4-aminobutyrate aminotransferase

Overview
Name4-aminobutyrate aminotransferase
Smed IDSMED30011394
Length (bp)1697
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 4-aminobutyrate aminotransferase (SMED30011394) t-SNE clustered cells

Violin plots show distribution of expression levels for 4-aminobutyrate aminotransferase (SMED30011394) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 4-aminobutyrate aminotransferase (SMED30011394) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 4-aminobutyrate aminotransferase (SMED30011394) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011394

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30011394SMESG000037567.1 SmedASXL_011419SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
parenchymal cellSMED30011394SMESG000037567.1 dd_Smed_v4_4367_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30011394SMESG000037567.1 dd_Smed_v6_4367_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Human
Match: ABAT (4-aminobutyrate aminotransferase [Source:HGNC Symbol;Acc:HGNC:23])

HSP 1 Score: 481.871 bits (1239), Expect = 1.215e-165
Identity = 234/453 (51.66%), Postives = 309/453 (68.21%), Query Frame = 3
Query:  231 PIMKTAVPGPKSMETIKKLSDFQMVNGIKFIANYENSIGNYIADVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKIDVPLFNWPQADFPIYKYDXXXXXXXXXXQDKICLEMVEETIRKC-AEISPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGYFTTKDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHVDLFLECFEDLI 1586
            P+MKT VPGP+S E +K+L+  Q    + F  NYE S GNY+ DVD N MLDL+ QISS+P+GY+HP L  + +  +     +NRP LG+ PP+++ + L+ SL+SVAPKG++ + TM CGSC+ ENA+K +F+  +  ERG + F+ EELE+CM N+ PGCP  SILSF G FHGRT+G L+ T SKAIHKID+P F+WP A FP  KY LEE ++ N  ++  CLE VE+ I K   +   V G+IVEP+ +EGGD H S++FF  LR+I RK   AF+VDEVQTG G TG FWAHE W L  P D++TFSKKM+ GG+F  +++ P APY+IFNTWLG+PSK LLL  V+  IK EDL+N     G  LL GL ++Q      +S  RG GTFC+ D    + R+K++   RN+G +LGGCGD SIRFRP L  +  H  LFL  F D++
Sbjct:   44 PLMKTEVPGPRSQELMKQLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYSHPALLKLIQQPQNASMFVNRPALGILPPENFVEKLRQSLLSVAPKGMSQLITMACGSCSNENALKTIFMWYRSKERGQRGFSQEELETCMINQAPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPSFDWPIAPFPRLKYPLEEFVKENQQEEARCLEEVEDLIVKYRKKKKTVAGIIVEPIQSEGGDNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPADVMTFSKKMMTGGFFHKEEFRPNAPYRIFNTWLGDPSKNLLLAEVINIIKREDLLNNAAHAGKALLTGLLDLQARYPQFISRVRGRGTFCSFDTPDDSIRNKLILIARNKGVVLGGCGDKSIRFRPTLVFRDHHAHLFLNIFSDIL 496          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Human
Match: ABAT (4-aminobutyrate aminotransferase [Source:HGNC Symbol;Acc:HGNC:23])

HSP 1 Score: 481.871 bits (1239), Expect = 1.215e-165
Identity = 234/453 (51.66%), Postives = 309/453 (68.21%), Query Frame = 3
Query:  231 PIMKTAVPGPKSMETIKKLSDFQMVNGIKFIANYENSIGNYIADVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKIDVPLFNWPQADFPIYKYDXXXXXXXXXXQDKICLEMVEETIRKC-AEISPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGYFTTKDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHVDLFLECFEDLI 1586
            P+MKT VPGP+S E +K+L+  Q    + F  NYE S GNY+ DVD N MLDL+ QISS+P+GY+HP L  + +  +     +NRP LG+ PP+++ + L+ SL+SVAPKG++ + TM CGSC+ ENA+K +F+  +  ERG + F+ EELE+CM N+ PGCP  SILSF G FHGRT+G L+ T SKAIHKID+P F+WP A FP  KY LEE ++ N  ++  CLE VE+ I K   +   V G+IVEP+ +EGGD H S++FF  LR+I RK   AF+VDEVQTG G TG FWAHE W L  P D++TFSKKM+ GG+F  +++ P APY+IFNTWLG+PSK LLL  V+  IK EDL+N     G  LL GL ++Q      +S  RG GTFC+ D    + R+K++   RN+G +LGGCGD SIRFRP L  +  H  LFL  F D++
Sbjct:   44 PLMKTEVPGPRSQELMKQLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYSHPALLKLIQQPQNASMFVNRPALGILPPENFVEKLRQSLLSVAPKGMSQLITMACGSCSNENALKTIFMWYRSKERGQRGFSQEELETCMINQAPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPSFDWPIAPFPRLKYPLEEFVKENQQEEARCLEEVEDLIVKYRKKKKTVAGIIVEPIQSEGGDNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPADVMTFSKKMMTGGFFHKEEFRPNAPYRIFNTWLGDPSKNLLLAEVINIIKREDLLNNAAHAGKALLTGLLDLQARYPQFISRVRGRGTFCSFDTPDDSIRNKLILIARNKGVVLGGCGDKSIRFRPTLVFRDHHAHLFLNIFSDIL 496          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Human
Match: ABAT (4-aminobutyrate aminotransferase [Source:HGNC Symbol;Acc:HGNC:23])

HSP 1 Score: 481.871 bits (1239), Expect = 1.215e-165
Identity = 234/453 (51.66%), Postives = 309/453 (68.21%), Query Frame = 3
Query:  231 PIMKTAVPGPKSMETIKKLSDFQMVNGIKFIANYENSIGNYIADVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKIDVPLFNWPQADFPIYKYDXXXXXXXXXXQDKICLEMVEETIRKC-AEISPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGYFTTKDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHVDLFLECFEDLI 1586
            P+MKT VPGP+S E +K+L+  Q    + F  NYE S GNY+ DVD N MLDL+ QISS+P+GY+HP L  + +  +     +NRP LG+ PP+++ + L+ SL+SVAPKG++ + TM CGSC+ ENA+K +F+  +  ERG + F+ EELE+CM N+ PGCP  SILSF G FHGRT+G L+ T SKAIHKID+P F+WP A FP  KY LEE ++ N  ++  CLE VE+ I K   +   V G+IVEP+ +EGGD H S++FF  LR+I RK   AF+VDEVQTG G TG FWAHE W L  P D++TFSKKM+ GG+F  +++ P APY+IFNTWLG+PSK LLL  V+  IK EDL+N     G  LL GL ++Q      +S  RG GTFC+ D    + R+K++   RN+G +LGGCGD SIRFRP L  +  H  LFL  F D++
Sbjct:   44 PLMKTEVPGPRSQELMKQLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYSHPALLKLIQQPQNASMFVNRPALGILPPENFVEKLRQSLLSVAPKGMSQLITMACGSCSNENALKTIFMWYRSKERGQRGFSQEELETCMINQAPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPSFDWPIAPFPRLKYPLEEFVKENQQEEARCLEEVEDLIVKYRKKKKTVAGIIVEPIQSEGGDNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPADVMTFSKKMMTGGFFHKEEFRPNAPYRIFNTWLGDPSKNLLLAEVINIIKREDLLNNAAHAGKALLTGLLDLQARYPQFISRVRGRGTFCSFDTPDDSIRNKLILIARNKGVVLGGCGDKSIRFRPTLVFRDHHAHLFLNIFSDIL 496          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Human
Match: ABAT (4-aminobutyrate aminotransferase [Source:HGNC Symbol;Acc:HGNC:23])

HSP 1 Score: 481.485 bits (1238), Expect = 2.978e-165
Identity = 234/453 (51.66%), Postives = 309/453 (68.21%), Query Frame = 3
Query:  231 PIMKTAVPGPKSMETIKKLSDFQMVNGIKFIANYENSIGNYIADVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKIDVPLFNWPQADFPIYKYDXXXXXXXXXXQDKICLEMVEETIRKC-AEISPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGYFTTKDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHVDLFLECFEDLI 1586
            P+MKT VPGP+S E +K+L+  Q    + F  NYE S GNY+ DVD N MLDL+ QISS+P+GY+HP L  + +  +     +NRP LG+ PP+++ + L+ SL+SVAPKG++ + TM CGSC+ ENA+K +F+  +  ERG + F+ EELE+CM N+ PGCP  SILSF G FHGRT+G L+ T SKAIHKID+P F+WP A FP  KY LEE ++ N  ++  CLE VE+ I K   +   V G+IVEP+ +EGGD H S++FF  LR+I RK   AF+VDEVQTG G TG FWAHE W L  P D++TFSKKM+ GG+F  +++ P APY+IFNTWLG+PSK LLL  V+  IK EDL+N     G  LL GL ++Q      +S  RG GTFC+ D    + R+K++   RN+G +LGGCGD SIRFRP L  +  H  LFL  F D++
Sbjct:   59 PLMKTEVPGPRSQELMKQLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYSHPALLKLIQQPQNASMFVNRPALGILPPENFVEKLRQSLLSVAPKGMSQLITMACGSCSNENALKTIFMWYRSKERGQRGFSQEELETCMINQAPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPSFDWPIAPFPRLKYPLEEFVKENQQEEARCLEEVEDLIVKYRKKKKTVAGIIVEPIQSEGGDNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPADVMTFSKKMMTGGFFHKEEFRPNAPYRIFNTWLGDPSKNLLLAEVINIIKREDLLNNAAHAGKALLTGLLDLQARYPQFISRVRGRGTFCSFDTPDDSIRNKLILIARNKGVVLGGCGDKSIRFRPTLVFRDHHAHLFLNIFSDIL 511          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Human
Match: ABAT (4-aminobutyrate aminotransferase [Source:HGNC Symbol;Acc:HGNC:23])

HSP 1 Score: 437.573 bits (1124), Expect = 4.869e-148
Identity = 214/419 (51.07%), Postives = 285/419 (68.02%), Query Frame = 3
Query:  231 PIMKTAVPGPKSMETIKKLSDFQMVNGIKFIANYENSIGNYIADVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKIDVPLFNWPQADFPIYKYDXXXXXXXXXXQDKICLEMVEETIRKC-AEISPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGYFTTKDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEELRNRGF 1484
            P+MKT VPGP+S E +K+L+  Q    + F  NYE S GNY+ DVD N MLDL+ QISS+P+GY+HP L  + +  +     +NRP LG+ PP+++ + L+ SL+SVAPKG++ + TM CGSC+ ENA+K +F+  +  ERG + F+ EELE+CM N+ PGCP  SILSF G FHGRT+G L+ T SKAIHKID+P F+WP A FP  KY LEE ++ N  ++  CLE VE+ I K   +   V G+IVEP+ +EGGD H S++FF  LR+I RK   AF+VDEVQTG G TG FWAHE W L  P D++TFSKKM+ GG+F  +++ P APY+IFNTWLG+PSK LLL  V+  IK EDL+N     G  LL GL ++Q      +S  RG GTFC+ D    + R+K++   RN+  
Sbjct:   44 PLMKTEVPGPRSQELMKQLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYSHPALLKLIQQPQNASMFVNRPALGILPPENFVEKLRQSLLSVAPKGMSQLITMACGSCSNENALKTIFMWYRSKERGQRGFSQEELETCMINQAPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPSFDWPIAPFPRLKYPLEEFVKENQQEEARCLEEVEDLIVKYRKKKKTVAGIIVEPIQSEGGDNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPADVMTFSKKMMTGGFFHKEEFRPNAPYRIFNTWLGDPSKNLLLAEVINIIKREDLLNNAAHAGKALLTGLLDLQARYPQFISRVRGRGTFCSFDTPDDSIRNKLILIARNKAL 462          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Celegans
Match: gta-1 (Probable 4-aminobutyrate aminotransferase, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q21217])

HSP 1 Score: 444.121 bits (1141), Expect = 1.456e-151
Identity = 220/467 (47.11%), Postives = 295/467 (63.17%), Query Frame = 3
Query:  192 KNVSRQFSNEPPKPIMKTAVPGPKSMETIKKLSDFQMVNGIKFIANYENSIGNYIADVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKIDVPLFNWPQADFPIYKYDXXXXXXXXXXQDKICLEMVEETIRKCAEI-SPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGYFTTKDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHVDLFLECFEDLIK 1589
            + VS   + EP  P + T++PGPKS    +++        ++F  +YE S GNY+ D D N +LD++ QISS+PLGYNHP+L  VA     I S ++RP LG FP  D+ D +  +L S+APKGL  VQTM+CG+ A ENAIK  FI  +   RGG       LESCM  + PG P  S++ F+G FHGR+L  LS+TRSK IHK+D+P F+WP A FP YKY L++N+ YN  QD+ CL  VE  I +     + V  +IVEP+ AEGGD +GS  FF  LR+I  K  I FIVDEVQTG G TG  WAH+ WNL  PPD+VTFSKK+L GGYF  +       Y+I+NTW+G+P+K+LLLE  ++ IK + LI +++E G    K L  +Q  S  KL  ARG GTF A+D  + + RDK ++   + G   GGCGD S+RFRP+L    +H+DL  +  +  +K
Sbjct:   15 RGVSAIANAEPSGPSISTSIPGPKSKALKQEMDKVHQTTSVRFHVDYEKSFGNYVVDADGNALLDVYTQISSLPLGYNHPDLVKVASQPHLITSLVSRPALGSFPRTDFADGISHALTSIAPKGLKAVQTMLCGTSANENAIKTAFIWYQAQRRGGLGPDALHLESCMNQQKPGTPNLSVMGFEGAFHGRSLCMLSVTRSKPIHKVDIPAFDWPIAKFPRYKYPLDQNVAYNKKQDQECLADVEAKISEWKRRDNDVAAIIVEPIQAEGGDHYGSPAFFQGLRDITSKHGIVFIVDEVQTGGGATGDIWAHDHWNLSSPPDMVTFSKKLLTGGYFYGEHLRVKEAYRIYNTWMGDPTKLLLLEKAVEVIKRDGLIEQSREVGAEFQKRLGELQASSGGKLDQARGRGTFAAVDFPSGSLRDKFVDLAISNGLHCGGCGDRSLRFRPSLVYTKKHLDLTFDLLDKTLK 481          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Celegans
Match: gta-1 (Probable 4-aminobutyrate aminotransferase, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q21217])

HSP 1 Score: 319.701 bits (818), Expect = 4.756e-105
Identity = 163/337 (48.37%), Postives = 215/337 (63.80%), Query Frame = 3
Query:  582 MMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKIDVPLFNWPQADFPIYKYDXXXXXXXXXXQDKICLEMVEETIRKCAEI-SPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGYFTTKDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHVDLFLECFEDLIK 1589
            M+CG+ A ENAIK  FI  +   RGG       LESCM  + PG P  S++ F+G FHGR+L  LS+TRSK IHK+D+P F+WP A FP YKY L++N+ YN  QD+ CL  VE  I +     + V  +IVEP+ AEGGD +GS  FF  LR+I  K  I FIVDEVQTG G TG  WAH+ WNL  PPD+VTFSKK+L GGYF  +       Y+I+NTW+G+P+K+LLLE  ++ IK + LI +++E G    K L  +Q  S  KL  ARG GTF A+D  + + RDK ++   + G   GGCGD S+RFRP+L    +H+DL  +  +  +K
Sbjct:    1 MLCGTSANENAIKTAFIWYQAQRRGGLGPDALHLESCMNQQKPGTPNLSVMGFEGAFHGRSLCMLSVTRSKPIHKVDIPAFDWPIAKFPRYKYPLDQNVAYNKKQDQECLADVEAKISEWKRRDNDVAAIIVEPIQAEGGDHYGSPAFFQGLRDITSKHGIVFIVDEVQTGGGATGDIWAHDHWNLSSPPDMVTFSKKLLTGGYFYGEHLRVKEAYRIYNTWMGDPTKLLLLEKAVEVIKRDGLIEQSREVGAEFQKRLGELQASSGGKLDQARGRGTFAAVDFPSGSLRDKFVDLAISNGLHCGGCGDRSLRFRPSLVYTKKHLDLTFDLLDKTLK 337          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Celegans
Match: gta-1 (Probable 4-aminobutyrate aminotransferase, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q21217])

