SMED30011400

Overview
NameSMED30011400
Smed IDSMED30011400
Length (bp)1188
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011400

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
prepharyngeal regionSMED30011400SMESG000042718.1 SmedASXL_014234SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
cephalic gangliaSMED30011400SMESG000042718.1 dd_Smed_v4_447_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30011400SMESG000042718.1 dd_Smed_v4_447_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30011400SMESG000042718.1 OX_Smed_1.0.01620ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
head regionSMED30011400SMESG000042718.1 OX_Smed_1.0.03267ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30011400 vs. Planmine SMEST
Match: SMESG000042718.1 (SMESG000042718.1)

HSP 1 Score: 490.345 bits (1261), Expect = 5.593e-157
Identity = 385/433 (88.91%), Postives = 391/433 (90.30%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            LDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 1950 LDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 2382          

HSP 2 Score: 490.345 bits (1261), Expect = 5.593e-157
Identity = 385/433 (88.91%), Postives = 391/433 (90.30%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            LDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 2507 LDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 2939          

HSP 3 Score: 490.345 bits (1261), Expect = 5.593e-157
Identity = 385/433 (88.91%), Postives = 391/433 (90.30%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            LDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 2724 LDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 3156          

HSP 4 Score: 489.574 bits (1259), Expect = 7.917e-157
Identity = 384/433 (88.68%), Postives = 391/433 (90.30%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            LDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPT+TFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 2941 LDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTITFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 3373          

HSP 5 Score: 489.574 bits (1259), Expect = 7.917e-157
Identity = 384/433 (88.68%), Postives = 391/433 (90.30%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            LDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPT+TFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 3158 LDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTITFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 3590          

HSP 6 Score: 489.189 bits (1258), Expect = 1.121e-156
Identity = 383/433 (88.45%), Postives = 391/433 (90.30%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            LDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPT+TFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPT+TFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 3706 LDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTITFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTKLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTITFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 4138          

HSP 7 Score: 488.419 bits (1256), Expect = 2.621e-156
Identity = 384/433 (88.68%), Postives = 390/433 (90.07%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            LDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPT+TFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V + GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 3923 LDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTITFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLIGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 4355          

HSP 8 Score: 367.081 bits (941), Expect = 3.339e-114
Identity = 269/316 (85.13%), Postives = 273/316 (86.39%), Query Frame = 2
Query:  353 DAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            D +T  NTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 2407 DKLTSPNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 2722          

HSP 9 Score: 362.459 bits (929), Expect = 1.517e-112
Identity = 266/311 (85.53%), Postives = 270/311 (86.82%), Query Frame = 2
Query:  368 SNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            S TISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPT+TFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 3611 SKTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTITFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTKLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 3921          

HSP 10 Score: 346.665 bits (888), Expect = 5.013e-107
Identity = 257/301 (85.38%), Postives = 261/301 (86.71%), Query Frame = 2
Query:  398 VLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            +LVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 1865 LLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTKLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 2165          

HSP 11 Score: 337.421 bits (864), Expect = 8.256e-104
Identity = 258/316 (81.65%), Postives = 261/316 (82.59%), Query Frame = 2
Query:  353 DAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            D +T  NTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPT+TFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQAN              +IVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 4380 DKLTSPNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTITFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQAN--------------KIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 4681          

HSP 12 Score: 292.352 bits (747), Expect = 3.173e-88
Identity = 223/247 (90.28%), Postives = 225/247 (91.09%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPN 685
            LDNGD+S V + GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPN
Sbjct: 4140 LDNGDKSMVVLIGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPN 4386          

HSP 13 Score: 286.574 bits (732), Expect = 3.426e-86
Identity = 218/247 (88.26%), Postives = 224/247 (90.69%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPN 685
            LDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPN
Sbjct: 2167 LDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPN 2413          

HSP 14 Score: 264.233 bits (674), Expect = 2.235e-78
Identity = 212/247 (85.83%), Postives = 214/247 (86.64%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPN 685
            LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPT+TFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQAN              +IVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPN
Sbjct: 4480 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTITFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQAN--------------KIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPN 4712          

HSP 15 Score: 257.299 bits (656), Expect = 4.920e-76
Identity = 204/228 (89.47%), Postives = 207/228 (90.79%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTI 628
            LDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTI
Sbjct: 3375 LDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTI 3602          

