            +  ++ VLG+  VGKTS+I Q +   +  T   ++  AV       + P ++ NE V  +R++D P    FP +S Q+W+      LR A  ++L++D+    SF++IK +R+QI++     P
Sbjct:    3 ETFKVAVLGAPGVGKTSIIRQFVSNEFGETYAPTRTRAV-------YAPALVMNERVLELRILDVPPIASFPLNSFQEWSDTRCRGLRSAHAYVLVYDICCFESFEYIKVLRQQILDCRCVTP 118          
BLAST of Ras family vs. Ensembl Sea Lamprey
Match: ralba (v-ral simian leukemia viral oncogene homolog Ba (ras related) [Source:ZFIN;Acc:ZDB-GENE-040801-267])

HSP 1 Score: 54.6842 bits (130), Expect = 5.033e-9
Identity = 46/182 (25.27%), Postives = 76/182 (41.76%), Query Frame = 1
Query:  430 RIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIELNIE--VPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSR 969
            +++++GS  VGK++L  Q MY   +E  +         +Y   +V+  E V  I ++D            +D+  +     R   GF+ +F +    SF      REQI+ +  +  VP ++  NK DL        R    E      + W+    +E S K    V  VF +LMR +  R
Sbjct:   15 KVIMVGSGGVGKSALTLQFMYDEFVEDYE----PTKADSYRKKVVLDGEEV-QIDILDTA--------GQEDYAAIRDNYFRSGEGFLCVFSICEHESFAATLEFREQILRVKEDDSVPFLLVGNKSDLEE-----RRQVSSEEARARAEQWR-VSYVETSAKTRANVDKVFFDLMRDVRKR 177          
BLAST of Ras family vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001560.1 (pep scaffold:Pmarinus_7.0:GL476528:157506:173211:1 gene:ENSPMAG00000001407.1 transcript:ENSPMAT00000001560.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.5286 bits (127), Expect = 1.169e-8
Identity = 54/207 (26.09%), Postives = 87/207 (42.03%), Query Frame = 1
Query:  391 VCSKSLSESSQNL-RIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIR--EQIIELNIE--VPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSRD-NNNKPNA 993
              +KS  ++S  L +++++GS  VGK++L  Q MY   +E  +         +Y   +V+  E V  I ++D            +D+  +     R   GF+  F +    SF     +R  EQI+ +  +  +P ++  NK DL        R    E        W G   +E S K    V  VF +LMR I +R   +NK N 
Sbjct:    2 AANKSKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYE----PTKADSYRKKVVLDGEEV-QIDILDTA--------GQEDYAAIRDNYFRSGEGFLCAFSICEHESFAGTTDLRRSEQILRVKEDDSIPFLLVGNKSDLEE-----RRQVSIEEARARADQW-GVGYVETSAKTRANVDKVFFDLMREIRTRKMEDNKDNG 189          
BLAST of Ras family vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000518.1 (pep scaffold:Pmarinus_7.0:GL479781:11597:21619:-1 gene:ENSPMAG00000000465.1 transcript:ENSPMAT00000000518.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.1434 bits (126), Expect = 1.903e-8
Identity = 35/120 (29.17%), Postives = 61/120 (50.83%), Query Frame = 1
Query:  610 VFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIELNIE--VPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTK-YNWRVLTVFKELMRLI 960
            + D       ++++ +    +R   GF++++ VT +ASF+H++   + I+ +      PM++ ANKVDLM +  K      +EM A    P+     IE S K     V   F+EL+R+I
Sbjct:   62 ILDVLDTAGQEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVERFHQLILRVKDRDSFPMILVANKVDLMHLR-KISSEQGQEMAAKYSIPY-----IETSAKDPPLNVDKAFQELVRVI 175          
BLAST of Ras family vs. Ensembl Sea Lamprey
Match: rheb (Ras homolog, mTORC1 binding [Source:ZFIN;Acc:ZDB-GENE-040426-1690])

HSP 1 Score: 50.8322 bits (120), Expect = 7.421e-8
Identity = 50/194 (25.77%), Postives = 92/194 (47.42%), Query Frame = 1
Query:  430 RIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQ---FPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIEL--NIEVPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSRDNNNKPNAA 996
            +I VLG   VGK+SL  Q +    ++ S  P +  N  T +  +   N   +N++L+D    D+   FP    Q +++       +  G++L++ VTS  SF+ ++ I E+++++   + VP+V+  NK DL        R    E    +   W     +E + K +  V+ VFK +++ I+  D +     A
Sbjct:    8 KIAVLGYRSVGKSSLTIQFVEGQFVD-SYDPTIE-NTFTKNLTV---NGQEFNLKLVDTAGQDEYSMFP----QTYSM-------DIHGYVLVYSVTSIKSFEVVRVIHEKLLDMVGKVHVPLVLVGNKKDL-----HMERVISCEEGKTLATSWNAA-FMESTAKEHQTVVEVFKWMIQEIERADGSAHQEKA 179          
BLAST of Ras family vs. Ensembl Yeast
Match: RSR1 (GTP-binding protein of the Ras superfamily; required for bud site selection, morphological changes in response to mating pheromone, and efficient cell fusion; localized to the plasma membrane; significantly similar to mammalian Rap GTPases [Source:SGD;Acc:S000003384])