HSP 1 Score: 319.701 bits (818), Expect = 4.756e-105
Identity = 163/337 (48.37%), Postives = 215/337 (63.80%), Query Frame = 3
Query:  582 MMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKIDVPLFNWPQADFPIYKYDXXXXXXXXXXQDKICLEMVEETIRKCAEI-SPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGYFTTKDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHVDLFLECFEDLIK 1589
            M+CG+ A ENAIK  FI  +   RGG       LESCM  + PG P  S++ F+G FHGR+L  LS+TRSK IHK+D+P F+WP A FP YKY L++N+ YN  QD+ CL  VE  I +     + V  +IVEP+ AEGGD +GS  FF  LR+I  K  I FIVDEVQTG G TG  WAH+ WNL  PPD+VTFSKK+L GGYF  +       Y+I+NTW+G+P+K+LLLE  ++ IK + LI +++E G    K L  +Q  S  KL  ARG GTF A+D  + + RDK ++   + G   GGCGD S+RFRP+L    +H+DL  +  +  +K
Sbjct:    1 MLCGTSANENAIKTAFIWYQAQRRGGLGPDALHLESCMNQQKPGTPNLSVMGFEGAFHGRSLCMLSVTRSKPIHKVDIPAFDWPIAKFPRYKYPLDQNVAYNKKQDQECLADVEAKISEWKRRDNDVAAIIVEPIQAEGGDHYGSPAFFQGLRDITSKHGIVFIVDEVQTGGGATGDIWAHDHWNLSSPPDMVTFSKKLLTGGYFYGEHLRVKEAYRIYNTWMGDPTKLLLLEKAVEVIKRDGLIEQSREVGAEFQKRLGELQASSGGKLDQARGRGTFAAVDFPSGSLRDKFVDLAISNGLHCGGCGDRSLRFRPSLVYTKKHLDLTFDLLDKTLK 337          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Celegans
Match: oatr-1 (Probable ornithine aminotransferase, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q18040])

HSP 1 Score: 88.1965 bits (217), Expect = 1.816e-18
Identity = 69/240 (28.75%), Postives = 108/240 (45.00%), Query Frame = 3
Query:  909 LEMVEETIRKCAEISPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGYFTTKDYI-------PIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHV----DLFLECFEDLIKRN 1595
            L+ VE+ I+       V   +VEP+  E G +     +   + ++C+K  + FI DEVQ+G G +G   AH   N+   PDIV    K L GG++     +        I P +  +T+ G P    +  A L+ ++ E L+  +   G+ L+  LK    L K+ +S  RG G FCAI         K+  +L+  G L        IRF P L +    V    D+ ++   D  K+N
Sbjct:  193 LKAVEDAIKD----KNVAAFMVEPIQGEAGVVLPDPGYLKGVSDLCKKYNVLFITDEVQSGLGRSGKLLAHYHDNV--RPDIVVLG-KALSGGFYPVSAVLCDDNVMMNIKPGEHGSTYGGNPLACKVAIAALEILQEEKLVENSAVMGDLLMSKLKT---LPKDIVSTVRGKGLFCAIVINKKYDAWKVCLKLKENGLLAKNTHGDIIRFAPPLCINKEQVEQAADIIIKTVTDFAKQN 422          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Celegans
Match: oatr-1 (Probable ornithine aminotransferase, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q18040])

HSP 1 Score: 88.1965 bits (217), Expect = 1.816e-18
Identity = 69/240 (28.75%), Postives = 108/240 (45.00%), Query Frame = 3
Query:  909 LEMVEETIRKCAEISPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGYFTTKDYI-------PIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHV----DLFLECFEDLIKRN 1595
            L+ VE+ I+       V   +VEP+  E G +     +   + ++C+K  + FI DEVQ+G G +G   AH   N+   PDIV    K L GG++     +        I P +  +T+ G P    +  A L+ ++ E L+  +   G+ L+  LK    L K+ +S  RG G FCAI         K+  +L+  G L        IRF P L +    V    D+ ++   D  K+N
Sbjct:  193 LKAVEDAIKD----KNVAAFMVEPIQGEAGVVLPDPGYLKGVSDLCKKYNVLFITDEVQSGLGRSGKLLAHYHDNV--RPDIVVLG-KALSGGFYPVSAVLCDDNVMMNIKPGEHGSTYGGNPLACKVAIAALEILQEEKLVENSAVMGDLLMSKLKT---LPKDIVSTVRGKGLFCAIVINKKYDAWKVCLKLKENGLLAKNTHGDIIRFAPPLCINKEQVEQAADIIIKTVTDFAKQN 422          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Fly
Match: Gabat (gene:FBgn0036927 transcript:FBtr0302049)

HSP 1 Score: 486.878 bits (1252), Expect = 3.886e-168
Identity = 237/458 (51.75%), Postives = 321/458 (70.09%), Query Frame = 3
Query:  219 EPPKPIMKT-AVPGPKSMETIKKLSDFQMVNGIKFIANYENSIGNYIADVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKIDVPLFNWPQADFPIYKYDXXXXXXXXXXQDKICLEMVEETIRKCAEISPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGYFTTKDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHVDLFLECFEDLIK 1589
            EP +P++KT ++PGPKS+E  K+L   Q    I+F A+YE SIGNYI DVD N++LD++ QISS+PLGYNHP L  V  +++ + + INRP LG+FP K++ + L S L+++APKGL  + TMMCGSC+ ENA K++FI  +   RG    T +E  SCM N PPG PK SILSFKG FHGRTLGALS T SK IHK+DVP F+WP A FP Y+Y L+EN+ +N  +D+ CL  V++ I++ A  +PV G++VEP+ +EGGD   S  FF SL+ IC+K  IA ++DEVQTG G TG FWAHE + L  PPD+VTFSKK+ LGGYF   D+IP  PY+IFNTW+G+P KVLLLE V+K I+ E L+      G  L  GL +++K   + L++ RG GTF A++CT +  RD+++  L+  G   GGCG++SIRFRPAL  K  H ++ L+ F  +++
Sbjct:   27 EPKEPVVKTKSIPGPKSIELKKQLDSVQATGTIQFFADYEKSIGNYIYDVDGNILLDVYTQISSVPLGYNHPRLYKVFNNEQNLKTLINRPALGVFPGKEWPEKLHSVLLNIAPKGLNKITTMMCGSCSNENAYKSIFIWYQNKLRGNAPLTEQEKNSCMINIPPGAPKLSILSFKGAFHGRTLGALSTTHSKYIHKLDVPSFDWPIASFPEYRYPLDENVAHNKKEDEKCLSEVQDLIQQYASKNPVAGIVVEPIQSEGGDNEASPEFFRSLQAICKKNGIALLIDEVQTGGGSTGKFWAHEHFELESPPDVVTFSKKLQLGGYFHNDDFIPNEPYRIFNTWMGDPGKVLLLEEVVKVIQEEKLLANVDVAGKVLKNGLLSLEKEFPHILNSTRGRGTFLAVNCTNTKVRDQIIGALKLHGIQTGGCGEISIRFRPALIFKEYHANIVLDRFRKVLQ 484          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Fly
Match: Gabat (gene:FBgn0036927 transcript:FBtr0344085)

HSP 1 Score: 486.878 bits (1252), Expect = 3.886e-168
Identity = 237/458 (51.75%), Postives = 321/458 (70.09%), Query Frame = 3
Query:  219 EPPKPIMKT-AVPGPKSMETIKKLSDFQMVNGIKFIANYENSIGNYIADVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKIDVPLFNWPQADFPIYKYDXXXXXXXXXXQDKICLEMVEETIRKCAEISPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGYFTTKDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHVDLFLECFEDLIK 1589
            EP +P++KT ++PGPKS+E  K+L   Q    I+F A+YE SIGNYI DVD N++LD++ QISS+PLGYNHP L  V  +++ + + INRP LG+FP K++ + L S L+++APKGL  + TMMCGSC+ ENA K++FI  +   RG    T +E  SCM N PPG PK SILSFKG FHGRTLGALS T SK IHK+DVP F+WP A FP Y+Y L+EN+ +N  +D+ CL  V++ I++ A  +PV G++VEP+ +EGGD   S  FF SL+ IC+K  IA ++DEVQTG G TG FWAHE + L  PPD+VTFSKK+ LGGYF   D+IP  PY+IFNTW+G+P KVLLLE V+K I+ E L+      G  L  GL +++K   + L++ RG GTF A++CT +  RD+++  L+  G   GGCG++SIRFRPAL  K  H ++ L+ F  +++
Sbjct:   27 EPKEPVVKTKSIPGPKSIELKKQLDSVQATGTIQFFADYEKSIGNYIYDVDGNILLDVYTQISSVPLGYNHPRLYKVFNNEQNLKTLINRPALGVFPGKEWPEKLHSVLLNIAPKGLNKITTMMCGSCSNENAYKSIFIWYQNKLRGNAPLTEQEKNSCMINIPPGAPKLSILSFKGAFHGRTLGALSTTHSKYIHKLDVPSFDWPIASFPEYRYPLDENVAHNKKEDEKCLSEVQDLIQQYASKNPVAGIVVEPIQSEGGDNEASPEFFRSLQAICKKNGIALLIDEVQTGGGSTGKFWAHEHFELESPPDVVTFSKKLQLGGYFHNDDFIPNEPYRIFNTWMGDPGKVLLLEEVVKVIQEEKLLANVDVAGKVLKNGLLSLEKEFPHILNSTRGRGTFLAVNCTNTKVRDQIIGALKLHGIQTGGCGEISIRFRPALIFKEYHANIVLDRFRKVLQ 484          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Fly
Match: Gabat (gene:FBgn0036927 transcript:FBtr0074908)

HSP 1 Score: 486.878 bits (1252), Expect = 3.886e-168
Identity = 237/458 (51.75%), Postives = 321/458 (70.09%), Query Frame = 3
Query:  219 EPPKPIMKT-AVPGPKSMETIKKLSDFQMVNGIKFIANYENSIGNYIADVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKIDVPLFNWPQADFPIYKYDXXXXXXXXXXQDKICLEMVEETIRKCAEISPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGYFTTKDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHVDLFLECFEDLIK 1589
            EP +P++KT ++PGPKS+E  K+L   Q    I+F A+YE SIGNYI DVD N++LD++ QISS+PLGYNHP L  V  +++ + + INRP LG+FP K++ + L S L+++APKGL  + TMMCGSC+ ENA K++FI  +   RG    T +E  SCM N PPG PK SILSFKG FHGRTLGALS T SK IHK+DVP F+WP A FP Y+Y L+EN+ +N  +D+ CL  V++ I++ A  +PV G++VEP+ +EGGD   S  FF SL+ IC+K  IA ++DEVQTG G TG FWAHE + L  PPD+VTFSKK+ LGGYF   D+IP  PY+IFNTW+G+P KVLLLE V+K I+ E L+      G  L  GL +++K   + L++ RG GTF A++CT +  RD+++  L+  G   GGCG++SIRFRPAL  K  H ++ L+ F  +++
Sbjct:   27 EPKEPVVKTKSIPGPKSIELKKQLDSVQATGTIQFFADYEKSIGNYIYDVDGNILLDVYTQISSVPLGYNHPRLYKVFNNEQNLKTLINRPALGVFPGKEWPEKLHSVLLNIAPKGLNKITTMMCGSCSNENAYKSIFIWYQNKLRGNAPLTEQEKNSCMINIPPGAPKLSILSFKGAFHGRTLGALSTTHSKYIHKLDVPSFDWPIASFPEYRYPLDENVAHNKKEDEKCLSEVQDLIQQYASKNPVAGIVVEPIQSEGGDNEASPEFFRSLQAICKKNGIALLIDEVQTGGGSTGKFWAHEHFELESPPDVVTFSKKLQLGGYFHNDDFIPNEPYRIFNTWMGDPGKVLLLEEVVKVIQEEKLLANVDVAGKVLKNGLLSLEKEFPHILNSTRGRGTFLAVNCTNTKVRDQIIGALKLHGIQTGGCGEISIRFRPALIFKEYHANIVLDRFRKVLQ 484          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Fly
Match: Gabat (gene:FBgn0036927 transcript:FBtr0074909)

HSP 1 Score: 486.878 bits (1252), Expect = 3.886e-168
Identity = 237/458 (51.75%), Postives = 321/458 (70.09%), Query Frame = 3
Query:  219 EPPKPIMKT-AVPGPKSMETIKKLSDFQMVNGIKFIANYENSIGNYIADVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKIDVPLFNWPQADFPIYKYDXXXXXXXXXXQDKICLEMVEETIRKCAEISPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGYFTTKDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHVDLFLECFEDLIK 1589
            EP +P++KT ++PGPKS+E  K+L   Q    I+F A+YE SIGNYI DVD N++LD++ QISS+PLGYNHP L  V  +++ + + INRP LG+FP K++ + L S L+++APKGL  + TMMCGSC+ ENA K++FI  +   RG    T +E  SCM N PPG PK SILSFKG FHGRTLGALS T SK IHK+DVP F+WP A FP Y+Y L+EN+ +N  +D+ CL  V++ I++ A  +PV G++VEP+ +EGGD   S  FF SL+ IC+K  IA ++DEVQTG G TG FWAHE + L  PPD+VTFSKK+ LGGYF   D+IP  PY+IFNTW+G+P KVLLLE V+K I+ E L+      G  L  GL +++K   + L++ RG GTF A++CT +  RD+++  L+  G   GGCG++SIRFRPAL  K  H ++ L+ F  +++
Sbjct:   27 EPKEPVVKTKSIPGPKSIELKKQLDSVQATGTIQFFADYEKSIGNYIYDVDGNILLDVYTQISSVPLGYNHPRLYKVFNNEQNLKTLINRPALGVFPGKEWPEKLHSVLLNIAPKGLNKITTMMCGSCSNENAYKSIFIWYQNKLRGNAPLTEQEKNSCMINIPPGAPKLSILSFKGAFHGRTLGALSTTHSKYIHKLDVPSFDWPIASFPEYRYPLDENVAHNKKEDEKCLSEVQDLIQQYASKNPVAGIVVEPIQSEGGDNEASPEFFRSLQAICKKNGIALLIDEVQTGGGSTGKFWAHEHFELESPPDVVTFSKKLQLGGYFHNDDFIPNEPYRIFNTWMGDPGKVLLLEEVVKVIQEEKLLANVDVAGKVLKNGLLSLEKEFPHILNSTRGRGTFLAVNCTNTKVRDQIIGALKLHGIQTGGCGEISIRFRPALIFKEYHANIVLDRFRKVLQ 484          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Fly
Match: CG11241 (gene:FBgn0037186 transcript:FBtr0347061)