HSP 16 Score: 221.476 bits (563), Expect = 1.066e-63
Identity = 132/153 (86.27%), Postives = 133/153 (86.93%), Query Frame = 2
Query:  338 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQ 739
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRT +
Sbjct: 1711 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTKLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTFK 1863          

HSP 17 Score: 166.392 bits (420), Expect = 1.122e-44
Identity = 105/128 (82.03%), Postives = 106/128 (82.81%), Query Frame = 2
Query:  353 DAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTS 679
            D +T  NTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTS
Sbjct: 4706 DKLTSPNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTS 4833          

HSP 18 Score: 154.066 bits (388), Expect = 1.903e-40
Identity = 85/104 (81.73%), Postives = 85/104 (81.73%), Query Frame = 2
Query:  932 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 1711 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTKLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 1814          

HSP 19 Score: 134.806 bits (338), Expect = 5.710e-34
Identity = 76/99 (76.77%), Postives = 77/99 (77.78%), Query Frame = 2
Query:  947 DAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            D +T  NTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 4706 DKLTSPNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 4804          

HSP 20 Score: 93.2041 bits (230), Expect = 5.289e-20
Identity = 46/48 (95.83%), Postives = 47/48 (97.92%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQ 145
            LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRT +
Sbjct: 1816 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTFK 1863          

HSP 21 Score: 56.6102 bits (135), Expect = 2.363e-8
Identity = 28/28 (100.00%), Postives = 28/28 (100.00%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTS 85
            LDNGDQSTVTISGIDLAQSPKLLDKLTS
Sbjct: 4806 LDNGDQSTVTISGIDLAQSPKLLDKLTS 4833          
BLAST of SMED30011400 vs. Planmine SMEST
Match: SMESG000042718.1 (SMESG000042718.1)

HSP 1 Score: 489.96 bits (1260), Expect = 5.696e-157
Identity = 385/433 (88.91%), Postives = 391/433 (90.30%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            LDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 1780 LDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 2212          

HSP 2 Score: 489.96 bits (1260), Expect = 5.696e-157
Identity = 385/433 (88.91%), Postives = 391/433 (90.30%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            LDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 2337 LDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 2769          

HSP 3 Score: 489.96 bits (1260), Expect = 5.696e-157
Identity = 385/433 (88.91%), Postives = 391/433 (90.30%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            LDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 2554 LDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 2986          

HSP 4 Score: 489.574 bits (1259), Expect = 8.141e-157
Identity = 384/433 (88.68%), Postives = 391/433 (90.30%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            LDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPT+TFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 2771 LDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTITFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 3203          

HSP 5 Score: 489.574 bits (1259), Expect = 8.141e-157
Identity = 384/433 (88.68%), Postives = 391/433 (90.30%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            LDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPT+TFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 2988 LDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTITFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 3420          

HSP 6 Score: 489.189 bits (1258), Expect = 1.164e-156
Identity = 383/433 (88.45%), Postives = 391/433 (90.30%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            LDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPT+TFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPT+TFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 3536 LDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTITFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTKLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTITFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 3968          

HSP 7 Score: 451.055 bits (1159), Expect = 2.348e-143
Identity = 356/387 (91.99%), Postives = 363/387 (93.80%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ 1105
            LDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPT+TFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V + GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPT+TFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ
Sbjct: 3753 LDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTITFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLIGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTITFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ 4139          

HSP 8 Score: 367.081 bits (941), Expect = 3.534e-114
Identity = 269/316 (85.13%), Postives = 273/316 (86.39%), Query Frame = 2
Query:  353 DAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            D +T  NTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 1680 DKLTSPNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTKLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 1995          

HSP 9 Score: 367.081 bits (941), Expect = 3.534e-114
Identity = 269/316 (85.13%), Postives = 273/316 (86.39%), Query Frame = 2
Query:  353 DAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            D +T  NTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 2237 DKLTSPNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 2552          

HSP 10 Score: 362.459 bits (929), Expect = 1.606e-112
Identity = 266/311 (85.53%), Postives = 270/311 (86.82%), Query Frame = 2
Query:  368 SNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            S TISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPT+TFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 3441 SKTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTITFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTKLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 3751          