HSP 1 Score: 58.9214 bits (141), Expect = 3.043e-10
Identity = 50/189 (26.46%), Postives = 83/189 (43.92%), Query Frame = 1
Query:  421 QNLRIVVLGSSKVGKTSLIEQLM-------YCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIEL--NIEVPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLI 960
            ++ ++VVLG+  VGK+ L  Q +       Y  T+E S R  + I+              V+++ ++D     QF        T +    ++   GF+L++ VT   S + +  +REQ++ +  +  VPMV+  NK DL  IN + +     E    V   W      E S      V  VF +L+R I
Sbjct:    2 RDYKLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIEDSYRKTIEID------------NKVFDLEILDTAGIAQF--------TAMRELYIKSGMGFLLVYSVTDRQSLEELMELREQVLRIKDSDRVPMVLIGNKADL--INERVI---SVEEGIEVSSKWGRVPFYETSALLRSNVDEVFVDLVRQI 165          
BLAST of Ras family vs. Ensembl Yeast
Match: YPT7 (Rab family GTPase; GTP-binding protein of the rab family; required for homotypic fusion event in vacuole inheritance, for endosome-endosome fusion; localizes to sites of contact between the vacuole and mitochondria (vCLAMPs); interacts with the cargo selection/retromer complex for retrograde sorting; similar to mammalian Rab7 [Source:SGD;Acc:S000004460])

HSP 1 Score: 51.6026 bits (122), Expect = 3.988e-8
Identity = 48/182 (26.37%), Postives = 84/182 (46.15%), Query Frame = 1
Query:  427 LRIVVLGSSKVGKTSLIEQLMYCHTLEK-SKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQ-IIELNI----EVPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMR 954
            L++++LG S VGKTSL    M+ +  +K S++   +I        + +  + V  +++ D    ++F          LG    R A   +L++DVT+ +SF++IKS R++ ++  N+      P VI  NK+D           + +E+     K      L   S K    V T F+E+ R
Sbjct:    9 LKVIILGDSGVGKTSL----MHRYVNDKYSQQYKATIGADFLTKEVTVDGDKVATMQVWDTAGQERFQS--------LGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFPFVILGNKIDAEESKKIVSEKSAQELA----KSLGDIPLFLTSAKNAINVDTAFEEIAR 174          
BLAST of Ras family vs. Ensembl Yeast
Match: RAS2 (GTP-binding protein; regulates nitrogen starvation response, sporulation, and filamentous growth; farnesylation and palmitoylation required for activity and localization to plasma membrane; homolog of mammalian Ras proto-oncogenes; RAS2 has a paralog, RAS1, that arose from the whole genome duplication [Source:SGD;Acc:S000005042])

HSP 1 Score: 45.8246 bits (107), Expect = 5.645e-6
Identity = 44/179 (24.58%), Postives = 79/179 (44.13%), Query Frame = 1
Query:  463 KTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIELNIE--VPMVIAANKVDLMSINGKFVR-NNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSRDNNNKPN 990
            K++L  QL   H +++   P +   + +Y   +VI +E           + D       ++++ +    +R   GF+L++ +TS++S   + +  +QI+ +     VP+V+  NK DL   N K V   +   M   +  P+     +E S K    V   F  L RL+  RD   K N
Sbjct:   23 KSALTIQLTQSHFVDEYD-PTI---EDSYRKQVVIDDE---------VSILDILDTAGQEEYSAMREQYMRNGEGFLLVYSITSKSSLDELMTYYQQILRVKDTDYVPIVVVGNKSDLE--NEKQVSYQDGLNMAKQMNAPF-----LETSAKQAINVEEAFYTLARLV--RDEGGKYN 179          
BLAST of Ras family vs. Ensembl Nematostella
Match: EDO39047 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB93])

HSP 1 Score: 63.5438 bits (153), Expect = 6.015e-12
Identity = 50/189 (26.46%), Postives = 90/189 (47.62%), Query Frame = 1
Query:  430 RIVVLGSSKVGKTSLIEQLM-------YCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIEL--NIEVPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSR 969
            ++VVLGS  VGK++L  Q +       Y  T+E S R  V ++       I            +D    +QF        T +    ++   GF+L++ +T++++F  ++ +REQI+ +    +VPMV+  NK DL   + + V  ++ +  A   K +  C  +E S K    V  +F +L+R I+ +
Sbjct:    5 KLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDGQQCMLEI------------LDTAGTEQF--------TAMRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLE--DERVVGKDQGQNLA---KQFANCTFLETSAKAKINVNEIFYDLVRQINRK 168          
BLAST of Ras family vs. Ensembl Nematostella
Match: EDO45827 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRV2])