HSP 1 Score: 78.9518 bits (193), Expect = 3.808e-15
Identity = 68/241 (28.22%), Postives = 103/241 (42.74%), Query Frame = 3
Query:  918 VEETIRKCAEISPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGT-FWAHEKWNLCYPPDIVTFSKKM----LLGGYFTTKDYIP-IAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKML---------EELRNRGFLL--GGCGDVSIRFRPALTLKIRHVDLFLECFEDLIK 1589
            +EET +       V  +  E +   GG +     +      + R     F+ DEVQTG G TG  FW  E  +  Y PDIVT +K +     L    TT +    ++    FNT+ G P    +  AVL  I+ E L   + E G + LKGL  +Q+  +  + + RG G    ++   +  +   L         E+ +++G LL  GG     +  RP L L    V+  LE  E+  K
Sbjct:  264 LEETFKYSLPRGKVAAMFAESIQGVGGTVQFPKGYLKRAAALVRANGGLFVADEVQTGFGRTGEHFWGFESHD--YVPDIVTMAKGIGNGFPLAAVVTTPEIAASLSQALHFNTYGGNPMASAVGIAVLDVIEEEQLQRNSLEVGTYFLKGLAELQQRFE-IIGDVRGKGLMIGVELVGNREKRTPLATPHVLDIWEKCKDQGVLLGRGGLHGNVLSMRPPLCLCAEDVEFALETLEEAFK 501          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Zebrafish
Match: abat (4-aminobutyrate aminotransferase [Source:ZFIN;Acc:ZDB-GENE-031006-4])

HSP 1 Score: 476.863 bits (1226), Expect = 7.515e-164
Identity = 240/477 (50.31%), Postives = 309/477 (64.78%), Query Frame = 3
Query:  168 RYSKYFLTKNVSRQFSNEPPKPIMKTAVPGPKSMETIKKLSDFQMVNGIKFIANYENSIGNYIADVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKIDVPLFNWPQADFPIYKYDXXXXXXXXXXQDKICLEMVEETIRKCAEIS-PVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGYFTTKDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHVDLFLECFEDLIKRN 1595
            RY     TK VS +F  + P   MKT VPGPKS E +++L + Q    I F  NYE S GNY+ DVD N MLD++ QISSIP+GYNHP L  V  +   + + +NRP LG+ PP+++ + L  SL+S+AP G+T VQTM CGSC+ ENA K++FI  +  ERG    + EE+ +CM N+ PGCP  SILSF G FHGRTLG L+ T SKAIHK+D+P F+WP A FP  +Y LEE    N  ++  CLE VE+ I K  +   PV G+++EP+ AEGGD H S +FF  LR I RK    F VDEVQTG G TG FWAHE W L  P D+V+FSKKML GGYF   +  P  PY+IFNTW+G+PSK L L  VL  I+ E+L+ +   +G  LL+GL  +Q    + LS ARG GTFCAI+ ++ A RD ++ + RN+G  LG CG+ SIRFRPAL  K  HV   L    D++  +
Sbjct:   26 RYVSKTATKTVS-EFEYDAPS--MKTTVPGPKSKELLRQLGEIQNTGAIHFFCNYEESRGNYLVDVDGNRMLDVYTQISSIPIGYNHPALMKVMTNPNNVSAFVNRPALGILPPENFPEKLAESLLSIAPSGMTKVQTMACGSCSNENAFKSMFIWYRNKERGYATPSEEEVGTCMVNQSPGCPDLSILSFMGAFHGRTLGCLATTHSKAIHKLDIPSFDWPIAPFPKLRYPLEEFERENAQEEARCLEEVEDLIVKWRQKGKPVAGIVIEPIQAEGGDNHASPDFFIKLRNIARKHGCGFHVDEVQTGGGATGKFWAHEHWGLDDPADLVSFSKKMLTGGYFHRDELQPDKPYRIFNTWMGDPSKNLFLSEVLNVIRRENLLEQVTRSGKALLQGLYALQSQYPHLLSGARGQGTFCAINASSDATRDSIMLKARNKGVFLGSCGEKSIRFRPALVFKEYHVHQLLNILNDVLAEH 499          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Zebrafish
Match: abat (4-aminobutyrate aminotransferase [Source:ZFIN;Acc:ZDB-GENE-031006-4])

HSP 1 Score: 476.863 bits (1226), Expect = 7.515e-164
Identity = 240/477 (50.31%), Postives = 309/477 (64.78%), Query Frame = 3
Query:  168 RYSKYFLTKNVSRQFSNEPPKPIMKTAVPGPKSMETIKKLSDFQMVNGIKFIANYENSIGNYIADVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKIDVPLFNWPQADFPIYKYDXXXXXXXXXXQDKICLEMVEETIRKCAEIS-PVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGYFTTKDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHVDLFLECFEDLIKRN 1595
            RY     TK VS +F  + P   MKT VPGPKS E +++L + Q    I F  NYE S GNY+ DVD N MLD++ QISSIP+GYNHP L  V  +   + + +NRP LG+ PP+++ + L  SL+S+AP G+T VQTM CGSC+ ENA K++FI  +  ERG    + EE+ +CM N+ PGCP  SILSF G FHGRTLG L+ T SKAIHK+D+P F+WP A FP  +Y LEE    N  ++  CLE VE+ I K  +   PV G+++EP+ AEGGD H S +FF  LR I RK    F VDEVQTG G TG FWAHE W L  P D+V+FSKKML GGYF   +  P  PY+IFNTW+G+PSK L L  VL  I+ E+L+ +   +G  LL+GL  +Q    + LS ARG GTFCAI+ ++ A RD ++ + RN+G  LG CG+ SIRFRPAL  K  HV   L    D++  +
Sbjct:   26 RYVSKTATKTVS-EFEYDAPS--MKTTVPGPKSKELLRQLGEIQNTGAIHFFCNYEESRGNYLVDVDGNRMLDVYTQISSIPIGYNHPALMKVMTNPNNVSAFVNRPALGILPPENFPEKLAESLLSIAPSGMTKVQTMACGSCSNENAFKSMFIWYRNKERGYATPSEEEVGTCMVNQSPGCPDLSILSFMGAFHGRTLGCLATTHSKAIHKLDIPSFDWPIAPFPKLRYPLEEFERENAQEEARCLEEVEDLIVKWRQKGKPVAGIVIEPIQAEGGDNHASPDFFIKLRNIARKHGCGFHVDEVQTGGGATGKFWAHEHWGLDDPADLVSFSKKMLTGGYFHRDELQPDKPYRIFNTWMGDPSKNLFLSEVLNVIRRENLLEQVTRSGKALLQGLYALQSQYPHLLSGARGQGTFCAINASSDATRDSIMLKARNKGVFLGSCGEKSIRFRPALVFKEYHVHQLLNILNDVLAEH 499          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Zebrafish
Match: agxt2 (alanine--glyoxylate aminotransferase 2 [Source:ZFIN;Acc:ZDB-GENE-050913-100])

HSP 1 Score: 85.5001 bits (210), Expect = 3.891e-17
Identity = 97/446 (21.75%), Postives = 179/446 (40.13%), Query Frame = 3
Query:  351 YIADVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKIDVP------------LFN--WPQA---DFPIYKYDXXXXXXXXXXQDKICLEMVEETIRKCAEISPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGT-FWAHEKWNLCYPPDIVTFSKKML----LGGYFTTKDYI-PIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAAR---------DKMLEELRNRGFLLGGCG--DVSIRFRPALTLKIRHVDLFLECFEDLI 1586
            ++ DVD    LDLF  ++++ +G+ +P +   A+                   K  + L  ++ + V P+   + + ++     + + +K V+    G E         +L   M     G     +++ +G +HG +  A  LT S   +K  VP            +F   W  +   D P+           + + + + ++ ++E        S +     EP+   GG +    N+     ++ R+K    I DEVQTG G TG+ FW  E  N+   PD+VT +K +     +G   TT +     A    FNT+ G P    +  +VL TIK + +   + E G +LL  L  ++      + + RG G    ++     A          +++ E+ ++ G L+G  G    + R +P + +     D FL  F   +
Sbjct:  101 WLWDVDGRRYLDLFAGVATVSVGHCNPKVTEAAE-------------------KQLRRLWHTTPIYVYPQIQEYAEKLVS---LLPDPLKVVYFTNSGSEA-------NDLAVLMARLHTG--NFDVITLRGSYHGGSPQATGLT-SNTHYKYPVPSSLGCHNTMCPDVFRGLWGGSHCRDSPVQTIRECSCSPGHCHANDMYIKELKEVFDTTVP-SRIAAFFTEPIQGVGGAVQYPKNYLKETYQLVREKGGICIADEVQTGFGRTGSHFWGFEGHNVI--PDMVTMAKGIANGIPMGAVVTTAEIARSFAKGVHFNTFGGNPLACAIASSVLDTIKEDKMQENSAELGTYLLTELAKLRD-KYEIIGDVRGKGLQIGVEMVKDKASRTPLPQEAMNEIFEDTKDMGVLIGKGGLYGQTFRIKPPMCITKADADFFLSVFNQAV 510          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Zebrafish
Match: oat (ornithine aminotransferase [Source:ZFIN;Acc:ZDB-GENE-110411-148])

HSP 1 Score: 67.781 bits (164), Expect = 1.355e-11
Identity = 64/227 (28.19%), Postives = 95/227 (41.85%), Query Frame = 3
Query:  927 TIRKCAEISPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWA--HEKWNLCYPPDIVTFSKKMLLGGYFTT------KDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARD--KMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHVDLFLECFE 1577
             + K  +   V   +VEP+  E G +     +   +RE+C K  + FI DEVQTG   TG   A  HE       PD+V   K +  G Y  +      +  + I P +  +T+ G P    +  A L+ ++ E+L    +  G  L   L    KL +  +S  RG G   AI    +   D  ++   LR+ G L        IR  P LT+  + V    EC E
Sbjct:  219 ALEKALQDPHVAAFMVEPIQGEAGVVVPDAGYLQKVRELCTKYNVLFIADEVQTGLCRTGRRLAVDHEAVR----PDLVILGKALSGGVYPVSAVLCDDEVMLTIKPGEHGSTYGGNPLACRVAIAALEVLEEENLAANAERMGQILRAEL---NKLPREIVSGVRGKGLLNAIIIKETKDYDAWQVCLRLRDNGLLAKPTHGDIIRLAPPLTINEQEVR---ECVE 435          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Zebrafish
Match: etnppl (ethanolamine-phosphate phospho-lyase [Source:NCBI gene;Acc:393421])

HSP 1 Score: 65.855 bits (159), Expect = 5.709e-11
Identity = 60/243 (24.69%), Postives = 106/243 (43.62%), Query Frame = 3
Query:  912 EMVEETIRKCAEISPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGT-FWAHEKWNLCYPPDIVTFSKKMLLGG----YFTTKDYIPI---APYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCT--------TSAARDKMLEELRNRGFLLGGCGDVS--IRFRPALTLKIRHVDLFLECFEDLI 1586
            E++EE  +K  EI+     I E + + GG +     +F  + +  R     FI DEVQ G G  GT FW  +     + PDIVT  K +  G       T+++       +  + FNT+ G P    +  AVL  I+ EDL       G +L + L++++K     + + RG G F  ++           +A   +++  L+ +  LL   G     ++F+P +       +  +E  + ++
Sbjct:  197 EVIEEAHKKGHEIA---AFIAESLQSCGGQVIPPMGYFQKVAQHVRNAGGIFIADEVQVGFGRVGTHFWGFQLQGEDFVPDIVTMGKPIGNGHPMSCVITSREIAESFMSSGMEYFNTFGGNPVSCAIGLAVLNVIEKEDLQGNALHVGGYLTQLLEDLKK-RHPLVGDVRGRGLFVGLELVRNQSKRTPATAEAQEVIYRLKEQRILLSADGPHRNVLKFKPPMCFSREDAEFAVEKIDQIL 435          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Xenopus
Match: abat (4-aminobutyrate aminotransferase [Source:NCBI gene;Acc:100158654])

HSP 1 Score: 488.804 bits (1257), Expect = 1.240e-168
Identity = 245/487 (50.31%), Postives = 327/487 (67.15%), Query Frame = 3
Query:  132 VNRFIMQKTVNIRY-SKYFLTKNVSRQFSNEPPKPIMKTAVPGPKSMETIKKLSDFQMVNGIKFIANYENSIGNYIADVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKIDVPLFNWPQADFPIYKYDXXXXXXXXXXQDKICLEMVEETIRKC-AEISPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGYFTTKDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHVDLFLECFEDLI 1586
            V +   +   ++RY S+    KNV  ++ +    P+MKT VPGP+S E IK+LS  Q    + F  NYE S GNY+ DVD N MLDL+ QISSIP+GYNHP L  + +  + + + +NRP LG+ PP+++ + L+ SL+SV PKGL  V TM CGSC+ ENA K +F+  +  ERG    T EEL+SCM N+ PGCP  SILSF GGFHGRT+G L+ T SKAIHK+D+P F+WP A FP  KY LE+ ++ N +++  CLE VE+ I K   +   V G++VEP+ +EGGD H S++FF  LR+I RK   AF+VDEVQTG G TG FWAHE W +  P D+V+FSKK++ GG+F  +++ P APY+IFNTWLG+PSK LLL  VL  IK E L++   + G  LL GL + Q    + +S ARG GTFC+ID  + A R+K++ + RN+G +LGGCGD SIRFRP L  K  H  LFL  F D++
Sbjct:    3 VKKDFQEAACSVRYISQAAAKKNVDFEYDS----PLMKTEVPGPRSRELIKQLSTIQNSEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSIPIGYNHPALIKILQQPQNLSTFVNRPALGILPPENFTEKLEDSLLSVGPKGLRQVITMSCGSCSNENAFKLIFMWYRNKERGHTGVTKEELDSCMINQFPGCPDYSILSFMGGFHGRTMGCLATTHSKAIHKLDIPSFDWPIAPFPRLKYPLEQFVKENQDEEARCLEEVEDLIVKYRKKKKTVAGIVVEPIQSEGGDNHASDDFFRKLRDISRKHGCAFLVDEVQTGGGSTGKFWAHEHWGMDDPADVVSFSKKLMTGGFFHKEEFRPNAPYRIFNTWLGDPSKNLLLAEVLNVIKREALLSNAVQAGKALLDGLLDFQTRYPHLVSRARGRGTFCSIDTPSDAIRNKLILQARNKGIVLGGCGDKSIRFRPTLVFKEHHAHLFLNIFNDIL 485          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Xenopus
Match: abat (4-aminobutyrate aminotransferase [Source:NCBI gene;Acc:100158654])

HSP 1 Score: 488.419 bits (1256), Expect = 2.552e-168
Identity = 248/490 (50.61%), Postives = 329/490 (67.14%), Query Frame = 3
Query:  123 NIQVNRFIMQKTVNIRY-SKYFLTKNVSRQFSNEPPKPIMKTAVPGPKSMETIKKLSDFQMVNGIKFIANYENSIGNYIADVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKIDVPLFNWPQADFPIYKYDXXXXXXXXXXQDKICLEMVEETIRKC-AEISPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGYFTTKDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHVDLFLECFEDLI 1586
            N+Q N  ++   V  RY S+    KNV  ++ +    P+MKT VPGP+S E IK+LS  Q    + F  NYE S GNY+ DVD N MLDL+ QISSIP+GYNHP L  + +  + + + +NRP LG+ PP+++ + L+ SL+SV PKGL  V TM CGSC+ ENA K +F+  +  ERG    T EEL+SCM N+ PGCP  SILSF GGFHGRT+G L+ T SKAIHK+D+P F+WP A FP  KY LE+ ++ N +++  CLE VE+ I K   +   V G++VEP+ +EGGD H S++FF  LR+I RK   AF+VDEVQTG G TG FWAHE W +  P D+V+FSKK++ GG+F  +++ P APY+IFNTWLG+PSK LLL  VL  IK E L++   + G  LL GL + Q    + +S ARG GTFC+ID  + A R+K++ + RN+G +LGGCGD SIRFRP L  K  H  LFL  F D++
Sbjct:   13 NLQQNSRLLLPCV--RYISQAAAKKNVDFEYDS----PLMKTEVPGPRSRELIKQLSTIQNSEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSIPIGYNHPALIKILQQPQNLSTFVNRPALGILPPENFTEKLEDSLLSVGPKGLRQVITMSCGSCSNENAFKLIFMWYRNKERGHTGVTKEELDSCMINQFPGCPDYSILSFMGGFHGRTMGCLATTHSKAIHKLDIPSFDWPIAPFPRLKYPLEQFVKENQDEEARCLEEVEDLIVKYRKKKKTVAGIVVEPIQSEGGDNHASDDFFRKLRDISRKHGCAFLVDEVQTGGGSTGKFWAHEHWGMDDPADVVSFSKKLMTGGFFHKEEFRPNAPYRIFNTWLGDPSKNLLLAEVLNVIKREALLSNAVQAGKALLDGLLDFQTRYPHLVSRARGRGTFCSIDTPSDAIRNKLILQARNKGIVLGGCGDKSIRFRPTLVFKEHHAHLFLNIFNDIL 496          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Xenopus
Match: abat (4-aminobutyrate aminotransferase [Source:NCBI gene;Acc:100158654])