HSP 11 Score: 354.369 bits (908), Expect = 1.104e-109
Identity = 262/297 (88.22%), Postives = 264/297 (88.89%), Query Frame = 2
Query:  353 DAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGTLKSAVNEINLVIKEPELVLVAVLTV 1186
            D +T  NTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPT+TFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSE           TLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 4319 DKLTSPNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTITFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSE---------NRTLKSAVNEINLVIKEPELVLVAVLTV 4606          

HSP 12 Score: 286.574 bits (732), Expect = 3.489e-86
Identity = 218/247 (88.26%), Postives = 224/247 (90.69%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPN 685
            LDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPN
Sbjct: 1997 LDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPN 2243          

HSP 13 Score: 281.182 bits (718), Expect = 2.959e-84
Identity = 216/228 (94.74%), Postives = 217/228 (95.18%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPN 685
            LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPT+TFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSE           TLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPN
Sbjct: 4419 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTITFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSE---------NRTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPN 4637          

HSP 14 Score: 257.299 bits (656), Expect = 4.915e-76
Identity = 204/228 (89.47%), Postives = 207/228 (90.79%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTI 628
            LDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTI
Sbjct: 3205 LDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTI 3432          

HSP 15 Score: 190.274 bits (482), Expect = 7.660e-53
Identity = 116/135 (85.93%), Postives = 116/135 (85.93%), Query Frame = 2
Query:  338 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPN 685
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPN
Sbjct: 1552 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTKLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPN 1686          

HSP 16 Score: 190.274 bits (482), Expect = 7.660e-53
Identity = 116/135 (85.93%), Postives = 116/135 (85.93%), Query Frame = 2
Query:  338 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPN 685
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPN
Sbjct: 4191 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPN 4325          

HSP 17 Score: 166.392 bits (420), Expect = 1.164e-44
Identity = 105/128 (82.03%), Postives = 106/128 (82.81%), Query Frame = 2
Query:  353 DAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTS 679
            D +T  NTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTS
Sbjct: 4631 DKLTSPNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTS 4758          

HSP 18 Score: 154.066 bits (388), Expect = 1.956e-40
Identity = 85/104 (81.73%), Postives = 85/104 (81.73%), Query Frame = 2
Query:  932 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 1552 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTKLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 1655          

HSP 19 Score: 154.066 bits (388), Expect = 1.956e-40
Identity = 85/104 (81.73%), Postives = 85/104 (81.73%), Query Frame = 2
Query:  932 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 4191 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 4294          

HSP 20 Score: 134.806 bits (338), Expect = 6.034e-34
Identity = 76/99 (76.77%), Postives = 77/99 (77.78%), Query Frame = 2
Query:  947 DAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            D +T  NTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 4631 DKLTSPNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 4729          

HSP 21 Score: 61.6178 bits (148), Expect = 7.505e-10
Identity = 30/30 (100.00%), Postives = 30/30 (100.00%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPN 91
            LDNGDQSTVTISGIDLAQSPKLLDKLTSPN
Sbjct: 1657 LDNGDQSTVTISGIDLAQSPKLLDKLTSPN 1686          

HSP 22 Score: 61.6178 bits (148), Expect = 7.505e-10
Identity = 30/30 (100.00%), Postives = 30/30 (100.00%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPN 91
            LDNGDQSTVTISGIDLAQSPKLLDKLTSPN
Sbjct: 4296 LDNGDQSTVTISGIDLAQSPKLLDKLTSPN 4325          

HSP 23 Score: 56.6102 bits (135), Expect = 2.362e-8
Identity = 28/28 (100.00%), Postives = 28/28 (100.00%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTS 85
            LDNGDQSTVTISGIDLAQSPKLLDKLTS
Sbjct: 4731 LDNGDQSTVTISGIDLAQSPKLLDKLTS 4758          
BLAST of SMED30011400 vs. Planmine SMEST
Match: SMESG000042718.1 (SMESG000042718.1)

HSP 1 Score: 489.96 bits (1260), Expect = 5.700e-157
Identity = 385/433 (88.91%), Postives = 391/433 (90.30%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            LDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 1780 LDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 2212          