HSP 1 Score: 59.3066 bits (142), Expect = 2.711e-10
Identity = 50/190 (26.32%), Postives = 81/190 (42.63%), Query Frame = 1
Query:  430 RIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIEL--NIEVPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSR--DNNNKP 987
            +++++GS  VGK++L  Q MY   +E  +         +Y    ++  E    I ++D            +D+  +     R   GF+ +F +T   SF      REQI+ +  + ++P ++  NK DL        R    E        W G   +E S K    V  VF +LMR I SR  D+ +KP
Sbjct:   13 KVIMVGSGGVGKSALTLQFMYEEFVEDYE----PTKADSYRKKAILDGEEC-QIDILDTA--------GQEDYAAIRDNYFRSGEGFLCVFSITEPESFAATTEFREQILRVKGDDKIPFLLVGNKSDLTD-----KRQVTSEEGQSKADEW-GVPYVETSAKTRSNVDKVFFDLMREIRSRKMDDGSKP 183          
BLAST of Ras family vs. Ensembl Nematostella
Match: EDO36577 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI57])

HSP 1 Score: 55.8398 bits (133), Expect = 1.695e-9
Identity = 51/175 (29.14%), Postives = 86/175 (49.14%), Query Frame = 1
Query:  433 IVVLGSSKVGKTSLIEQLMYC-HTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQII-ELNIEVPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELM 951
            I VLG  +VGK+SLI    +C    ++   P +      +    +++N+  Y + +ID    + FP         +   ++ +A   IL++ + +  SF+ ++  RE+II E    VP+++ ANK DL S++G   R N R+   +V K WK    I  S K NW V   F  ++
Sbjct:    1 IAVLGEGRVGKSSLIRG--FCGEGFQEEYVPTIE----EFVSKHLLYNDRTYQLDIIDTCGSENFPA--------IRRVDIAKADAIILVYSIDNPRSFEQLQQYREEIIAEKGNSVPVLVVANKSDL-SLDG--CRVNTRD---VVLKRWKYLWSI-TSCKMNWGVQEPFHGIL 154          
BLAST of Ras family vs. Ensembl Nematostella
Match: EDO33484 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SS29])

HSP 1 Score: 55.8398 bits (133), Expect = 2.765e-9
Identity = 49/192 (25.52%), Postives = 91/192 (47.40%), Query Frame = 1
Query:  433 IVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIE--LNIEVPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCV------LIECSTKYNWRVLTVFKELMRLIDSRDNNNK 984
            I V G + VGKTS++++  YC    +   P V       +  ++  N  +  +   D     QFP  ++++  I      + ASGFIL++ + S+ SF+ +K +  ++IE   + ++P+V+  NK DL            +E+ A  ++  KGC        +E S K +  +  VF E++ ++D   N  +
Sbjct:   11 IAVFGGAGVGKTSIVKRF-YCGKFSEEYEPTVE----DCYSKVLNKNGSIMVLNTTDSSGSYQFP--AMREVAI------KRASGFILVYSLDSKFSFEELKRLLYEVIEKKKSADIPVVLVGNKKDLEEQREVSSEQVVKEVMAFARE--KGCEGKLNMRQVETSAKDDCNISDVFDEVVDMLDKHPNKQE 187          
BLAST of Ras family vs. Ensembl Nematostella
Match: EDO43637 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY50])

HSP 1 Score: 55.4546 bits (132), Expect = 4.337e-9
Identity = 50/187 (26.74%), Postives = 78/187 (41.71%), Query Frame = 1
Query:  430 RIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQD-WTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIELNIE--VPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSRDNNN 981
            +I V+G   VGK+SL  Q +    ++               Y   I N    NI+      F +    + QD ++I          G+IL++ VTS  SF+ +K I E+++++  +  VPMV+  NK DL        R    E        WK     E S K N  V  +F+ ++  ID   N +
Sbjct:    8 KIAVMGFRSVGKSSLTIQFVEGQFVDS--------------YDPTIENTFTKNIKYKGQEFFLELVDTAGQDEYSIFPQSYSMGIHGYILVYAVTSAKSFEVVKVIHEKLLDMTGQNYVPMVLVGNKTDL-----HMERVVSTESGQSTANSWKAA-FFEASAKENSSVHEIFQAMLYEIDKHQNGS 174          
BLAST of Ras family vs. Ensembl Medaka
Match: rasl10a (RAS like family 10 member A [Source:NCBI gene;Acc:101163255])