HSP 1 Score: 448.358 bits (1152), Expect = 1.067e-152
Identity = 238/494 (48.18%), Postives = 318/494 (64.37%), Query Frame = 3
Query:  123 NIQVNRFIMQKTVNIRY-SKYFLTKNVSRQFSNEPPKPIMKTAVPGPKSMETIKKLSDFQMVNGIKFIANYENSIGNYIADVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSV----APKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKIDVPLFNWPQADFPIYKYDXXXXXXXXXXQDKICLEMVEETIRKC-AEISPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGYFTTKDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHVDLFLECFEDLI 1586
            N+Q N  ++   V  RY S+    KNV  ++ +    P+MKT VPGP+S E IK+LS  Q    + F  NYE S GNY+ DVD N MLDL+ QISSIP+GYNHP L  + +  + + + +NRP LG+ PP+++ + L+ SL+SV     PK LT         C + + I  +       ERG    T EEL+SCM N+ PGCP  SILSF GGFHGRT+G L+ T SKAIHK+D+P F+WP A FP  KY LE+ ++ N +++  CLE VE+ I K   +   V G++VEP+ +EGGD H S++FF  LR+I RK   AF+VDEVQTG G TG FWAHE W +  P D+V+FSKK++ GG+F  +++ P APY+IFNTWLG+PSK LLL  VL  IK E L++   + G  LL GL + Q    + +S ARG GTFC+ID  + A R+K++ + RN+G +LGGCGD SIRFRP L  K  H  LFL  F D++
Sbjct:   13 NLQQNSRLLLPCV--RYISQAAAKKNVDFEYDS----PLMKTEVPGPRSRELIKQLSTIQNSEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSIPIGYNHPALIKILQQPQNLSTFVNRPALGILPPENFTEKLEDSLLSVNILGGPKQLT-------SKCLLFSDINII-----NKERGHTGVTKEELDSCMINQFPGCPDYSILSFMGGFHGRTMGCLATTHSKAIHKLDIPSFDWPIAPFPRLKYPLEQFVKENQDEEARCLEEVEDLIVKYRKKKKTVAGIVVEPIQSEGGDNHASDDFFRKLRDISRKHGCAFLVDEVQTGGGSTGKFWAHEHWGMDDPADVVSFSKKLMTGGFFHKEEFRPNAPYRIFNTWLGDPSKNLLLAEVLNVIKREALLSNAVQAGKALLDGLLDFQTRYPHLVSRARGRGTFCSIDTPSDAIRNKLILQARNKGIVLGGCGDKSIRFRPTLVFKEHHAHLFLNIFNDIL 488          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Xenopus
Match: abat (4-aminobutyrate aminotransferase [Source:NCBI gene;Acc:100158654])

HSP 1 Score: 443.736 bits (1140), Expect = 3.516e-151
Identity = 229/476 (48.11%), Postives = 306/476 (64.29%), Query Frame = 3
Query:  165 IRY-SKYFLTKNVSRQFSNEPPKPIMKTAVPGPKSMETIKKLSDFQMVNGIKFIANYENSIGNYIADVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKIDVPLFNWPQADFPIYKYDXXXXXXXXXXQDKICLEMVEETIRKC-AEISPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGYFTTKDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHVDLFLECFEDLI 1586
            +RY S+    KNV  ++ +    P+MKT VPGP+S E IK+LS  Q    + F  NYE S GNY+ DVD N MLDL+ QISSIP+GYNHP L  + +  + + + +NRP LG+ PP+++ + L+ SL+SV PKGL  V TM CGSC+ ENA K +F+  +   R                         ILSF GGFHGRT+G L+ T SKAIHK+D+P F+WP A FP  KY LE+ ++ N +++  CLE VE+ I K   +   V G++VEP+ +EGGD H S++FF  LR+I RK   AF+VDEVQTG G TG FWAHE W +  P D+V+FSKK++ GG+F  +++ P APY+IFNTWLG+PSK LLL  VL  IK E L++   + G  LL GL + Q    + +S ARG GTFC+ID  + A R+K++ + RN+G +LGGCGD SIRFRP L  K  H  LFL  F D++
Sbjct:   25 VRYISQAAAKKNVDFEYDS----PLMKTEVPGPRSRELIKQLSTIQNSEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSIPIGYNHPALIKILQQPQNLSTFVNRPALGILPPENFTEKLEDSLLSVGPKGLRQVITMSCGSCSNENAFKLIFMWYRVKSR------------------------FILSFMGGFHGRTMGCLATTHSKAIHKLDIPSFDWPIAPFPRLKYPLEQFVKENQDEEARCLEEVEDLIVKYRKKKKTVAGIVVEPIQSEGGDNHASDDFFRKLRDISRKHGCAFLVDEVQTGGGSTGKFWAHEHWGMDDPADVVSFSKKLMTGGFFHKEEFRPNAPYRIFNTWLGDPSKNLLLAEVLNVIKREALLSNAVQAGKALLDGLLDFQTRYPHLVSRARGRGTFCSIDTPSDAIRNKLILQARNKGIVLGGCGDKSIRFRPTLVFKEHHAHLFLNIFNDIL 472          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Xenopus
Match: abat (4-aminobutyrate aminotransferase [Source:NCBI gene;Acc:100158654])

HSP 1 Score: 441.425 bits (1134), Expect = 6.396e-150
Identity = 232/480 (48.33%), Postives = 312/480 (65.00%), Query Frame = 3
Query:  162 NIRY-SKYFLTKNVSRQFSNEPPKPIMKTAVPGPKSMETIKKLSDFQMVNGIKFIANYENSIGNYIADVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPP--GCPKNSILSFKGG-FHGRTLGALSLTRSKAIHKIDVPLFNWPQADFPIYKYDXXXXXXXXXXQDKICLEMVEETIRKC-AEISPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGYFTTKDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHVDLFLECFEDLI 1586
            ++RY S+    KNV  ++ +    P+MKT VPGP+S E IK+LS  Q    + F  NYE S GNY+ DVD N MLDL+ QISSIP+GYNHP L  + +  + + + +NRP LG+ PP+++ + L+ SL+SV PKGL  V TM CGSC+ ENA K +F+  +  ERG    T EEL+SCM N+     C   S L+     F     G L+ T SKAIHK+D+P F+WP A FP  KY LE+ ++ N +++  CLE VE+ I K   +   V G++VEP+ +EGGD H S++FF  LR+I RK   AF+VDEVQTG G TG FWAHE W +  P D+V+FSKK++ GG+F  +++ P APY+IFNTWLG+PSK LLL  VL  IK E L++   + G  LL GL + Q    + +S ARG GTFC+ID  + A R+K++ + RN+G +LGGCGD SIRFRP L  K  H  LFL  F D++
Sbjct:   19 SVRYISQAAAKKNVDFEYDS----PLMKTEVPGPRSRELIKQLSTIQNSEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSIPIGYNHPALIKILQQPQNLSTFVNRPALGILPPENFTEKLEDSLLSVGPKGLRQVITMSCGSCSNENAFKLIFMWYRNKERGHTGVTKEELDSCMINQVKLLVCLCASHLNMLSPYFMASISGCLATTHSKAIHKLDIPSFDWPIAPFPRLKYPLEQFVKENQDEEARCLEEVEDLIVKYRKKKKTVAGIVVEPIQSEGGDNHASDDFFRKLRDISRKHGCAFLVDEVQTGGGSTGKFWAHEHWGMDDPADVVSFSKKLMTGGFFHKEEFRPNAPYRIFNTWLGDPSKNLLLAEVLNVIKREALLSNAVQAGKALLDGLLDFQTRYPHLVSRARGRGTFCSIDTPSDAIRNKLILQARNKGIVLGGCGDKSIRFRPTLVFKEHHAHLFLNIFNDIL 494          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Mouse
Match: Abat (4-aminobutyrate aminotransferase [Source:MGI Symbol;Acc:MGI:2443582])

HSP 1 Score: 486.878 bits (1252), Expect = 9.772e-168
Identity = 237/453 (52.32%), Postives = 306/453 (67.55%), Query Frame = 3
Query:  231 PIMKTAVPGPKSMETIKKLSDFQMVNGIKFIANYENSIGNYIADVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKIDVPLFNWPQADFPIYKYDXXXXXXXXXXQDKICLEMVEETIRKC-AEISPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGYFTTKDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHVDLFLECFEDLI 1586
            P+MKT VPGP+S E +K+L+  Q    + F  NYE S GNY+ DVD N MLDL+ QISS+P+GYNHP L  + +  +   + INRP LG+ PP+++ D L+ SLMSVAP+G++ + TM CGSC+ ENA K +F+  +  ERG + F+ EELE+CM N+ PGCP  SILSF G FHGRT+G L+ T SKAIHKID+P F+WP A FP  KY LEE    N  ++  CLE VE+ I K   +   V G+IVEP+ +EGGD H S++FF  LR+I RK   AF+VDEVQTG G TG FWAHE W L  P D++TFSKKM+ GG+F  +++ P APY+IFNTWLG+PSK LLL  V+  IK EDL+N     G  LL GL ++Q      +S  RG GTFC+ D    A R+K++   RN+G +LGGCGD SIRFRP L  +  H  LFL  F  ++
Sbjct:   44 PLMKTEVPGPRSKELMKQLNTIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYNHPALAKLVQQPQNASTFINRPALGILPPENFVDKLQESLMSVAPRGMSQLITMACGSCSNENAFKTIFMWYRSKERGQRGFSKEELETCMVNQSPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPSFDWPIAPFPRLKYPLEEFTTDNQQEEARCLEEVEDLIVKYRKKKRTVAGIIVEPIQSEGGDNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPADVMTFSKKMMTGGFFHKEEFRPSAPYRIFNTWLGDPSKNLLLAEVINIIKREDLLNNVARVGKTLLTGLLDLQAQYPQFISRVRGRGTFCSFDTPDEAIRNKLILIARNKGVVLGGCGDKSIRFRPTLVFRDHHAHLFLSIFSGIL 496          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Mouse
Match: Abat (4-aminobutyrate aminotransferase [Source:MGI Symbol;Acc:MGI:2443582])

HSP 1 Score: 347.051 bits (889), Expect = 6.750e-114
Identity = 195/453 (43.05%), Postives = 257/453 (56.73%), Query Frame = 3
Query:  231 PIMKTAVPGPKSMETIKKLSDFQMVNGIKFIANYENSIGNYIADVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKIDVPLFNWPQADFPIYKYDXXXXXXXXXXQDKICLEMVEETIRKC-AEISPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGYFTTKDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHVDLFLECFEDLI 1586
            P+MKT VPGP+S E +K+L+  Q    + F  NYE S GNY+ DVD N MLDL+ QISS+P+GYNHP L  + +  +   + INRP LG+ PP+++ D L+ SLMSVAP+G++ + TM CGSC+ ENA K +F+  +  ERG + F+ EELE+CM N+ PGCP  SILSF G FHGRT+G L+ T SKAIHKID+P F+WP A FP  KY LEE    N  ++  CLE VE+ I K   +   V G+IVEP+ +EGGD H S++FF  LR+I RK    F               W  +             SK +LL               ++ N    E     LL  V +  KT             LL GL ++Q      +S  RG GTFC+ D    A R+K++   RN+G +LGGCGD SIRFRP L  +  H  LFL  F  ++
Sbjct:   44 PLMKTEVPGPRSKELMKQLNTIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYNHPALAKLVQQPQNASTFINRPALGILPPENFVDKLQESLMSVAPRGMSQLITMACGSCSNENAFKTIFMWYRSKERGQRGFSKEELETCMVNQSPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPSFDWPIAPFPRLKYPLEEFTTDNQQEEARCLEEVEDLIVKYRKKKRTVAGIIVEPIQSEGGDNHASDDFFRKLRDIARKPYRIF-------------NTWLGDP------------SKNLLLA--------------EVINIIKRED----LLNNVARVGKT-------------LLTGLLDLQAQYPQFISRVRGRGTFCSFDTPDEAIRNKLILIARNKGVVLGGCGDKSIRFRPTLVFRDHHAHLFLSIFSGIL 440          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Mouse
Match: Abat (4-aminobutyrate aminotransferase [Source:MGI Symbol;Acc:MGI:2443582])

HSP 1 Score: 204.142 bits (518), Expect = 1.105e-61
Identity = 99/210 (47.14%), Postives = 130/210 (61.90%), Query Frame = 3
Query:  231 PIMKTAVPGPKSMETIKKLSDFQMVNGIKFIANYENSIGNYIADVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKIDVPLFNWPQADFPIYKY 860
            P+MKT VPGP+S E +K+L+  Q    + F  NYE S                         GYNHP L  + +  +   + INRP LG+ PP+++ D L+ SLMSVAP+G++ + TM CGSC+ ENA K +F+  +  ERG + F+ EELE+CM N+ PGCP  SILSF G FHGRT+G L+ T SKAIHKID+P F+WP A FP  KY
Sbjct:   37 PLMKTEVPGPRSKELMKQLNTIQNAEAVHFFCNYEES------------------------RGYNHPALAKLVQQPQNASTFINRPALGILPPENFVDKLQESLMSVAPRGMSQLITMACGSCSNENAFKTIFMWYRSKERGQRGFSKEELETCMVNQSPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPSFDWPIAPFPRLKY 222          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Mouse
Match: Abat (4-aminobutyrate aminotransferase [Source:MGI Symbol;Acc:MGI:2443582])

HSP 1 Score: 154.451 bits (389), Expect = 2.681e-43
Identity = 69/134 (51.49%), Postives = 95/134 (70.90%), Query Frame = 3
Query:  231 PIMKTAVPGPKSMETIKKLSDFQMVNGIKFIANYENSIGNYIADVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFI 632
            P+MKT VPGP+S E +K+L+  Q    + F  NYE S GNY+ DVD N MLDL+ QISS+P+GYNHP L  + +  +   + INRP LG+ PP+++ D L+ SLMSVAP+G++ + TM CGSC+ ENA K +F+
Sbjct:   44 PLMKTEVPGPRSKELMKQLNTIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYNHPALAKLVQQPQNASTFINRPALGILPPENFVDKLQESLMSVAPRGMSQLITMACGSCSNENAFKTIFM 177          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Mouse
Match: Abat (4-aminobutyrate aminotransferase [Source:MGI Symbol;Acc:MGI:2443582])

HSP 1 Score: 82.0333 bits (201), Expect = 2.188e-18
Identity = 35/72 (48.61%), Postives = 51/72 (70.83%), Query Frame = 3
Query:  417 GYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFI 632
            GYNHP L  + +  +   + INRP LG+ PP+++ D L+ SLMSVAP+G++ + TM CGSC+ ENA K +F+
Sbjct:   11 GYNHPALAKLVQQPQNASTFINRPALGILPPENFVDKLQESLMSVAPRGMSQLITMACGSCSNENAFKTIFM 82          
BLAST of 4-aminobutyrate aminotransferase vs. UniProt/SwissProt
Match: sp|P61922|GABT_MOUSE (4-aminobutyrate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Abat PE=1 SV=1)