HSP 2 Score: 489.96 bits (1260), Expect = 5.700e-157
Identity = 385/433 (88.91%), Postives = 391/433 (90.30%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            LDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 2337 LDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 2769          

HSP 3 Score: 489.96 bits (1260), Expect = 5.700e-157
Identity = 385/433 (88.91%), Postives = 391/433 (90.30%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            LDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 2554 LDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 2986          

HSP 4 Score: 489.574 bits (1259), Expect = 8.148e-157
Identity = 384/433 (88.68%), Postives = 391/433 (90.30%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            LDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPT+TFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 2771 LDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTITFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 3203          

HSP 5 Score: 489.574 bits (1259), Expect = 8.148e-157
Identity = 384/433 (88.68%), Postives = 391/433 (90.30%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            LDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPT+TFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 2988 LDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTITFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 3420          

HSP 6 Score: 489.189 bits (1258), Expect = 1.165e-156
Identity = 383/433 (88.45%), Postives = 391/433 (90.30%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            LDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPT+TFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPT+TFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 3536 LDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTITFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTKLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTITFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 3968          

HSP 7 Score: 451.055 bits (1159), Expect = 2.350e-143
Identity = 356/387 (91.99%), Postives = 363/387 (93.80%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ 1105
            LDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPT+TFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V + GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPT+TFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ
Sbjct: 3753 LDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTITFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLIGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTITFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ 4139          

HSP 8 Score: 397.127 bits (1019), Expect = 1.381e-124
Identity = 346/414 (83.57%), Postives = 347/414 (83.82%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGTLKSAVNEINLVIKEPELVLVAVLTV 1186
            LDNGDQSTVTISGIDLAQSPKLLDKLTSPN                              LEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPT+TFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGST                  QGTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 4296 LDNGDQSTVTISGIDLAQSPKLLDKLTSPN------------------------------LEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTITFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGST------------------QGTLKSAVNEINLVIKEPELVLVAVLTV 4661          

HSP 9 Score: 367.081 bits (941), Expect = 3.537e-114
Identity = 269/316 (85.13%), Postives = 273/316 (86.39%), Query Frame = 2
Query:  353 DAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            D +T  NTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 1680 DKLTSPNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTKLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 1995          

HSP 10 Score: 367.081 bits (941), Expect = 3.537e-114
Identity = 269/316 (85.13%), Postives = 273/316 (86.39%), Query Frame = 2
Query:  353 DAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            D +T  NTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 2237 DKLTSPNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 2552          

HSP 11 Score: 362.459 bits (929), Expect = 1.607e-112
Identity = 266/311 (85.53%), Postives = 270/311 (86.82%), Query Frame = 2
Query:  368 SNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            S TISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPT+TFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 3441 SKTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTITFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTKLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 3751          

HSP 12 Score: 321.242 bits (822), Expect = 3.374e-98
Identity = 253/321 (78.82%), Postives = 253/321 (78.82%), Query Frame = 2
Query:  338 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPN                              LEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 4191 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPN------------------------------LEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 4481          

HSP 13 Score: 286.574 bits (732), Expect = 3.492e-86
Identity = 218/247 (88.26%), Postives = 224/247 (90.69%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPN 685
            LDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPN
Sbjct: 1997 LDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPN 2243          

HSP 14 Score: 266.159 bits (679), Expect = 4.716e-79
Identity = 209/228 (91.67%), Postives = 210/228 (92.11%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPN 685
            LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPT+TFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQG                  TLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPN
Sbjct: 4483 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTITFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQG------------------TLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPN 4692          

HSP 15 Score: 257.299 bits (656), Expect = 4.919e-76
Identity = 204/228 (89.47%), Postives = 207/228 (90.79%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTI 628
            LDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTI
Sbjct: 3205 LDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTI 3432          

HSP 16 Score: 190.274 bits (482), Expect = 7.666e-53
Identity = 116/135 (85.93%), Postives = 116/135 (85.93%), Query Frame = 2
Query:  338 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPN 685
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPN
Sbjct: 1552 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTKLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPN 1686          

HSP 17 Score: 166.392 bits (420), Expect = 1.165e-44
Identity = 105/128 (82.03%), Postives = 106/128 (82.81%), Query Frame = 2
Query:  353 DAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTS 679
            D +T  NTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTS
Sbjct: 4686 DKLTSPNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTS 4813          