HSP 1 Score: 119.013 bits (297), Expect = 3.310e-31
Identity = 71/208 (34.13%), Postives = 117/208 (56.25%), Query Frame = 1
Query:  421 QNLRIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHY-PIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIE----LNIEVPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSRDNNNKPNAARAMHNAFRRNQ 1029
            + L I V+G+  VGKTS+I Q +Y    E       +  +  Y Y P VI N ++Y ++++D P    FP  + Q+W  L    +R A+ +IL++D+    SF+++K IR+QI+E     + EVP+++  NK DL     +F+   +R +  +VKK WK C  +ECS K+NW V+ +FKEL+ +  +R       + R +  A +RN+
Sbjct:    3 ETLSIAVIGAPAVGKTSIIRQFIYNDFSE-----GYTATRTRYVYRPSVILNGNMYELKILDVPPIASFPASASQEWMDLRCRGVRNANAYILVYDICCVESFEYVKMIRQQIVENREGSSNEVPILVVGNKRDLQ--RQRFM--PRRAVSVLVKKTWK-CGYVECSAKFNWHVILLFKELLGIAVARGLRQNHTSIR-LQGALQRNR 199          
BLAST of Ras family vs. Ensembl Medaka
Match: rap1ab (ras-related protein Rap-1A [Source:NCBI gene;Acc:101167529])

HSP 1 Score: 67.781 bits (164), Expect = 5.955e-13
Identity = 50/189 (26.46%), Postives = 87/189 (46.03%), Query Frame = 1
Query:  430 RIVVLGSSKVGKTSLIEQLM-------YCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIEL--NIEVPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSR 969
            ++VVLGS  VGK++L  Q +       Y  T+E S R  V ++       I            +D    +QF        T +    ++   GF L++ +T++++F  ++ +REQI+ +    +VPM++  NK DL        R   +E    + + W  C  +E S K    VL +F +L+R I+ +
Sbjct:    5 KLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDGQQCMLEI------------LDTAGTEQF--------TAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKCDLED-----ERVVGKEQGQNLARQWNNCAFLESSAKSKINVLDIFYDLVRQINRK 168          
BLAST of Ras family vs. Ensembl Medaka
Match: ralba (ras-related protein Ral-B [Source:NCBI gene;Acc:101157118])

HSP 1 Score: 67.781 bits (164), Expect = 1.005e-12
Identity = 55/207 (26.57%), Postives = 95/207 (45.89%), Query Frame = 1
Query:  391 VCSKSLSESSQNL-RIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIELNIE---VPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSR--DNNNKPNA 993
              +K  S+SS  L +++++GS  VGK++L  Q MY   +E  + P  +    +Y   +V+  + V  I ++D            +D+  +     R   GF+L+F +T + SF      REQI+ +  +   +P+++  NK DL       V   +R+      + W G   +E S K    V  VF +LMR +  +    NN+ N 
Sbjct:    2 AANKGKSQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYE-PTKA---DSYRKKVVLDGDEV-QIDILDTA--------GQEDYAAIRDNYFRSGEGFLLVFSITEQESFTATDEFREQILRVKADEDKIPLLLVGNKSDLEERRHVSVEEARRKA-----EEW-GAQYVETSAKTRANVDKVFFDLMREVRGKKMSKNNQTNG 189          
BLAST of Ras family vs. Ensembl Medaka
Match: ralba (ras-related protein Ral-B [Source:NCBI gene;Acc:101157118])

HSP 1 Score: 67.781 bits (164), Expect = 1.005e-12
Identity = 55/207 (26.57%), Postives = 95/207 (45.89%), Query Frame = 1
Query:  391 VCSKSLSESSQNL-RIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIELNIE---VPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSR--DNNNKPNA 993
              +K  S+SS  L +++++GS  VGK++L  Q MY   +E  + P  +    +Y   +V+  + V  I ++D            +D+  +     R   GF+L+F +T + SF      REQI+ +  +   +P+++  NK DL       V   +R+      + W G   +E S K    V  VF +LMR +  +    NN+ N 
Sbjct:    2 AANKGKSQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYE-PTKA---DSYRKKVVLDGDEV-QIDILDTA--------GQEDYAAIRDNYFRSGEGFLLVFSITEQESFTATDEFREQILRVKADEDKIPLLLVGNKSDLEERRHVSVEEARRKA-----EEW-GAQYVETSAKTRANVDKVFFDLMREVRGKKMSKNNQTNG 189          
BLAST of Ras family vs. Ensembl Medaka
Match: ENSORLT00000047032.1 (ras-related protein Rap-1b [Source:NCBI gene;Acc:101172864])