HSP 1 Score: 486.878 bits (1252), Expect = 6.835e-167
Identity = 237/453 (52.32%), Postives = 306/453 (67.55%), Query Frame = 3
Query:  231 PIMKTAVPGPKSMETIKKLSDFQMVNGIKFIANYENSIGNYIADVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKIDVPLFNWPQADFPIYKYDXXXXXXXXXXQDKICLEMVEETIRKC-AEISPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGYFTTKDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHVDLFLECFEDLI 1586
            P+MKT VPGP+S E +K+L+  Q    + F  NYE S GNY+ DVD N MLDL+ QISS+P+GYNHP L  + +  +   + INRP LG+ PP+++ D L+ SLMSVAP+G++ + TM CGSC+ ENA K +F+  +  ERG + F+ EELE+CM N+ PGCP  SILSF G FHGRT+G L+ T SKAIHKID+P F+WP A FP  KY LEE    N  ++  CLE VE+ I K   +   V G+IVEP+ +EGGD H S++FF  LR+I RK   AF+VDEVQTG G TG FWAHE W L  P D++TFSKKM+ GG+F  +++ P APY+IFNTWLG+PSK LLL  V+  IK EDL+N     G  LL GL ++Q      +S  RG GTFC+ D    A R+K++   RN+G +LGGCGD SIRFRP L  +  H  LFL  F  ++
Sbjct:   44 PLMKTEVPGPRSKELMKQLNTIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYNHPALAKLVQQPQNASTFINRPALGILPPENFVDKLQESLMSVAPRGMSQLITMACGSCSNENAFKTIFMWYRSKERGQRGFSKEELETCMVNQSPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPSFDWPIAPFPRLKYPLEEFTTDNQQEEARCLEEVEDLIVKYRKKKRTVAGIIVEPIQSEGGDNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPADVMTFSKKMMTGGFFHKEEFRPSAPYRIFNTWLGDPSKNLLLAEVINIIKREDLLNNVARVGKTLLTGLLDLQAQYPQFISRVRGRGTFCSFDTPDEAIRNKLILIARNKGVVLGGCGDKSIRFRPTLVFRDHHAHLFLSIFSGIL 496          
BLAST of 4-aminobutyrate aminotransferase vs. UniProt/SwissProt
Match: sp|P50554|GABT_RAT (4-aminobutyrate aminotransferase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Abat PE=1 SV=3)

HSP 1 Score: 486.493 bits (1251), Expect = 8.874e-167
Identity = 240/472 (50.85%), Postives = 311/472 (65.89%), Query Frame = 3
Query:  174 SKYFLTKNVSRQFSNEPPKPIMKTAVPGPKSMETIKKLSDFQMVNGIKFIANYENSIGNYIADVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKIDVPLFNWPQADFPIYKYDXXXXXXXXXXQDKICLEMVEETIRKC-AEISPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGYFTTKDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHVDLFLECFEDLI 1586
            S+Y         F  +   P+MKT VPGP+S E +K+L+  Q    + F  NYE S GNY+ DVD N MLDL+ QISS+P+GYNHP L  + +  +   + INRP LG+ PP+++ D L+ SLMSVAPKG+  + TM CGSC+ ENA K +F+  +  ERG + F+ EELE+CM N+ PGCP  SILSF G FHGRT+G L+ T SKAIHKID+P F+WP A FP  KY LEE +  N  ++  CLE VE+ I K   +   V G+IVEP+ +EGGD H S++FF  LR+I RK   AF+VDEVQTG G TG FWAHE W L  P D+++FSKKM+ GG+F  +++ P APY+IFNTWLG+PSK LLL  V+  IK EDL+N     G  LL GL ++Q      +S  RG GTFC+ D    A R+K++   RN+G +LGGCGD SIRFRP L  +  H  LFL  F  ++
Sbjct:   25 SRYISQAAAKVDFEFDYDGPLMKTEVPGPRSQELMKQLNTIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYNHPALAKLVQQPQNASTFINRPALGILPPENFVDKLRESLMSVAPKGMCQLITMACGSCSNENAFKTIFMWYRSKERGQRGFSKEELETCMVNQSPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPSFDWPIAPFPRLKYPLEEFVTDNQQEEARCLEEVEDLIVKYRKKKRTVAGIIVEPIQSEGGDNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPADVMSFSKKMMTGGFFHKEEFRPSAPYRIFNTWLGDPSKNLLLAEVINIIKREDLLNNVAHAGKTLLTGLLDLQAQYPQFVSRVRGRGTFCSFDTPDEAIRNKLILIARNKGVVLGGCGDKSIRFRPTLVFRDHHAHLFLNIFSGIL 496          
BLAST of 4-aminobutyrate aminotransferase vs. UniProt/SwissProt
Match: sp|P80147|GABT_PIG (4-aminobutyrate aminotransferase, mitochondrial OS=Sus scrofa OX=9823 GN=ABAT PE=1 SV=2)

HSP 1 Score: 483.797 bits (1244), Expect = 8.427e-166
Identity = 235/453 (51.88%), Postives = 309/453 (68.21%), Query Frame = 3
Query:  231 PIMKTAVPGPKSMETIKKLSDFQMVNGIKFIANYENSIGNYIADVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKIDVPLFNWPQADFPIYKYDXXXXXXXXXXQDKICLEMVEETIRKC-AEISPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGYFTTKDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHVDLFLECFEDLI 1586
            P+MKT VPGP+S E +K+L+  Q    + F  NYE S GNY+ DVD N MLDL+ QISSIP+GY+HP L  + +  + + + INRP LG+ PP+++ + L+ SL+SVAPKG++ + TM CGSC+ ENA K +F+  +  ERG   F+ EELE+CM N+ PGCP  SILSF G FHGRT+G L+ T SKAIHKID+P F+WP A FP  KY LEE ++ N  ++  CLE VE+ I K   +   V G+IVEP+ +EGGD H S++FF  LR+I RK   AF+VDEVQTG G TG FWAHE W L  P D++TFSKKM+ GG+F  +++ P APY+IFNTWLG+PSK LLL  V+  IK EDL++     G  LL GL ++Q      +S  RG GTFC+ D    + R+K++   RN+G +LGGCGD SIRFRP L  +  H  LFL  F D++
Sbjct:   44 PLMKTEVPGPRSRELMKQLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSIPIGYSHPALVKLVQQPQNVSTFINRPALGILPPENFVEKLRESLLSVAPKGMSQLITMACGSCSNENAFKTIFMWYRSKERGQSAFSKEELETCMINQAPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPSFDWPIAPFPRLKYPLEEFVKENQQEEARCLEEVEDLIVKYRKKKKTVAGIIVEPIQSEGGDNHASDDFFRKLRDISRKHGCAFLVDEVQTGGGSTGKFWAHEHWGLDDPADVMTFSKKMMTGGFFHKEEFRPNAPYRIFNTWLGDPSKNLLLAEVINIIKREDLLSNAAHAGKVLLTGLLDLQARYPQFISRVRGRGTFCSFDTPDESIRNKLISIARNKGVMLGGCGDKSIRFRPTLVFRDHHAHLFLNIFSDIL 496          
BLAST of 4-aminobutyrate aminotransferase vs. UniProt/SwissProt
Match: sp|P80404|GABT_HUMAN (4-aminobutyrate aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=ABAT PE=1 SV=3)

HSP 1 Score: 481.871 bits (1239), Expect = 5.837e-165
Identity = 234/453 (51.66%), Postives = 309/453 (68.21%), Query Frame = 3
Query:  231 PIMKTAVPGPKSMETIKKLSDFQMVNGIKFIANYENSIGNYIADVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKIDVPLFNWPQADFPIYKYDXXXXXXXXXXQDKICLEMVEETIRKC-AEISPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGYFTTKDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHVDLFLECFEDLI 1586
            P+MKT VPGP+S E +K+L+  Q    + F  NYE S GNY+ DVD N MLDL+ QISS+P+GY+HP L  + +  +     +NRP LG+ PP+++ + L+ SL+SVAPKG++ + TM CGSC+ ENA+K +F+  +  ERG + F+ EELE+CM N+ PGCP  SILSF G FHGRT+G L+ T SKAIHKID+P F+WP A FP  KY LEE ++ N  ++  CLE VE+ I K   +   V G+IVEP+ +EGGD H S++FF  LR+I RK   AF+VDEVQTG G TG FWAHE W L  P D++TFSKKM+ GG+F  +++ P APY+IFNTWLG+PSK LLL  V+  IK EDL+N     G  LL GL ++Q      +S  RG GTFC+ D    + R+K++   RN+G +LGGCGD SIRFRP L  +  H  LFL  F D++
Sbjct:   44 PLMKTEVPGPRSQELMKQLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYSHPALLKLIQQPQNASMFVNRPALGILPPENFVEKLRQSLLSVAPKGMSQLITMACGSCSNENALKTIFMWYRSKERGQRGFSQEELETCMINQAPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPSFDWPIAPFPRLKYPLEEFVKENQQEEARCLEEVEDLIVKYRKKKKTVAGIIVEPIQSEGGDNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPADVMTFSKKMMTGGFFHKEEFRPNAPYRIFNTWLGDPSKNLLLAEVINIIKREDLLNNAAHAGKALLTGLLDLQARYPQFISRVRGRGTFCSFDTPDDSIRNKLILIARNKGVVLGGCGDKSIRFRPTLVFRDHHAHLFLNIFSDIL 496          
BLAST of 4-aminobutyrate aminotransferase vs. UniProt/SwissProt
Match: sp|Q55FI1|GABT_DICDI (4-aminobutyrate aminotransferase OS=Dictyostelium discoideum OX=44689 GN=gabT PE=3 SV=1)

HSP 1 Score: 479.559 bits (1233), Expect = 4.481e-164
Identity = 239/473 (50.53%), Postives = 312/473 (65.96%), Query Frame = 3
Query:  171 YSKYFLTKNVSRQFSNEPPKPIMKTAVPGPKSMETIKKLSDFQMVNGIKFIANYENSIGNYIADVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKIDVPLFNWPQADFPIYKYDXXXXXXXXXXQDKICLEMVEETIRKCAEISPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGYFTTKDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHVDLFLECFEDLIK 1589
            +SK  +    +  F  E  +PI+KT +PGP+S   I++L+  Q      F A+Y NS GNYI+DVD N++LDL+CQI+SIP+GYN+P L   AKSD ++ + INRP LG+ PPKD+  L+++S M V+PKGL  V T MCGSCA E A KAVF+  + ++RGGK FT EEL SCMKN+ PG P  SILSFK GFHGRT G LS TRSKAIHK+D+P F+WP A FP  KY L E+ + N   +  CL+ VE+ I+      PV G+IVEP+ AEGGD + +  FF  LR+I +K  ++ IVDEVQTG G TG FWAHE WNL  PPDIVTFSKKM   G++   DY P   Y+ FNTW+G+P + L LE V+  IK   L++    TGN+L  GL ++       + N RG GTF AID  T A RD+++  +R  G  +GGCG+ SIRFRP L  +  H++ FL  F+  +K
Sbjct:   20 FSKSSIPTTPTPDFPGEYKEPIVKTQIPGPQSKALIERLNKLQDPRAAHFFADYANSRGNYISDVDGNILLDLYCQIASIPIGYNNPELIKAAKSDRWVSAIINRPSLGVLPPKDWPALIENSFMQVSPKGLNQVFTAMCGSCANECAYKAVFMHYQHVKRGGKPFTPEELSSCMKNQEPGSPSLSILSFKKGFHGRTFGTLSTTRSKAIHKLDIPAFDWPAATFPDLKYPLAEHAKENREIEDRCLQEVEQLIKTWH--IPVAGIIVEPIQAEGGDNYATPYFFQGLRDITKKHGVSMIVDEVQTGMGATGKFWAHEHWNLTSPPDIVTFSKKMQAAGFYHNLDYRPSESYRNFNTWMGDPVRALELEVVIGEIKKNHLLDNVVITGNYLKDGLFDIAARYPGLIQNIRGEGTFLAIDFPTPAERDRVISHIRLLGVEMGGCGERSIRFRPMLVCQPSHINQFLNRFDQTMK 490          
BLAST of 4-aminobutyrate aminotransferase vs. TrEMBL
Match: A0A267FLE5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig019532g3 PE=3 SV=1)

HSP 1 Score: 517.694 bits (1332), Expect = 1.120e-176
Identity = 245/458 (53.49%), Postives = 327/458 (71.40%), Query Frame = 3
Query:  219 EPPKPIMKT-AVPGPKSMETIKKLSDFQMVNGIKFIANYENSIGNYIADVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKIDVPLFNWPQADFPIYKYDXXXXXXXXXXQDKICLEMVEETIRKCAEISPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGYFTTKDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHVDLFLECFEDLIK 1589
            EP  P ++T +VPGP+S + +++ +  Q+ +GI F A+Y  S GNYI DVD N +LD+F QISS+P GYNHP L+ VA+S EF+  +INRP LG+ PP D+ D L +SL+SVAPKGL+ VQTMMCGSCA ENAIK +F+R    +R G+  + +EL+S M NEPPG P+ SILSFK  FHGRTLG LS TRSKAIHK+DVP F WP  DFP YKY LE++ E+N  Q+K+ L  VEET+ +     PV G+IVEP+LAEGGDIH    +F +LR +C K  +  +VDEVQTG G  GT+WAHE+W L  PPD VTFSK+ LLGG + + + +P   Y+++NTWLGEPSKV+LLEAV++TIK E L++   E G  L KGL+ + +     +++ RG G  CA+D   + +R++ ++ LRN+GF  GGCG+V +RFRPAL  K +H  LFLE F+ ++K
Sbjct:   35 EPAGPSIRTDSVPGPRSKQLMEEANKKQLPHGIYFFADYSKSSGNYIVDVDGNTLLDMFMQISSLPFGYNHPALQKVAQSKEFLEMSINRPALGVCPPSDWVDRLNASLLSVAPKGLSRVQTMMCGSCANENAIKMLFMRYMAKQRAGRPVSQQELDSTMLNEPPGTPRLSILSFKRSFHGRTLGVLSCTRSKAIHKLDVPAFQWPAVDFPAYKYPLEQHQEHNAKQEKLSLVQVEETVNRQRATEPVAGLIVEPILAEGGDIHARPEYFKALRSLCSKLDVPLLVDEVQTGGGLCGTYWAHEQWGLDSPPDAVTFSKRTLLGGIYFSDNLVPDQQYRVYNTWLGEPSKVMLLEAVIRTIKEEKLMDSVLEAGTALTKGLEGLSQRYPQLINSPRGLGIMCAVDFADTNSRNEAVQRLRNKGFHTGGCGEVGLRFRPALIFKEKHAKLFLETFDSVLK 492          
BLAST of 4-aminobutyrate aminotransferase vs. TrEMBL
Match: A0A1I8HWU1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig019532g2 PE=3 SV=1)