HSP 18 Score: 154.066 bits (388), Expect = 1.958e-40
Identity = 85/104 (81.73%), Postives = 85/104 (81.73%), Query Frame = 2
Query:  932 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 1552 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTKLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 1655          

HSP 19 Score: 134.806 bits (338), Expect = 6.039e-34
Identity = 76/99 (76.77%), Postives = 77/99 (77.78%), Query Frame = 2
Query:  947 DAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            D +T  NTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 4686 DKLTSPNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 4784          

HSP 20 Score: 61.6178 bits (148), Expect = 7.509e-10
Identity = 30/30 (100.00%), Postives = 30/30 (100.00%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPN 91
            LDNGDQSTVTISGIDLAQSPKLLDKLTSPN
Sbjct: 1657 LDNGDQSTVTISGIDLAQSPKLLDKLTSPN 1686          

HSP 21 Score: 56.6102 bits (135), Expect = 2.363e-8
Identity = 28/28 (100.00%), Postives = 28/28 (100.00%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTS 85
            LDNGDQSTVTISGIDLAQSPKLLDKLTS
Sbjct: 4786 LDNGDQSTVTISGIDLAQSPKLLDKLTS 4813          
BLAST of SMED30011400 vs. Planmine SMEST
Match: SMESG000042718.1 (SMESG000042718.1)

HSP 1 Score: 489.96 bits (1260), Expect = 5.805e-157
Identity = 385/433 (88.91%), Postives = 391/433 (90.30%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            LDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 1791 LDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 2223          

HSP 2 Score: 489.96 bits (1260), Expect = 5.805e-157
Identity = 385/433 (88.91%), Postives = 391/433 (90.30%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            LDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 2348 LDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 2780          

HSP 3 Score: 489.96 bits (1260), Expect = 5.805e-157
Identity = 385/433 (88.91%), Postives = 391/433 (90.30%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            LDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 2565 LDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 2997          

HSP 4 Score: 489.574 bits (1259), Expect = 8.297e-157
Identity = 384/433 (88.68%), Postives = 391/433 (90.30%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            LDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPT+TFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 2782 LDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTITFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 3214          

HSP 5 Score: 489.574 bits (1259), Expect = 8.297e-157
Identity = 384/433 (88.68%), Postives = 391/433 (90.30%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            LDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPT+TFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 2999 LDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTITFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 3431          

HSP 6 Score: 489.189 bits (1258), Expect = 1.186e-156
Identity = 383/433 (88.45%), Postives = 391/433 (90.30%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            LDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPT+TFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPT+TFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 3547 LDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTITFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTKLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTITFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 3979          

HSP 7 Score: 488.034 bits (1255), Expect = 2.747e-156
Identity = 384/433 (88.68%), Postives = 390/433 (90.07%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            LDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPT+TFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V + GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 3764 LDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTITFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLIGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 4196          

HSP 8 Score: 423.705 bits (1088), Expect = 8.734e-134
Identity = 360/433 (83.14%), Postives = 362/433 (83.60%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            LDNGD+S V + GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPN                              LEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 3981 LDNGDKSMVVLIGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPN------------------------------LEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 4383          

HSP 9 Score: 403.675 bits (1036), Expect = 7.339e-127
Identity = 349/415 (84.10%), Postives = 354/415 (85.30%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSE-IVIDVNPTHQGTLKSAVNEINLVIKEPELVLVAVLTV 1186
            LDNGDQSTVTISGIDLAQSPKLLDKLTSPN                              LEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPT+TFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQG+  +  E   +  N +  GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 4198 LDNGDQSTVTISGIDLAQSPKLLDKLTSPN------------------------------LEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTITFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 4582          

HSP 10 Score: 367.081 bits (941), Expect = 3.499e-114
Identity = 269/316 (85.13%), Postives = 273/316 (86.39%), Query Frame = 2
Query:  353 DAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            D +T  NTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 2248 DKLTSPNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 2563          

HSP 11 Score: 362.459 bits (929), Expect = 1.590e-112
Identity = 266/311 (85.53%), Postives = 270/311 (86.82%), Query Frame = 2
Query:  368 SNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            S TISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPT+TFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 3452 SKTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTITFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTKLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 3762          