HSP 1 Score: 65.4698 bits (158), Expect = 3.543e-12
Identity = 49/189 (25.93%), Postives = 88/189 (46.56%), Query Frame = 1
Query:  430 RIVVLGSSKVGKTSLIEQLM-------YCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIEL--NIEVPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSR 969
            ++VVLGS  VGK++L  Q +       Y  T+E S R  V I+                 + ++D    +QF        T +    ++   GF L++ +T++++F  ++ +REQI+ +    +VPM++  NK DL     +  R   +E    + + W  C  +E S K    V  +F +L+R I+ +
Sbjct:    5 KLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEIDGQQCM------------LEILDTAGTEQF--------TAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKCDL-----EVERVVAKESGIGLARQWNSCAFLETSAKSKINVNEIFYDLVRQINKK 168          
BLAST of Ras family vs. Planmine SMEST
Match: SMESG000007281.1 (SMESG000007281.1)

HSP 1 Score: 595.119 bits (1533), Expect = 0.000e+0
Identity = 288/296 (97.30%), Postives = 291/296 (98.31%), Query Frame = 1
Query:  142 KLRN*EIVSSMATKRKPNVRLKISSHNNPNCCHKSESNILLSNYMLDSNQTDINNYTNDNDPNPFKTTNIPSGTNDTESINTGVCSKSLSESSQNLRIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIELNIEVPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSRDNNNKPNAARAMHNAFRRNQ 1029
            K++  E  S MAT+RKPNVRLKISSHNNPNCCHKSESNILLSNYMLDSNQTDINNYTNDNDPNPFKTTNIPSGTNDTESINTGVCSKSLSESSQNLRIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIELNIEVPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSRDNNNKPNAARAMHNAFRRNQ
Sbjct:    2 KIKEFEKRSMMATERKPNVRLKISSHNNPNCCHKSESNILLSNYMLDSNQTDINNYTNDNDPNPFKTTNIPSGTNDTESINTGVCSKSLSESSQNLRIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIELNIEVPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSRDNNNKPNAARAMHNAFRRNQ 297          
BLAST of Ras family vs. Planmine SMEST
Match: SMESG000007281.1 (SMESG000007281.1)

HSP 1 Score: 591.267 bits (1523), Expect = 0.000e+0
Identity = 285/286 (99.65%), Postives = 286/286 (100.00%), Query Frame = 1
Query:  172 MATKRKPNVRLKISSHNNPNCCHKSESNILLSNYMLDSNQTDINNYTNDNDPNPFKTTNIPSGTNDTESINTGVCSKSLSESSQNLRIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIELNIEVPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSRDNNNKPNAARAMHNAFRRNQ 1029
            MAT+RKPNVRLKISSHNNPNCCHKSESNILLSNYMLDSNQTDINNYTNDNDPNPFKTTNIPSGTNDTESINTGVCSKSLSESSQNLRIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIELNIEVPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSRDNNNKPNAARAMHNAFRRNQ
Sbjct:    1 MATERKPNVRLKISSHNNPNCCHKSESNILLSNYMLDSNQTDINNYTNDNDPNPFKTTNIPSGTNDTESINTGVCSKSLSESSQNLRIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIELNIEVPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSRDNNNKPNAARAMHNAFRRNQ 286          
BLAST of Ras family vs. Planmine SMEST
Match: SMESG000017950.1 (SMESG000017950.1)

HSP 1 Score: 68.1662 bits (165), Expect = 3.395e-13
Identity = 57/191 (29.84%), Postives = 94/191 (49.21%), Query Frame = 1
Query:  430 RIVVLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQI--IELNIEVPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSRDNNNKPNAA 996
            ++V+LGS  VGK+ L  Q +    LEK   P +   + +Y   + I +     + ++D    +QF        T +    ++   GFIL++ +T++ SF  I  +REQI  I+ + ++PM++  NK DL        RN  R       K W  C  +E S + N  V  +F EL+R I+S+ N  KP+ +
Sbjct:    5 KLVMLGSGGVGKSCLTVQFVQGVFLEKYD-PTI---EDSYRKQVEIDDNQCM-LEILDTAGAEQF--------TAMRDMYMKSGQGFILVYSITNQTSFNDIDDLREQITRIKDSTDIPMILVGNKCDLED-----QRNVGRIQGQHKAKLWN-CSFLETSARSNNNVQDIFVELVRQINSK-NPEKPSKS 175          
BLAST of Ras family vs. Planmine SMEST
Match: SMESG000017950.1 (SMESG000017950.1)