HSP 1 Score: 517.309 bits (1331), Expect = 1.487e-176
Identity = 245/458 (53.49%), Postives = 326/458 (71.18%), Query Frame = 3
Query:  219 EPPKPIMKT-AVPGPKSMETIKKLSDFQMVNGIKFIANYENSIGNYIADVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKIDVPLFNWPQADFPIYKYDXXXXXXXXXXQDKICLEMVEETIRKCAEISPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGYFTTKDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHVDLFLECFEDLIK 1589
            EP  P ++T +VPGP+S + +++ +  Q+ +GI F A+Y  S GNYI DVD N +LD+F QISS+P GYNHP L+ VAKS EF+  +INRP LG+ PP D+ D L +SL+SVAPKGL+ VQTMMCGSCA ENAIK +F+R    +R G+  + +EL+S M NEPPG P+ SILSFK  FHGRTLG LS TRSKAIHK+DVP F WP  DFP YKY LE++ E+N  Q+K+ L  VEET+ +     PV G+IVEP+LAEGGDIH    +F +LR +C K  +  +VDEVQTG G  GT+WAHE+W L  PPD VTFSK+ LLGG + + + +P   Y+++NTWLGEPSKV+LLEAV++TIK E L++   E G  L KGL+ + +     +++ RG G  CA+D   + +R++ ++ LRN+G   GGCG+V +RFRPAL  K +H  LFLE F+ ++K
Sbjct:   35 EPAGPSIRTDSVPGPRSKQLMEEANKKQLPHGIYFFADYSKSSGNYIVDVDGNTLLDMFMQISSLPFGYNHPALQKVAKSKEFLEMSINRPALGVCPPSDWVDRLNASLLSVAPKGLSRVQTMMCGSCANENAIKMLFMRYMAKQRAGRPVSQQELDSTMLNEPPGTPRLSILSFKRSFHGRTLGVLSCTRSKAIHKLDVPAFQWPAVDFPAYKYPLEQHQEHNAKQEKLSLAQVEETVNRQRATEPVAGLIVEPILAEGGDIHARPEYFRALRSLCSKLDVPLLVDEVQTGGGLCGTYWAHEQWGLDSPPDAVTFSKRTLLGGIYFSDNLVPDQQYRVYNTWLGEPSKVMLLEAVIRTIKEEKLMDSVLEAGTALTKGLEGLSQRYPQLINSPRGLGIMCAVDFADTNSRNEAVQRLRNKGIHTGGCGEVGLRFRPALIFKEKHAKLFLETFDSVLK 492          
BLAST of 4-aminobutyrate aminotransferase vs. TrEMBL
Match: A0A1D2NLF3 (4-aminobutyrate aminotransferase, mitochondrial OS=Orchesella cincta OX=48709 GN=Ocin01_00572 PE=3 SV=1)

HSP 1 Score: 501.901 bits (1291), Expect = 1.592e-170
Identity = 243/472 (51.48%), Postives = 329/472 (69.70%), Query Frame = 3
Query:  195 NVSRQFSN------EPPKPIMKTAVPGPKSMETIKKLSDFQMVNGIKFIANYENSIGNYIADVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKIDVPLFNWPQADFPIYKYDXXXXXXXXXXQDKICLEMVEETIRKCAEIS-PVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGYFTTKDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHVDLFLECFEDLIK 1589
            +V+R  S+      EP  P +KTAVPGP S + +++L+  Q    ++  A+Y+ SIGNY+ DVD N+ LD++ QISSIPLGYN+P+L ++      + + INRP LG+FP KD+   LKSSL+ VAPKG+ H+ TM CGSC+ ENA KA+F   +  +RGGK+F+  ++ESCM N+ PG P  +IL+F G FHGRTL AL+ T SK IHKIDVP F+WP A FP YKY LE+N+  N  +DK CL  V+E I + ++   PV G+IVEP+ AEGGD HGS  FF  L+ + +   +A ++DEVQTG GPTGT W HE++NL  PPDIVTFSKKM  GG+F T ++ P   Y+IFNTW+GEPSK+ +++ +L  IK ++L+   K+TGN LL  LKN Q    N L++ARG GTFCAIDCT++  RDK++ ELRN+G   GGCGD +IRFRP L  +  H ++F + FE ++K
Sbjct:   19 SVARHMSSSTIIKGEPSGPSIKTAVPGPASKKLMQELAALQQSGSVQIFADYDKSIGNYLVDVDGNVFLDIYTQISSIPLGYNNPDLLNLFNDPHHVKTLINRPALGVFPGKDWVSELKSSLLEVAPKGVNHIMTMACGSCSNENAFKAIFFWYRKRQRGGKDFSPADIESCMVNQSPGSPPLAILAFDGAFHGRTLAALTCTHSKPIHKIDVPAFDWPVAQFPRYKYPLEDNVRENKEEDKRCLADVQEKIEQWSKKGVPVAGIIVEPIQAEGGDHHGSPEFFQGLQALAKSSGVALLIDEVQTGGGPTGTMWCHEQFNLPQPPDIVTFSKKMQTGGFFHTPEFKPDQGYRIFNTWMGEPSKIQVVKKILDVIKRDNLLENAKQTGNLLLSELKNFQNKYPNILNSARGRGTFCAIDCTSTEVRDKIVNELRNQGVQSGGCGDKAIRFRPTLVFQPHHANIFFDKFESVLK 490          
BLAST of 4-aminobutyrate aminotransferase vs. TrEMBL
Match: A0A077Z5K2 (4 aminobutyrate aminotransferase, mitochondrial OS=Trichuris trichiura OX=36087 GN=TTRE_0000369301 PE=3 SV=1)

HSP 1 Score: 499.975 bits (1286), Expect = 4.497e-170
Identity = 250/464 (53.88%), Postives = 320/464 (68.97%), Query Frame = 3
Query:  198 VSRQFSNEPPKPIMKTAVPGPKSMETIKKLSDFQMVNGIKFIANYENSIGNYIADVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKIDVPLFNWPQADFPIYKYDXXXXXXXXXXQDKICLEMVEETIRKCAEIS-PVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGYFTTKDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHVDLFLECFEDLI 1586
            V+  F NEP  P MKT++PGPKS     +LS  Q    ++F A+YE SIGNYIADVD NL+LD + QISSIP+GYNHP+L  + ++       +NRP LG+FPP DY   ++ SL+SVAP+G+ +V TMMCGSC+ ENA K  FI  +  +R GKE T EELESCM+N+PPG P  +ILSFKG FHGRT   LS T SKAIHK+D P  NWP+A +P YKY LEE+ ++N ++D+ CL  VE  I    +    V GVIVEPV AEGGD   SN+FF +L+ I +K   A IVDEVQTGCG TG  WAH  WNL  PP+IVTFSKKMLLGGY+   D      Y+IF+TW+G+PSK++LLE VLK IK ++LI  T+ TG  LL  LK ++K     L++ARG GTFCA+ C   + R+K++ ++R RG  LGGCG+ SIRFRPAL  +  HV+  +  FED++
Sbjct:    3 VASSFPNEPSAPAMKTSIPGPKSESMRAELSQIQNAETVQFFADYEKSIGNYIADVDGNLLLDAYTQISSIPIGYNHPDLLKITQNKSNQTLFVNRPALGVFPPSDYAKRIRESLLSVAPQGMHNVMTMMCGSCSNENAFKTAFIWYRTKQREGKEPTQEELESCMENKPPGSPPLTILSFKGSFHGRTYACLSTTHSKAIHKVDFPALNWPKASYPRYKYPLEEHSDFNASEDRNCLAEVENEIYTWNKKGCHVAGVIVEPVQAEGGDHWASNSFFRNLQNIVKKYGTALIVDEVQTGCGVTGKMWAHSHWNLPQPPEIVTFSKKMLLGGYYYKSDLHVKQGYRIFDTWMGDPSKLVLLEGVLKAIKRDNLIENTQNTGALLLGELKRLEKKYPAFLNSARGLGTFCAVTCCDVSTRNKIITQIRQRGVNLGGCGEQSIRFRPALIFQPHHVEAIISRFEDVL 466          
BLAST of 4-aminobutyrate aminotransferase vs. TrEMBL
Match: A0A3B3TFY6 (4-aminobutyrate aminotransferase OS=Paramormyrops kingsleyae OX=1676925 GN=ABAT PE=3 SV=1)

HSP 1 Score: 500.745 bits (1288), Expect = 7.081e-170
Identity = 245/456 (53.73%), Postives = 313/456 (68.64%), Query Frame = 3
Query:  231 PIMKTAVPGPKSMETIKKLSDFQMVNGIKFIANYENSIGNYIADVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKIDVPLFNWPQADFPIYKYDXXXXXXXXXXQDKICLEMVEETIRKCAEIS-PVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGYFTTKDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHVDLFLECFEDLIKRN 1595
            P MK+ VPGP+S E +++L + Q V  + F  NYE S GNY+ DVD N MLDL+ QISSIP+GYNHP L  V  S   + + +NRP LG+ PP+++ D L  SL+SVAP+G+ HVQTM CGSC+ ENA K++FI  +  ERG K  T EE+ SCM N+ PGCP  SILSF GGFHGRT+G L+ T SKAIHK+DVP F+WP A FP  +Y LEE +  N  ++  CLE VE+ I K  +    V G+++EP+ AEGGD H S +FF  LR I RK   AF VDEVQTGCGPTG FWAHE W+L  P D+V+FSKKML GG+F   + +P  PY+IFNTW+G+PSK + L AVL  IKTE L+ E   +G  LL GL  +Q    + L+ ARG GTFCAID      RD +++++R++G +LGGCGD SIRFRP+L  K  HV LFL  F D++  +
Sbjct:   44 PSMKSKVPGPRSKELMRQLGEIQNVGAVHFFCNYEESRGNYLVDVDGNRMLDLYTQISSIPIGYNHPALMKVMSSPHNLSTFVNRPALGILPPENFPDRLNESLLSVAPRGMRHVQTMSCGSCSNENAFKSIFIWHRNKERGHKTPTQEEMTSCMVNQGPGCPDLSILSFMGGFHGRTMGCLATTHSKAIHKLDVPSFDWPIAPFPKLRYPLEEFVRENGQEEARCLEEVEDLIVKWRQKGKTVAGIVIEPIQAEGGDNHASPDFFKKLRNIARKHGCAFQVDEVQTGCGPTGKFWAHEHWDLDEPVDVVSFSKKMLTGGFFFRDELMPDKPYRIFNTWMGDPSKNVFLSAVLNVIKTERLLGEVTRSGAALLHGLIELQTQYPHLLNAARGLGTFCAIDACDDKTRDALIQKVRDKGVILGGCGDKSIRFRPSLVFKEYHVHLFLNIFNDVLAEH 499          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Cavefish
Match: abat (4-aminobutyrate aminotransferase [Source:NCBI gene;Acc:103041441])

HSP 1 Score: 476.863 bits (1226), Expect = 6.509e-164
Identity = 239/470 (50.85%), Postives = 307/470 (65.32%), Query Frame = 3
Query:  183 FLTKNVSRQFSN-EPPKPIMKTAVPGPKSMETIKKLSDFQMVNGIKFIANYENSIGNYIADVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKIDVPLFNWPQADFPIYKYDXXXXXXXXXXQDKICLEMVEETIRKCAEIS-PVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGYFTTKDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHVDLFLECFEDLI 1586
            +++K  ++  S  E   P MKT VPGPKS E  ++L + Q V  + F  NYE S GNY+ D D N MLDL+ QISS+P+GYNHP L     +   + + +NRP LG+ PP+++ + L  SL+S+AP G+T VQTM CGSC+ ENA KA+FI  K  ERG    + +E+ SCM N+ PGCP  SILSF GGFHGRTLG L+ T SK IHK+D+P F+WP A FP  +Y LEE +  N  ++  CLE VE+ I K  +   PV G++VEP+ AEGGD H S +FF  LR I RK   AF VDEVQTG G TG FWAHE W    P DIV+FSKKML GGY+   + +P   Y+IFNTW+G+PSK + L  VL  I+ E+L++E   +G  LL+GL  +Q    + LS ARG GTFCA+D      RD +L + R++G LLGGCGD SIRFRPAL  K  H   FL  F D++
Sbjct:   27 YVSKTAAKPVSEFEYDAPSMKTPVPGPKSKELTRQLGEIQNVGAVNFFCNYEESRGNYLVDADGNRMLDLYTQISSVPIGYNHPALMKAVTNPIHLSAFVNRPALGILPPENFPEKLVESLLSIAPTGMTRVQTMACGSCSNENAYKAMFIWYKNKERGTNSPSADEVSSCMINQGPGCPDLSILSFMGGFHGRTLGCLATTHSKVIHKLDIPSFDWPIASFPRLQYPLEEFVRENAQEEARCLEEVEDLIVKWRQKGKPVAGIVVEPIQAEGGDNHASPDFFIKLRNIARKHGCAFHVDEVQTGGGTTGKFWAHEHWGTDDPADIVSFSKKMLTGGYYHKDELVPDKGYRIFNTWMGDPSKNVFLTEVLNVIRRENLLDEVTRSGKVLLQGLYELQAQYPHILSRARGQGTFCAVDARDDVTRDNLLLKTRDKGVLLGGCGDRSIRFRPALVFKEYHAHQFLNIFNDVL 496          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Cavefish
Match: abat (4-aminobutyrate aminotransferase [Source:NCBI gene;Acc:103041441])

HSP 1 Score: 442.965 bits (1138), Expect = 9.575e-151
Identity = 231/477 (48.43%), Postives = 300/477 (62.89%), Query Frame = 3
Query:  183 FLTKNVSRQFSN-EPPKPIMKTAVPGPKSMETIKKLSDFQMVNGIKFIANYENSIGNYIADVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKN-------EPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKIDVPLFNWPQADFPIYKYDXXXXXXXXXXQDKICLEMVEETIRKCAEIS-PVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGYFTTKDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHVDLFLECFEDLI 1586
            +++K  ++  S  E   P MKT VPGPKS          + V  + F  NYE S GNY+ D D N MLDL+ QISS+P+GYNHP L     +   + + +NRP LG+ PP+++ + L  SL+S+AP G+T VQTM CGSC+ ENA KA+FI  K   +G    +  +L + M++       + PGCP  SILSF GGFHGRTLG L+ T SK IHK+D+P F+WP A FP  +Y LEE +  N  ++  CLE VE+ I K  +   PV G++VEP+ AEGGD H S +FF  LR I RK   AF VDEVQTG G TG FWAHE W    P DIV+FSKKML GGY+   + +P   Y+IFNTW+G+PSK + L  VL  I+ E+L++E   +G  LL+GL  +Q    + LS ARG GTFCA+D      RD +L + R++G LLGGCGD SIRFRPAL  K  H   FL  F D++
Sbjct:   27 YVSKTAAKPVSEFEYDAPSMKTPVPGPKS----------KNVGAVNFFCNYEESRGNYLVDADGNRMLDLYTQISSVPIGYNHPALMKAVTNPIHLSAFVNRPALGILPPENFPEKLVESLLSIAPTGMTRVQTMACGSCSNENAYKAMFIWYK--VKGNVGLSRRKLRTHMRHPHYIVFLQGPGCPDLSILSFMGGFHGRTLGCLATTHSKVIHKLDIPSFDWPIASFPRLQYPLEEFVRENAQEEARCLEEVEDLIVKWRQKGKPVAGIVVEPIQAEGGDNHASPDFFIKLRNIARKHGCAFHVDEVQTGGGTTGKFWAHEHWGTDDPADIVSFSKKMLTGGYYHKDELVPDKGYRIFNTWMGDPSKNVFLTEVLNVIRRENLLDEVTRSGKVLLQGLYELQAQYPHILSRARGQGTFCAVDARDDVTRDNLLLKTRDKGVLLGGCGDRSIRFRPALVFKEYHAHQFLNIFNDVL 491          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Cavefish
Match: agxt2 (alanine--glyoxylate aminotransferase 2 [Source:ZFIN;Acc:ZDB-GENE-050913-100])