HSP 12 Score: 346.665 bits (888), Expect = 5.152e-107
Identity = 257/301 (85.38%), Postives = 261/301 (86.71%), Query Frame = 2
Query:  398 VLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            +LVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 1706 LLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTKLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 2006          

HSP 13 Score: 286.574 bits (732), Expect = 3.521e-86
Identity = 218/247 (88.26%), Postives = 224/247 (90.69%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPN 685
            LDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPN
Sbjct: 2008 LDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPN 2254          

HSP 14 Score: 272.707 bits (696), Expect = 2.561e-81
Identity = 212/229 (92.58%), Postives = 217/229 (94.76%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSE-IVIDVNPTHQGTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPN 685
            LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPT+TFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQG+  +  E   +  N +  GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPN
Sbjct: 4385 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTITFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPN 4613          

HSP 15 Score: 257.299 bits (656), Expect = 4.960e-76
Identity = 204/228 (89.47%), Postives = 207/228 (90.79%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTI 628
            LDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTI
Sbjct: 3216 LDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTI 3443          

HSP 16 Score: 221.476 bits (563), Expect = 1.085e-63
Identity = 132/153 (86.27%), Postives = 133/153 (86.93%), Query Frame = 2
Query:  338 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQ 739
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRT +
Sbjct: 1552 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTKLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTFK 1704          

HSP 17 Score: 166.392 bits (420), Expect = 1.153e-44
Identity = 105/128 (82.03%), Postives = 106/128 (82.81%), Query Frame = 2
Query:  353 DAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTS 679
            D +T  NTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTS
Sbjct: 4607 DKLTSPNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTS 4734          

HSP 18 Score: 154.066 bits (388), Expect = 1.937e-40
Identity = 85/104 (81.73%), Postives = 85/104 (81.73%), Query Frame = 2
Query:  932 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 1552 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTKLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 1655          

HSP 19 Score: 134.806 bits (338), Expect = 5.920e-34
Identity = 76/99 (76.77%), Postives = 77/99 (77.78%), Query Frame = 2
Query:  947 DAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            D +T  NTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 4607 DKLTSPNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 4705          

HSP 20 Score: 93.2041 bits (230), Expect = 5.379e-20
Identity = 46/48 (95.83%), Postives = 47/48 (97.92%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQ 145
            LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRT +
Sbjct: 1657 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTFK 1704          

HSP 21 Score: 56.6102 bits (135), Expect = 2.382e-8
Identity = 28/28 (100.00%), Postives = 28/28 (100.00%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTS 85
            LDNGDQSTVTISGIDLAQSPKLLDKLTS
Sbjct: 4707 LDNGDQSTVTISGIDLAQSPKLLDKLTS 4734          
BLAST of SMED30011400 vs. Planmine SMEST
Match: SMESG000042718.1 (SMESG000042718.1)

HSP 1 Score: 489.96 bits (1260), Expect = 5.813e-157
Identity = 385/433 (88.91%), Postives = 391/433 (90.30%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            LDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 1780 LDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 2212          

HSP 2 Score: 489.96 bits (1260), Expect = 5.813e-157
Identity = 385/433 (88.91%), Postives = 391/433 (90.30%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            LDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 2337 LDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 2769          

HSP 3 Score: 489.96 bits (1260), Expect = 5.813e-157
Identity = 385/433 (88.91%), Postives = 391/433 (90.30%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            LDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 2554 LDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 2986          

HSP 4 Score: 489.574 bits (1259), Expect = 8.308e-157
Identity = 384/433 (88.68%), Postives = 391/433 (90.30%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            LDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPT+TFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 2771 LDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTITFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 3203          

HSP 5 Score: 489.574 bits (1259), Expect = 8.308e-157
Identity = 384/433 (88.68%), Postives = 391/433 (90.30%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            LDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPT+TFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 2988 LDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTITFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 3420          

HSP 6 Score: 489.189 bits (1258), Expect = 1.188e-156
Identity = 383/433 (88.45%), Postives = 391/433 (90.30%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            LDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPT+TFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPT+TFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 3536 LDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTITFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTKLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTITFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 3968          