HSP 1 Score: 65.4698 bits (158), Expect = 2.268e-12
Identity = 56/188 (29.79%), Postives = 91/188 (48.40%), Query Frame = 1
Query:  439 VLGSSKVGKTSLIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQI--IELNIEVPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSRDNNNKPNAA 996
            +LGS  VGK+ L  Q +    LEK   P +   + +Y   + I +     + ++D    +QF        T +    ++   GFIL++ +T++ SF  I  +REQI  I+ + ++PM++  NK DL        RN  R       K W  C  +E S + N  V  +F EL+R I+S+ N  KP+ +
Sbjct:    1 MLGSGGVGKSCLTVQFVQGVFLEKYD-PTI---EDSYRKQVEIDDNQCM-LEILDTAGAEQF--------TAMRDMYMKSGQGFILVYSITNQTSFNDIDDLREQITRIKDSTDIPMILVGNKCDLED-----QRNVGRIQGQHKAKLWN-CSFLETSARSNNNVQDIFVELVRQINSK-NPEKPSKS 168          
BLAST of Ras family vs. Planmine SMEST
Match: SMESG000017314.1 (SMESG000017314.1)

HSP 1 Score: 61.2326 bits (147), Expect = 8.565e-11
Identity = 51/199 (25.63%), Postives = 91/199 (45.73%), Query Frame = 1
Query:  430 RIVVLGSSKVGKTSLIEQLM-------YCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQFPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIELNIE--VPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNWRVLTVFKELMRLIDSRDNNNKPNAAR 999
            ++VVLG+  VGK++L  Q +       Y  T+E S R  V ++       I            +D    +QF        T +    ++   GF+L++ +T+++SF  ++ +REQI+ +     VPMV+  NK DL        R+  +E   ++ + +  C  +E S K    V  +F +L+R I+ +   +K    R
Sbjct:    5 KLVVLGTGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDGSQCMLEI------------LDTAGTEQF--------TAMRDLYMKNGQGFVLVYSITAQSSFNELEDLREQILRVKDTDNVPMVLVGNKCDLEDD-----RSVGKEQGQVLARKF-NCSFMETSAKNKINVNEIFYDLVRQINKQAPTSKDVKKR 177          
The following BLAST results are available for this feature:
BLAST of Ras family vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RASL10B1.144e-3031.86RAS like family 10 member B [Source:HGNC Symbol;Ac... [more]
RASL10A2.439e-2630.10RAS like family 10 member A [Source:HGNC Symbol;Ac... [more]
DIRAS25.537e-1229.32DIRAS family GTPase 2 [Source:HGNC Symbol;Acc:HGNC... [more]
RASD18.437e-1227.27ras related dexamethasone induced 1 [Source:HGNC S... [more]
RAP1B1.119e-1125.40RAP1B, member of RAS oncogene family [Source:HGNC ... [more]
back to top
BLAST of Ras family vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ral-11.065e-1125.00RAL (Ras-related GTPase) homolog [Source:UniProtK... [more]
ral-11.296e-1124.77RAL (Ras-related GTPase) homolog [Source:UniProtK... [more]
rap-11.876e-1026.98Ras-related protein Rap-1 [Source:UniProtKB/Swiss... [more]
ssr-21.367e-928.49Sperm-Specific family, class R [Source:UniProtKB/... [more]
rheb-12.287e-926.73GTP-binding protein Rheb homolog 1 [Source:UniPro... [more]
back to top
BLAST of Ras family vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG146699.917e-1825.97gene:FBgn0037326 transcript:FBtr0334742[more]
CG146699.917e-1825.97gene:FBgn0037326 transcript:FBtr0078679[more]
CG133751.338e-1629.94gene:FBgn0040370 transcript:FBtr0342963[more]
CG133752.160e-1629.94gene:FBgn0040370 transcript:FBtr0070103[more]
CG133752.160e-1629.94gene:FBgn0040370 transcript:FBtr0300326[more]
back to top
BLAST of Ras family vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rasl10a1.490e-2634.13RAS-like, family 10, member A [Source:ZFIN;Acc:ZDB... [more]
RASL10B6.876e-1629.17RAS like family 10 member B [Source:HGNC Symbol;Ac... [more]
rap1ab7.070e-1326.46RAP1A, member of RAS oncogene family b [Source:ZFI... [more]
rap1ab7.070e-1326.46RAP1A, member of RAS oncogene family b [Source:ZFI... [more]
rap1ab7.070e-1326.46RAP1A, member of RAS oncogene family b [Source:ZFI... [more]
back to top
BLAST of Ras family vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RASL10B1.015e-3133.98RAS like family 10 member B [Source:NCBI gene;Acc:... [more]
rasl10a1.370e-2228.95RAS like family 10 member A [Source:NCBI gene;Acc:... [more]
rasl10a1.686e-2228.95RAS like family 10 member A [Source:NCBI gene;Acc:... [more]
pnp1.109e-1126.77purine nucleoside phosphorylase [Source:Xenbase;Ac... [more]
rap1b1.183e-1125.27RAP1B, member of RAS oncogene family [Source:NCBI ... [more]
back to top
BLAST of Ras family vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rasl10b8.442e-3131.86RAS-like, family 10, member B [Source:MGI Symbol;A... [more]
Rasl10b8.442e-3131.86RAS-like, family 10, member B [Source:MGI Symbol;A... [more]
Rasl10b8.442e-3131.86RAS-like, family 10, member B [Source:MGI Symbol;A... [more]
Rasl10a3.074e-2629.90RAS-like, family 10, member A [Source:MGI Symbol;A... [more]
Rasl10b3.079e-1631.53RAS-like, family 10, member B [Source:MGI Symbol;A... [more]
back to top
BLAST of Ras family vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96S79|RSLAB_HUMAN5.495e-3031.86Ras-like protein family member 10B OS=Homo sapiens... [more]
sp|Q5SSG5|RSLAB_MOUSE5.905e-3031.86Ras-like protein family member 10B OS=Mus musculus... [more]