HSP 1 Score: 76.2554 bits (186), Expect = 2.722e-14
Identity = 93/444 (20.95%), Postives = 175/444 (39.41%), Query Frame = 3
Query:  381 LDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKIDVPLFNWPQADFPIYKYDXXXXXXXXXXQDKICLEMVEETIRKCAEISP------------------------VCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGT-FWAHEKWNLCYPPDIVTFSKKM----LLGGYFTTKDYI-PIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTS---------AARDKMLEELRNRGFLLGGCG--DVSIRFRPALTLKIRHVDLFLECFEDLIK 1589
            LDLF  ++++ +G+ +P +   A                    K  + L  ++ + + P+   + + +   +  +   +K V++   G E         +L   M     G   + +++ +G +HG +  A+ LT + A        + +P A        +  ++         C +   +TIR+C+  SP                        +     EP+   GG +    +F     ++ R+K    I DEVQTG G TG+ FW  +  ++   PDIVT +K +     +G   TT++     A    FNT+ G P    +  +VL TI  + L       G +LL  L  ++      + + RG G    ++  T           A  ++ E++++ G L+G  G    + R +P + +    VD FL  F+  ++
Sbjct:  137 LDLFAGVATVSVGHCNPRVTEAAV-------------------KQLEHLWHTTAIYIHPQIQEYAEKL---ASLLPEPLKVVYLTNSGSEA-------NDLAMLMARVHTG--NHDVITLRGSYHGGSPLAIGLTSNAA--------YKYPVASGFGCHNTMCPDVFRGVWGGNQCRDSPVQTIRECS-CSPGHCQANGRYIEQMKEMFATTVPNRIAAFFGEPIQGVGGAVQYPKSFLKDTYKLVREKGGICIADEVQTGFGRTGSHFWGFQAHDVM--PDIVTMAKGIGNGFPMGAVVTTEEIAGSFAKGVHFNTFGGNPVACAIGSSVLDTIAEDGLQENCAVVGTYLLTELAKLRD-KHEIVGDVRGKGLMIGVEMVTDKVSRVPLPKEAMAEIFEDVKDMGVLIGTGGLYGQTFRIKPPMCITKEDVDFFLAVFDQALQ 537          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Cavefish
Match: phykpl (5-phosphohydroxy-L-lysine phospho-lyase-like [Source:NCBI gene;Acc:103047782])

HSP 1 Score: 69.707 bits (169), Expect = 2.464e-12
Identity = 64/245 (26.12%), Postives = 102/245 (41.63%), Query Frame = 3
Query:  957 VCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGT-FWAHEKWNLCYPPDIVTFSKKM-------------LLGGYFTTKDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCA-------IDCTTSAARDKML-EELRNRGFLLGGCG--DVSIRFRPALTLKIRHVDLFLECFEDLIKRN*KHLSIFK 1619
            +    VE + + GG I     +F  + E  R     F+ DE+QTG G  G+ +WA +     + PDIVT  K M              + G FT          + FNT+ G P    +  AVL  I+ EDL       GNHL   LK +Q +    + + RG+G F         +D T +     +L   ++ +   L   G  +  ++F+P +  ++   +   E   DL+ R  +  S+ K
Sbjct:  182 ISSFFVESLPSVGGQIIFPRGYFTKVAEYVRAAGGVFVADEIQTGFGRVGSHYWAFQLQGEDFCPDIVTMGKPMGNGHPLACVVTTEEIAGAFTANGV------EYFNTFGGNPVSCAIGLAVLDVIEKEDLRGNAVRVGNHLKDLLKQLQ-IKHPIIGDVRGAGLFVGFELVKDRVDLTPATEEAALLIRRMKEKYICLSTDGPWENVVKFKPPMCFRMEDAERVTEEI-DLVLREIQDASLQK 418          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Cavefish
Match: phykpl (5-phosphohydroxy-L-lysine phospho-lyase-like [Source:NCBI gene;Acc:103047782])

HSP 1 Score: 69.3218 bits (168), Expect = 3.294e-12
Identity = 64/245 (26.12%), Postives = 102/245 (41.63%), Query Frame = 3
Query:  957 VCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGT-FWAHEKWNLCYPPDIVTFSKKM-------------LLGGYFTTKDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCA-------IDCTTSAARDKML-EELRNRGFLLGGCG--DVSIRFRPALTLKIRHVDLFLECFEDLIKRN*KHLSIFK 1619
            +    VE + + GG I     +F  + E  R     F+ DE+QTG G  G+ +WA +     + PDIVT  K M              + G FT          + FNT+ G P    +  AVL  I+ EDL       GNHL   LK +Q +    + + RG+G F         +D T +     +L   ++ +   L   G  +  ++F+P +  ++   +   E   DL+ R  +  S+ K
Sbjct:  207 ISSFFVESLPSVGGQIIFPRGYFTKVAEYVRAAGGVFVADEIQTGFGRVGSHYWAFQLQGEDFCPDIVTMGKPMGNGHPLACVVTTEEIAGAFTANGV------EYFNTFGGNPVSCAIGLAVLDVIEKEDLRGNAVRVGNHLKDLLKQLQ-IKHPIIGDVRGAGLFVGFELVKDRVDLTPATEEAALLIRRMKEKYICLSTDGPWENVVKFKPPMCFRMEDAERVTEEI-DLVLREIQDASLQK 443          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Sea Lamprey
Match: abat (4-aminobutyrate aminotransferase [Source:ZFIN;Acc:ZDB-GENE-031006-4])

HSP 1 Score: 472.626 bits (1215), Expect = 1.581e-163
Identity = 233/453 (51.43%), Postives = 300/453 (66.23%), Query Frame = 3
Query:  231 PIMKTAVPGPKSMETIKKLSDFQMVNGIKFIANYENSIGNYIADVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKIDVPLFNWPQADFPIYKYDXXXXXXXXXXQDKICLEMVEETIRKCAEIS-PVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGYFTTKDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHVDLFLECFEDLI 1586
            P+MKT +PGPKS    K+L + Q    ++F  +Y  S GNY+ DVD N MLDL+ QISS+PLGYNHP L    +    + +  NRP LG  PP D   LL  SL+SVAP GL  VQTM CGSC+ ENA KA+FI  +  +RGG + T EEL + M N+ PGCP+ SILSF G FHGRT+G L+ T SKAIHK+D+P  +WP A FP  +Y LEE+   N +++  CL  VE+ I+K A    PV GV+VEP+ AEGGD H S++FF  LR +  K   AF+ DEVQTG G TG FWAHE W L  PPD+VTFSKKML GG++   +     PY+I+NTW+GEPSK L+L  VLK ++ E L++  +  G+ LL+GL ++Q    N LS ARG GTFCAID      R+K +   RN+G +LGGCGD+SIRFRP+L     H ++FL  F D++
Sbjct:    5 PLMKTTIPGPKSQVLTKELGEIQNSVAVQFFCDYTASRGNYLVDVDGNRMLDLYMQISSLPLGYNHPALLRTLQDPANLATFANRPALGALPPHDLPQLLHKSLVSVAPTGLRQVQTMACGSCSNENAFKAIFIWYRNKQRGGAKPTTEELRTSMINQSPGCPELSILSFMGSFHGRTIGCLATTHSKAIHKLDIPSLDWPIAPFPRLQYPLEEHSRENASEEARCLAEVEDLIQKFARKGRPVAGVVVEPIQAEGGDNHASDDFFRKLRALTAKHGAAFLCDEVQTGAGTTGLFWAHEHWGLENPPDVVTFSKKMLTGGFYYKDELRTELPYRIYNTWMGEPSKTLMLAEVLKVVRAERLLDNVQHAGSVLLRGLTDLQNEFPNILSRARGRGTFCAIDIRDEDTRNKAVLLARNKGVVLGGCGDMSIRFRPSLIFTEIHANIFLNIFRDVV 457          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Sea Lamprey
Match: etnppl (ethanolamine-phosphate phospho-lyase [Source:NCBI gene;Acc:393421])

HSP 1 Score: 71.2478 bits (173), Expect = 2.096e-13
Identity = 61/225 (27.11%), Postives = 101/225 (44.89%), Query Frame = 3
Query:  912 EMVEETIRKCAEISPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGT-FWAHEKWNLCYPPDIVTFSKKMLLGG----YFTTK---DYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAID--------CTTSAARDKMLEELRNRGFLLGGCGDVS--IRFRPAL 1532
            EM+E+  +K  +I+     + E + + GG I     +F  + +  R+    FI DEVQ G G  G+ FWA +     + PDIVT  K +  G       TT+   D    +  + FNT+ G P    +  +VL  I+ E++      TG +L++ L N  K     + + RG G F  +D           +A  + ++  L+    LL   G  S  ++F+P +
Sbjct:  199 EMLEQAHKKGRKIA---AFVAESMQSCGGQIIPPPGYFKQVADHVRRAGGIFIADEVQVGFGRVGSHFWAFQLQGEDFVPDIVTMGKPIGNGHPISCVVTTREVADSFRASGVEYFNTFGGNPVSCAIALSVLDIIEKENMRENAVSTGRYLVE-LLNELKTRHEIIGDIRGQGLFVGVDLVKDRKSRAAATAEAEHIIYRLKEEHVLLSADGPYSNVLKFKPPM 419          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Yeast
Match: UGA1 (Gamma-aminobutyrate (GABA) transaminase; also known as 4-aminobutyrate aminotransferase; involved in the 4-aminobutyrate and glutamate degradation pathways; required for normal oxidative stress tolerance and nitrogen utilization; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000003251])

HSP 1 Score: 366.696 bits (940), Expect = 3.833e-122
Identity = 200/460 (43.48%), Postives = 280/460 (60.87%), Query Frame = 3
Query:  210 FSNEPPKPIMKT-AVPGPKSMETIKKLSDFQMVNGIKFIANYENSIGNYIADVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERG-GKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKIDVPLFNWPQADFPIYKYDXXXXXXXXXXQDKICLEMVEETIRKCAEISPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGY-FTTKDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGS--GTFCAIDCTTSAARDKMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHVDLFLECF 1574
            +  EP KP +KT ++PGP+S + +K+L +        F+A+YE S+GNYI DVD N  LDL+ QISSI LGYN+P L   A+S E I + ++RP LG FP KD   +LK  L S APKG  HV + + G+ A E A KA FI  +  +RG   +F+ +E  S M N+ PG P  ++LSFK  FHGR   + S T SK IHK+D P F+WP A++P Y+Y L+EN + N  +D  CL +VEE I+  +   PV  +I+EP+ +EGGD H S  F   LR+I  K  + +I+DEVQTG G TG  W HE  ++  P D+VTFSKK    GY F    +IP  PY+ FNTW GEP+++++  A+ + I  + L  +    G++L K L+ +QK       N RG   GTF A D  T   RD +L++L+  G  +GGC   ++R RP+LT + +H D+F+E  
Sbjct:    8 YPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYEKSLGNYITDVDGNTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDRPALGNFPSKDLDKILKQILKS-APKGQDHVWSGLSGADANELAFKAAFIYYRAKQRGYDADFSEKENLSVMDNDAPGAPHLAVLSFKRAFHGRLFASGSTTCSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDHCLAIVEELIKTWS--IPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTGVGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFNTWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENFQNLRGKGRGTFIAWDLPTGEKRDLLLKKLKLNGCNVGGCAVHAVRLRPSLTFEEKHADIFIEAL 464          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Yeast
Match: ARG8 (Acetylornithine aminotransferase; catalyzes the fourth step in the biosynthesis of the arginine precursor ornithine [Source:SGD;Acc:S000005500])

HSP 1 Score: 96.6709 bits (239), Expect = 6.200e-22
Identity = 107/429 (24.94%), Postives = 175/429 (40.79%), Query Frame = 3
Query:  360 DVDNNLMLDLFCQISSIPLGYNHPNLKSV--AKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTH--VQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKIDVPLFNW-PQADFPIYKYDXXXXXXXXXXQDKICLEMVEETIRKCAEISPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGYFTTKDYIPIAPYQIFN--------------TWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHVDLFLECFEDLIK 1589
            DV+    +D    I+   LG+ +P +  +   ++++ + S+       ++  K+  DL +  +      G  H   +  +C S    N     F ++ GI               MKN      K  I++F+  FHGRT+GALS+T +    K   P  +  P   F             N N +   L+   ET +       + G+IVEP+  EGG           L++IC+   +  I DE+Q G G +G  WAH        PDI T S K L  G+       PIA   I N              T+ G P    +   VL TI  E  + +  +  + L K L+ +Q    N++   RG G     +        +++++ R  G L+   G  ++RF PALT++   ++  ++ FE  I+
Sbjct:   47 DVNGKEYIDFTAGIAVTALGHANPKVAEILHHQANKLVHSS------NLYFTKECLDLSEKIVEKTKQFGGQHDASRVFLCNSGTEANEAALKFAKKHGI---------------MKNPS----KQGIVAFENSFHGRTMGALSVTWNS---KYRTPFGDLVPHVSF------------LNLNDEMTKLQSYIETKK-----DEIAGLIVEPIQGEGGVFPVEVEKLTGLKKICQDNDVIVIHDEIQCGLGRSGKLWAHAYLPSEAHPDIFT-SAKALGNGF-------PIAA-TIVNEKVNNALRVGDHGTTYGGNPLACSVSNYVLDTIADEAFLKQVSKKSDILQKRLREIQAKYPNQIKTIRGKGLMLGAEFVEPPT--EVIKKARELGLLIITAGKSTVRFVPALTIEDELIEEGMDAFEKAIE 419          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Yeast
Match: CAR2 (L-ornithine transaminase (OTAse); catalyzes the second step of arginine degradation, expression is dually-regulated by allophanate induction and a specific arginine induction process; not nitrogen catabolite repression sensitive; protein abundance increases in response to DNA replication stress; human homolog OAT complements yeast null mutant [Source:SGD;Acc:S000004430])

HSP 1 Score: 94.7449 bits (234), Expect = 2.291e-21
Identity = 105/405 (25.93%), Postives = 161/405 (39.75%), Query Frame = 3
Query:  360 DVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKIDV-PLFNWPQADFPIYKYDXXXXXXXXXXQDKICLEMVEETIRKCAEISPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGG------YFTTKDYIP-IAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEEL----RNRGFLLGGCGDVSIRFRPALTL 1538
            D +  L LD     S++  G+ HP++          ++  +R     F    Y    K         G   V  M  G+ A+E A+K    R+ G  +              KN P    K  IL  +G FHGRT GA+SL+      K+   P      +   ++K      + Y + +D +        I +  E   V  +I+EP+  E G +    ++F  +  +CRK  +  IVDE+QTG G TG    ++ +     PDIV   K  L GG        ++ D +    P    +T+ G P    +  A L+ I+ E L     + G+  +  LK +Q  S   +S  RG G   AI    S A  K   +L    ++ G L     D  IR  P L +
Sbjct:   40 DPEGKLYLDFLSAYSAVNQGHCHPHIIKALTEQAQTLTLSSR----AFHNDVYAQFAK---FVTEFFGFETVLPMNTGAEAVETALK--LARRWGYMK--------------KNIPQD--KAIILGAEGNFHGRTFGAISLSTDYEDSKLHFGPFVPNVASGHSVHK------IRYGHAEDFV-------PILESPEGKNVAAIILEPIQGEAGIVVPPADYFPKVSALCRKHNVLLIVDEIQTGIGRTGELLCYDHYKAEAKPDIVLLGKA-LSGGVLPVSCVLSSHDIMSCFTPGSHGSTFGGNPLASRVAIAALEVIRDEKLCQRAAQLGSSFIAQLKALQAKSNGIISEVRGMGLLTAIVIDPSKANGKTAWDLCLLMKDHGLLAKPTHDHIIRLAPPLVI 405          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Nematostella
Match: EDO34279 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPT6])