HSP 7 Score: 451.055 bits (1159), Expect = 2.396e-143
Identity = 356/387 (91.99%), Postives = 363/387 (93.80%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ 1105
            LDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPT+TFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V + GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPT+TFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ
Sbjct: 3753 LDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTITFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLIGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTITFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ 4139          

HSP 8 Score: 403.675 bits (1036), Expect = 7.565e-127
Identity = 349/415 (84.10%), Postives = 354/415 (85.30%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSE-IVIDVNPTHQGTLKSAVNEINLVIKEPELVLVAVLTV 1186
            LDNGDQSTVTISGIDLAQSPKLLDKLTSPN                              LEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPT+TFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQG+  +  E   +  N +  GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 4296 LDNGDQSTVTISGIDLAQSPKLLDKLTSPN------------------------------LEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTITFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 4680          

HSP 9 Score: 367.081 bits (941), Expect = 3.572e-114
Identity = 269/316 (85.13%), Postives = 273/316 (86.39%), Query Frame = 2
Query:  353 DAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            D +T  NTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 1680 DKLTSPNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTKLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 1995          

HSP 10 Score: 367.081 bits (941), Expect = 3.572e-114
Identity = 269/316 (85.13%), Postives = 273/316 (86.39%), Query Frame = 2
Query:  353 DAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            D +T  NTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 2237 DKLTSPNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 2552          

HSP 11 Score: 362.459 bits (929), Expect = 1.623e-112
Identity = 266/311 (85.53%), Postives = 270/311 (86.82%), Query Frame = 2
Query:  368 SNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            S TISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPT+TFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 3441 SKTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTITFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTKLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 3751          

HSP 12 Score: 321.242 bits (822), Expect = 3.407e-98
Identity = 253/321 (78.82%), Postives = 253/321 (78.82%), Query Frame = 2
Query:  338 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPN                              LEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 4191 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPN------------------------------LEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 4481          

HSP 13 Score: 286.574 bits (732), Expect = 3.526e-86
Identity = 218/247 (88.26%), Postives = 224/247 (90.69%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPN 685
            LDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPN
Sbjct: 1997 LDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPN 2243          

HSP 14 Score: 272.707 bits (696), Expect = 2.614e-81
Identity = 212/229 (92.58%), Postives = 217/229 (94.76%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSE-IVIDVNPTHQGTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPN 685
            LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPT+TFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQG+  +  E   +  N +  GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPN
Sbjct: 4483 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTITFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPN 4711          

HSP 15 Score: 257.299 bits (656), Expect = 4.968e-76
Identity = 204/228 (89.47%), Postives = 207/228 (90.79%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTI 628
            LDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTI
Sbjct: 3205 LDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTI 3432          

HSP 16 Score: 190.274 bits (482), Expect = 7.668e-53
Identity = 116/135 (85.93%), Postives = 116/135 (85.93%), Query Frame = 2
Query:  338 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPN 685
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPN
Sbjct: 1552 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTKLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPN 1686          

HSP 17 Score: 166.392 bits (420), Expect = 1.165e-44
Identity = 105/128 (82.03%), Postives = 106/128 (82.81%), Query Frame = 2
Query:  353 DAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTS 679
            D +T  NTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTS
Sbjct: 4705 DKLTSPNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTS 4832          

HSP 18 Score: 154.066 bits (388), Expect = 1.958e-40
Identity = 85/104 (81.73%), Postives = 85/104 (81.73%), Query Frame = 2
Query:  932 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 1552 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTKLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 1655          

HSP 19 Score: 134.806 bits (338), Expect = 6.040e-34
Identity = 76/99 (76.77%), Postives = 77/99 (77.78%), Query Frame = 2
Query:  947 DAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPELVLVAVLTV 1186
            D +T  NTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTV
Sbjct: 4705 DKLTSPNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTV 4803          

HSP 20 Score: 61.6178 bits (148), Expect = 7.510e-10
Identity = 30/30 (100.00%), Postives = 30/30 (100.00%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTSPN 91
            LDNGDQSTVTISGIDLAQSPKLLDKLTSPN
Sbjct: 1657 LDNGDQSTVTISGIDLAQSPKLLDKLTSPN 1686          