sp|Q92737|RSLAA_HUMAN1.171e-2530.10Ras-like protein family member 10A OS=Homo sapiens... [more]
sp|Q8K5A4|RSLAA_MOUSE2.150e-2529.90Ras-like protein family member 10A OS=Mus musculus... [more]
sp|P48555|RALA_DROME6.135e-1326.70Ras-related protein Ral-a OS=Drosophila melanogast... [more]
back to top
BLAST of Ras family vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G7Y7Y21.305e-5231.85Ras-like family 10 member B (Fragment) OS=Clonorch... [more]
A0A183A6Q31.311e-5239.39Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A1S8XA171.865e-5237.24GTP-binding domain protein OS=Opisthorchis viverri... [more]
A0A074Z5262.768e-5237.24Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A3R7FIT83.058e-5232.17Ras-like protein family member 10B OS=Clonorchis s... [more]
back to top
BLAST of Ras family vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rasl10a3.474e-3034.30RAS-like, family 10, member A [Source:ZFIN;Acc:ZDB... [more]
RASL10B9.130e-2833.70RAS like family 10 member B [Source:NCBI gene;Acc:... [more]
rap1ab1.006e-1226.46ras-related protein Rap-1A [Source:NCBI gene;Acc:1... [more]
rasd42.441e-1227.66ras-related protein Rap-1b-like [Source:NCBI gene;... [more]
rap1aa3.332e-1225.00RAP1A, member of RAS oncogene family [Source:NCBI ... [more]
back to top
BLAST of Ras family vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rasl10a7.524e-1730.89RAS-like, family 10, member A [Source:ZFIN;Acc:ZDB... [more]
ralba5.033e-925.27v-ral simian leukemia viral oncogene homolog Ba (r... [more]
ENSPMAT00000001560.11.169e-826.09pep scaffold:Pmarinus_7.0:GL476528:157506:173211:1... [more]
ENSPMAT00000000518.11.903e-829.17pep scaffold:Pmarinus_7.0:GL479781:11597:21619:-1 ... [more]
rheb7.421e-825.77Ras homolog, mTORC1 binding [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Ras family vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
RSR13.043e-1026.46GTP-binding protein of the Ras superfamily; requir... [more]
YPT73.988e-826.37Rab family GTPase; GTP-binding protein of the rab ... [more]
RAS25.645e-624.58GTP-binding protein; regulates nitrogen starvation... [more]
back to top
BLAST of Ras family vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO390476.015e-1226.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458272.711e-1026.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO365771.695e-929.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO334842.765e-925.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436374.337e-926.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ras family vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rasl10a3.310e-3134.13RAS like family 10 member A [Source:NCBI gene;Acc:... [more]
rap1ab5.955e-1326.46ras-related protein Rap-1A [Source:NCBI gene;Acc:1... [more]
ralba1.005e-1226.57ras-related protein Ral-B [Source:NCBI gene;Acc:10... [more]
ralba1.005e-1226.57ras-related protein Ral-B [Source:NCBI gene;Acc:10... [more]
ENSORLT00000047032.13.543e-1225.93ras-related protein Rap-1b [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Ras family vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000007281.10.000e+097.30SMESG000007281.1[more]
SMESG000007281.10.000e+099.65SMESG000007281.1[more]
SMESG000017950.13.395e-1329.84SMESG000017950.1[more]
SMESG000017950.12.268e-1229.79SMESG000017950.1[more]
SMESG000017314.18.565e-1125.63SMESG000017314.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011402 ID=SMED30011402|Name=Ras family|organism=Schmidtea mediterranea sexual|type=transcript|length=1279bp
CTGATTTCTAATTATTTTTTACTAACAATTTTTAATCATTGTATTTTTGA
TGATAACTTTTCAATAACAAAAAAAAATTTACAAAAAATAAAATCGGAAT
TTTTAATTGTAAAGAACACAAAATCTCAATGGATGAATAGAAAATTGCGA
AATTGAGAAATAGTCAGTTCGATGGCTACTAAAAGAAAACCAAATGTTAG
ATTGAAAATATCTTCTCACAACAATCCAAATTGTTGTCACAAATCAGAAT
CAAACATCCTTTTATCTAACTATATGTTGGATTCAAATCAGACAGACATT
AATAATTATACAAATGATAATGATCCAAATCCTTTCAAAACGACAAACAT
TCCATCAGGTACCAACGATACCGAATCTATCAATACTGGTGTTTGCTCAA
AGTCTCTATCAGAATCAAGCCAAAACTTACGCATAGTTGTTCTTGGCTCA
TCGAAGGTTGGAAAAACTAGTCTCATTGAACAATTGATGTACTGTCATAC
GCTGGAAAAATCAAAAAGACCAGCGGTATCTATCAACAAACCAACTTATC
ATTATCCAATCGTCATCTTTAATGAACATGTATATAACATTCGTTTGATA
GATTGTCCCGTTTTCGATCAGTTTCCCTGTGACTCTCTACAAGACTGGAC
GATACTTGGTGGTTGCAATCTTCGCGAAGCTTCGGGCTTCATACTGATGT
TCGATGTGACTTCTGAGGCGTCATTTCAACACATAAAGTCAATAAGGGAA
CAAATAATCGAGTTGAACATTGAAGTGCCGATGGTTATAGCAGCGAACAA
GGTCGATTTAATGTCAATTAATGGGAAATTCGTTCGAAACAACAAGCGGG
AAATGTGCGCTATCGTCAAAAAGCCATGGAAAGGCTGTGTATTAATCGAA
TGCTCAACAAAATACAATTGGCGTGTTTTGACAGTTTTCAAAGAGCTCAT
GAGACTAATTGACAGTCGGGACAATAATAATAAACCGAACGCTGCTAGGG
CTATGCACAATGCGTTCCGACGCAATCAGTGTTGCGTAATGTAATTCGTG
GGAATTTGAATTATTTTTTGTTGTTTTTTGAAACATTTTCTACTCAAAAC
ATTCCAATGAAGAAATTCATCCTCCCTCCCTCTACAAAGATATTTCAATA
TTTTATTATTTATCAGTTTTTCATGAACTAAATTTTTCAGATAGTATTTC
TATGAACTTTAGGTAGAATGAATAACTTTTTTTCTTTTTCTAAATGGCAT
TAGAATGTGATAGAAAATTAAGATTCGTC
back to top

protein sequence of SMED30011402-orf-1

>SMED30011402-orf-1 ID=SMED30011402-orf-1|Name=SMED30011402-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=291bp
MATKRKPNVRLKISSHNNPNCCHKSESNILLSNYMLDSNQTDINNYTNDN
DPNPFKTTNIPSGTNDTESINTGVCSKSLSESSQNLRIVVLGSSKVGKTS
LIEQLMYCHTLEKSKRPAVSINKPTYHYPIVIFNEHVYNIRLIDCPVFDQ
FPCDSLQDWTILGGCNLREASGFILMFDVTSEASFQHIKSIREQIIELNI
EVPMVIAANKVDLMSINGKFVRNNKREMCAIVKKPWKGCVLIECSTKYNW
RVLTVFKELMRLIDSRDNNNKPNAARAMHNAFRRNQCCVM*
back to top
Aliases
The feature 'Ras family' has the following synonyms
Synonym
H.18.4a
Ras-related
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003924GTPase activity
GO:0005525GTP binding
GO:0000166nucleotide binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000035Category 3 cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR027417P-loop_NTPase
IPR001806Small_GTPase
IPR020849Small_GTPase_Ras-type
Vocabulary: biological process
TermDefinition
GO:0007264small GTPase mediated signal transduction
GO:0007165signal transduction
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00449RASTRNSFRMNGcoord: 86..107
score: 34.62
coord: 200..213
score: 37.29
coord: 241..263
score: 30.32
NoneNo IPR availableSMARTSM00175rab_sub_5coord: 86..266
e-value: 1.2E-4
score: -51.7
NoneNo IPR availableSMARTSM00173ras_sub_4coord: 83..266
e-value: 3.1E-10
score: 29.6
NoneNo IPR availableSMARTSM00174rho_sub_3coord: 88..266
e-value: 0.0036
score: -76.2
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 73..287
e-value: 3.5E-29
score: 103.3
NoneNo IPR availablePANTHERPTHR46350:SF2RAS LIKE FAMILY 10 MEMBER Bcoord: 84..290
NoneNo IPR availablePANTHERPTHR46350FAMILY NOT NAMEDcoord: 84..290
IPR001806Small GTPasePFAMPF00071Rascoord: 87..263
e-value: 7.4E-17
score: 61.4
IPR020849Small GTPase superfamily, Ras-typePROSITEPS51421RAScoord: 81..290
score: 14.756
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 84..266