HSP 21 Score: 56.6102 bits (135), Expect = 2.363e-8
Identity = 28/28 (100.00%), Postives = 28/28 (100.00%), Query Frame = 2
Query:    2 LDNGDQSTVTISGIDLAQSPKLLDKLTS 85
            LDNGDQSTVTISGIDLAQSPKLLDKLTS
Sbjct: 4805 LDNGDQSTVTISGIDLAQSPKLLDKLTS 4832          
The following BLAST results are available for this feature:
BLAST of SMED30011400 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011400 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011400 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011400 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011400 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011400 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011400 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011400 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011400 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011400 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011400 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011400 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011400 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011400 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000042718.15.593e-15788.91SMESG000042718.1[more]
SMESG000042718.15.696e-15788.91SMESG000042718.1[more]
SMESG000042718.15.700e-15788.91SMESG000042718.1[more]
SMESG000042718.15.805e-15788.91SMESG000042718.1[more]
SMESG000042718.15.813e-15788.91SMESG000042718.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011400 ID=SMED30011400|Name=SMED30011400|organism=Schmidtea mediterranea sexual|type=transcript|length=1188bp
ATTGGACAATGGTGATCAATCAACTGTAACAATATCCGGAATAGATCTAG
CACAATCTCCAAAGTTGTTGGACAAATTGACTTCGCCAAATGTAAATCCA
GGATCTGAAATCGAGAAAATAGAAATTTCCATTAGAACCATTCAAAATTC
TGATGGAACTAATCCAACAATAACTATCAAGTTAGAAGTCAATGGTTGCT
TCACTCCAACTGAAGCATCTACAACTTCAGAAACAAGTTCGACATCCATA
ACTACGACGTCCGGAACTACAACATCTACCACAACGCCAACAGTAACTTT
TACAACGTCAACACCGAAAACAACAACAATTCCAACACAGTGTTTAATTA
AAGACGCAATGACAGACAGCAATACTATATCACCATCTGACATCACAGTT
CTTGTCGATGACACACCATTGCCTAAACAAGCAAATGTAAATCTTGGAAG
TACACAAGGTTTAACAATAACTGGTTCAGAAATCGTAATTGACGTCAATC
CAACACATCAAGGAACGCTGAAGTCAGCAGTCAATGAAATCAACCTTGTC
ATTAAAGAACCTGAACTAGTCCTAGTTGCAGTACTGACAGTAACATTGGA
CAATGGTGATCAATCAACTGTAACAATATCCGGAATAGATCTAGCACAAT
CTCCAAAGTTGTTGGACAAATTGACTTCGCCAAATGTAAATCCAGGATCT
GAAATCGAGAAAATAGAAATTTCCATTAGAACCATTCAAAATTCTGATGG
AACTAATCCAACAATAACTATCAAGTTAGAAGTCAATGGTTGCTTCACTC
CAACTGAAGCATCTACAACTTCAGAAACAAGTTCGACATCCATAACTACG
ACGTCCGGAACTACAACATCTACCACAACGCCAACAGTAACTTTTACAAC
GTCAACACCGAAAACAACAACAATTCCAACACAGTGTTTAATTAAAGACG
CAATGACAGACAGCAATACTATATCACCATCTGACATCACAGTTCTTGTC
GATGACACACCATTGCCTAAACAAGCAAATGTAAATCTTGGAAGTACACA
AGGTTTAACAATAACTGGTTCAGAAATCGTAATTGACGTCAATCCAACAC
ATCAAGGAACGCTGAAGTCAGCAGTCAATGAAATCAACCTTGTCATTAAA
GAACCTGAACTAGTCCTAGTTGCAGTACTGACAGTAAC
back to top

protein sequence of SMED30011400-orf-1

>SMED30011400-orf-1 ID=SMED30011400-orf-1|Name=SMED30011400-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=395bp
LDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNS
DGTNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTF
TTSTPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGS
TQGLTITGSEIVIDVNPTHQGTLKSAVNEINLVIKEPELVLVAVLTVTLD
NGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDG
TNPTITIKLEVNGCFTPTEASTTSETSSTSITTTSGTTTSTTTPTVTFTT
STPKTTTIPTQCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQ
GLTITGSEIVIDVNPTHQGTLKSAVNEINLVIKEPELVLVAVLTV
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0000419prepharyngeal region
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 268..295
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 70..98