HSP 1 Score: 463.766 bits (1192), Expect = 8.169e-160
Identity = 226/451 (50.11%), Postives = 303/451 (67.18%), Query Frame = 3
Query:  237 MKTAVPGPKSMETIKKLSDFQMVNGIKFIANYENSIGNYIADVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKIDVPLFNWPQADFPIYKYDXXXXXXXXXXQDKICLEMVEETIRKCAEIS-PVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGYFTTKDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHVDLFLECFEDLI 1586
            M+T+VPGPKS E  K+L + Q   G+K+  ++E S GNY+ D D N+MLD++ QI+SIPLGYNHP L    +  E + S INR  LG+ PPK     LK S++SV+PKGLT V TM CG+CA ENAIKA  I  +  ERG +  T E++ +CMK + PG P  ++LSF GGFHGRTLG+L+LTRSKAIHK+D+P F+WP A FP  KY LEE+   N  +++ CL+ V+E I    +   PV  +I EP+ AEGGD H S NFF  L+ IC++   AFIVDEVQTG G TG FWAHE W L   PD VTFSKKM +GG++   ++ P AP++IFNTW+G+P+K++LL  VLK I+ ++LI  T + G  LLKGL+ +++     +S ARG GTFC ID      R K L ++RN G  + GCG  ++RFRPAL    +H+DL +   + ++
Sbjct:    1 MRTSVPGPKSQELFKELDEIQSSKGMKYFVDFEKSKGNYVVDADGNVMLDVYQQIASIPLGYNHPALLKAMQDPEILSSIINRSALGLLPPKTLPKNLKESVLSVSPKGLTEVTTMACGTCANENAIKAACIWYRNRERGSETPTEEDMITCMKGQAPGSPPYTVLSFTGGFHGRTLGSLTLTRSKAIHKVDIPSFDWPVATFPKLKYPLEEHQRENAAEEQRCLDEVKEIISTWNKAGKPVAALITEPIQAEGGDNHASPNFFKGLQAICKEFGTAFIVDEVQTGVGSTGKFWAHEHWGLDEAPDFVTFSKKMAIGGFYYKHEFRPSAPFRIFNTWMGDPNKMILLREVLKVIRKDNLIEYTADVGKELLKGLQYIEERHPEFVSRARGLGTFCGIDLPDLETRTKFLGQMRNNGVDMDGCGVKTVRFRPALIFGHKHLDLAVNTMDSVL 451          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Nematostella
Match: EDO31358 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SY55])

HSP 1 Score: 118.242 bits (295), Expect = 5.387e-31
Identity = 69/175 (39.43%), Postives = 98/175 (56.00%), Query Frame = 3
Query: 1062 AFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGYFTTKDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHVDLFLECFEDLI 1586
            AFIVDEVQTG G TG FWAHE W+L   PD VTFSKKM +GG++   ++ P   + +F   + + +  +   +V        L+  T + G   LKG ++ + +SK     ARG GTFC ID      R K L  +RN G  + GCG  ++RFRPAL    +H+DL +   + ++
Sbjct:    2 AFIVDEVQTGVGSTGKFWAHEHWDLDEAPDFVTFSKKMAIGGFYYKHEFRPRIQF-VFGCCMSQRTSRIHSSSVEFRGGKLSLLY-TADVGKERLKG-RHPEFVSK-----ARGLGTFCGIDLPDLETRTKFLGLMRNNGVDMDGCGVKTVRFRPALIFGHKHLDLAVNTMDSVL 168          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Nematostella
Match: EDO34914 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMZ4])

HSP 1 Score: 75.8702 bits (185), Expect = 1.080e-14
Identity = 85/387 (21.96%), Postives = 154/387 (39.79%), Query Frame = 3
Query:  360 DVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKIDVP----LFNWPQADFPIYKYDXXXXXXXXXXQDKIC-------------LEMVEETIRKCAEISPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGT-FWAHEKWNLCYPPDIVTFSKKM----LLGGYFTT--KDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAAR 1448
            D++N   LD+F  I ++ +G+ HP++    K+       ++R             L  ++ +   P+   + + M   +  +   +K  +    G E         ++   M     G     I++ +  +HG   G + +T S++  K++VP     ++    D     +      +  +  D+ C              E +E+ +   A    V G I EP+   GG +     F     E+ RK+    I DEVQ G G  G+ +W  E   +   PDIVT +K +     +G   TT  ++    A    FNT+ G P    + +AV++TI  E L       G   L+GL+ +Q    + + + RG G    ++  T   +
Sbjct:   51 DINNKRYLDMFAGIVTVGVGHCHPHVNKALKAQ------VDR-------------LWHTTNIYYHPQIHEYAELM---ASKLPGNLKVCYFVNSGSEA-------NDMALMMARAHTG--NFDIVNLRNSYHGSGQGVVGIT-SQSTWKLNVPTNIGFYSTMNPDVYRGPWGGANCRDSISQTDRACNCGPDECKASDLYAEQLEDLLIHSAG-KKVAGFIAEPIQGVGGTVQLPKGFLKKAYELIRKRGGLCISDEVQCGFGRLGSHYWGFESHGVM--PDIVTMAKGIGNGFPMGAVITTPGENRKKFANALHFNTYGGNPMASAVGKAVIETIDNEGLQENCSTVGTRFLRGLRKLQDEFPDFVGDVRGKGLMTGMELVTDRVK 402          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Nematostella
Match: EDO48680 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIC3])

HSP 1 Score: 72.4034 bits (176), Expect = 1.177e-13
Identity = 60/202 (29.70%), Postives = 89/202 (44.06%), Query Frame = 3
Query:  969 IVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGYFTT------KDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAI------DCTTSAARDKMLEELRNRGFLLGGCGDVSIRFRPALTL 1538
            +VEP+  E G +     +   +R++C K  + FI DEVQTG G TG     +  N+   PD+V   K +  G Y  +      +  + I P +  +T+ G P    +    L+ ++ E L   + E G   L  +   QKL+ N +  ARG G   AI      DC       K+   LR+ G L     D  IRF P L +
Sbjct:  219 MVEPIQGEAGVVVPDAGYLKGVRDLCDKYNVLFIADEVQTGLGRTGRRLCVDHDNV--RPDMVVLGKAISGGLYPVSCVLADDQVMLTIKPGEHGSTYGGNPLGAKVAMEALRVLEEEKLSERSAELGKVFLSAM---QKLNPNVVELARGKGLMNAIVIKPSDDCNAW----KVCLRLRDNGLLAKPTHDHIIRFTPPLVI 411          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Nematostella
Match: EDO40982 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5I9])

HSP 1 Score: 59.3066 bits (142), Expect = 2.022e-9
Identity = 57/184 (30.98%), Postives = 76/184 (41.30%), Query Frame = 3
Query:  900 KICLEMVEETIRKCAEISPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGT-FWAHEKWNLCYPPDIVTFSKKM----LLGGYFTT---KDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAID 1427
            K  +E VE+  RK A      G I E +   GG I    NF     +  R      I DEVQ G G  G  FWA E  ++   PDIVT  K +     L    TT    +         FNT+ G P    +  AVL  I+ E L     + G  L+  LK +Q+     + + RG G F  ++
Sbjct:  235 KQLIEEVEKDGRKIA------GFICESMQGCGGQIVYPQNFMKEAFKHVRAAGGVCIADEVQVGFGRVGNHFWAFETQDVV--PDIVTLGKPIGNGHPLACVVTTPEISESFAATGMAYFNTYGGNPVSCAVGNAVLDVIEEEGLQQHALKVGTQLIDKLKGLQQ-KHPLIGDVRGMGLFVGVE 409          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Medaka
Match: abat (4-aminobutyrate aminotransferase [Source:NCBI gene;Acc:101158322])

HSP 1 Score: 469.159 bits (1206), Expect = 6.085e-161
Identity = 235/488 (48.16%), Postives = 320/488 (65.57%), Query Frame = 3
Query:  147 MQKTVNIRYSK-YFLTKNVSR---QFSNEPPKPIMKTAVPGPKSMETIKKLSDFQMVNGIKFIANYENSIGNYIADVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKIDVPLFNWPQADFPIYKYDXXXXXXXXXXQDKICLEMVEETIRKCAEIS-PVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGYFTTKDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHVDLFLECFEDLIKRN 1595
            +Q+T+ +R     F++K  ++   +F  + P   MKT+VPGP+S E +K+L + Q V  + F  NY++S GNY+ DVD N MLDL+ QISSIP+GYNHP L  +  +   + + +NRP LG+ PP+++ D +  SL+SVAP G++ VQTM CGSC+ ENA K++FI  +  ERG    T E+L SCM N+ PGCP  SILSF G FHGRT+G L+ T SKAIHK+DVP  +WP A FP  +Y LEE    N  ++  CLE VE+ I K  +   PV G+++EP+ +EGGD H + +FF  LR I +K    F+VDEVQTG G TG FWAHE W +  P DIV+FSKK++ GGYF   +     PY+IFNTW+G+PSK L L  VL  I+ E+L+ E   +G  L+ GL  +Q      LS ARG GTFCAID   +  R+++  + R++G +LGGCG+ SIRFRPAL  K  HV LFL  F D++ ++
Sbjct:   14 LQRTLCLRAPGCRFVSKTAAKTHVEFDYDGPS--MKTSVPGPRSQELLKQLGEIQNVGAVNFFCNYDDSRGNYLVDVDGNRMLDLYTQISSIPIGYNHPALLKLMANPNNLSTFVNRPALGILPPENFPDKVTESLLSVAPSGMSRVQTMSCGSCSNENAFKSIFIWYRNKERGLSGPTAEDLSSCMLNQAPGCPDLSILSFTGAFHGRTMGCLATTHSKAIHKLDVPSLDWPIAPFPRLQYPLEEFSRENEQEEARCLEEVEDLIVKWRQKGKPVAGIVIEPIQSEGGDNHATADFFRKLRIIAQKHGCGFLVDEVQTGGGGTGKFWAHEHWGMDDPADIVSFSKKLMTGGYFHKDELQADKPYRIFNTWMGDPSKNLFLAEVLNVIRRENLLEEVARSGKALMNGLYELQAQYPGLLSRARGQGTFCAIDVRDAETRERITLQTRDKGVILGGCGEKSIRFRPALIFKEYHVHLFLNIFNDVLAQH 499          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Medaka
Match: abat (4-aminobutyrate aminotransferase [Source:NCBI gene;Acc:101158322])

HSP 1 Score: 332.413 bits (851), Expect = 7.799e-109
Identity = 188/456 (41.23%), Postives = 256/456 (56.14%), Query Frame = 3
Query:  231 PIMKTAVPGPKSMETIKKLSDFQMVNGIKFIANYENSIGNYIADVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKIDVPLFNWPQADFPIYKYDXXXXXXXXXXQDKICLEMVEETIRKCAEIS-PVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGYFTTKDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHVDLFLECFEDLIKRN 1595
            P MKT+VPGP+S     +++  Q V  + F  NY++S GNY+ DVD N MLDL+ QISSIP+GYNHP L  +  +   + + +NRP LG+ PP+++ D +  SL+SVAP G++ VQTM CGSC+ ENA K++FI  +  ERG    T E+L SCM N+ PGCP  SILSF G FHGRT+G L+ T SKAIHK+DVP  +WP A FP  +Y LEE    N  ++  CLE VE+ I K  +   PV G+++EP+ +EGGD H + +FF  LR I +K    F             T+      NL                                   +L E   V+  E +L+         E   +G  L+ GL  +Q      LS ARG GTFCAID   +  R+++  + R++G +LGGCG+ SIRFRPAL  K  HV LFL  F D++ ++
Sbjct:   11 PSMKTSVPGPRS-----QVTHTQNVGAVNFFCNYDDSRGNYLVDVDGNRMLDLYTQISSIPIGYNHPALLKLMANPNNLSTFVNRPALGILPPENFPDKVTESLLSVAPSGMSRVQTMSCGSCSNENAFKSIFIWYRNKERGLSGPTAEDLSSCMLNQAPGCPDLSILSFTGAFHGRTMGCLATTHSKAIHKLDVPSLDWPIAPFPRLQYPLEEFSRENEQEEARCLEEVEDLIVKWRQKGKPVAGIVIEPIQSEGGDNHATADFFRKLRIIAQKPYRIF------------NTWMGDPSKNL-----------------------------------FLAEVLNVIRRENLLE---------EVARSGKALMNGLYELQAQYPGLLSRARGQGTFCAIDVRDAETRERITLQTRDKGVILGGCGEKSIRFRPALIFKEYHVHLFLNIFNDVLAQH 405          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Medaka
Match: agxt2 (alanine--glyoxylate aminotransferase 2 [Source:NCBI gene;Acc:111948298])

HSP 1 Score: 90.8929 bits (224), Expect = 5.638e-19
Identity = 95/444 (21.40%), Postives = 181/444 (40.77%), Query Frame = 3
Query:  348 NYIADVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKIDVP------------LFNWPQA-----DFPIYKYDXXXXXXXXXXQDKICLEMVEETIRKCAEISPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGT-FWAHEKWNLCYPPDIVTFSKKM----LLGGYFTTKDYIPIAPYQI-FNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTS---------AARDKMLEELRNRGFLLGGCGDVS--IRFRPALTLKIRHVDLFLECFE 1577
             ++ DVD +  LDLF  ++++ +G+ HP + + A+                   +  K L  ++ + + P    + + +   +  + + +K +++   G E         +L   M     G     I++F+G +HG     L LT S A +K  V             +F  P       D P+         + +   ++  +E + ET+      + + G   EP+   GG +    +F      + R++    I DEVQTG G TG+ FW  +  ++   PD+VT +K +     +G   TT +        + FNT+ G P    +  +VL TI+ +     + + G +LLK L  ++      + + RG G    ++  T              ++ E++++ G L+G  G      R +P + + +   D FL  F+
Sbjct:   98 QWLWDVDGSRYLDLFAGVATVSVGHCHPKVLTAAE-------------------QQLKKLWHTTNIYIYPTLHEYCEKL---ASYLPDPLKVIYLTNSGSEA-------NDLAMLMARLHTG--NYDIITFRGSYHGGGPQTLGLT-SNAAYKYPVASGLGCTNTMCPDVFRGPWGGSNCRDSPVQTIRDCSCAQGHCKANEHYIEQLRETLATSVP-TRIAGFFAEPIQGVGGAVQYPKDFLKEAYRLVRERGGICIADEVQTGFGRTGSHFWGFQGHDII--PDMVTMAKGIGNGFPMGAVVTTPEIAASFARGVHFNTFGGNPVACAMASSVLDTIQEDKTQKVSLDVGTYLLKELAKLRD-KYEIIGDVRGKGLMIGVEMVTDKTSRTPLPLGEMAEIFEDVKDMGVLIGKGGLYGQIFRIKPPMCITMEDADFFLAVFD 505          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Medaka
Match: agxt2 (alanine--glyoxylate aminotransferase 2 [Source:NCBI gene;Acc:111948298])

HSP 1 Score: 82.4185 bits (202), Expect = 2.176e-16
Identity = 92/433 (21.25%), Postives = 172/433 (39.72%), Query Frame = 3
Query:  348 NYIADVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKIDVP------------LFNWPQA-----DFPIYKYDXXXXXXXXXXQDKICLEMVEETIRKCAEISPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGT-FWAHEKWNLCYPPDIVTFSKKM----LLGGYFTTKDYIPIAPYQI-FNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHVDLFLECFE 1577
             ++ DVD +  LDLF  ++++ +G+ HP + + A+                   +  K L  ++ + + P    + + +   +  + + +K +++   G E         +L   M     G     I++F+G +HG     L LT S A +K  V             +F  P       D P+         + +   ++  +E + ET+      + + G   EP+   GG +    +F      + R++    I DEVQTG G TG+ FW  +  ++   PD+VT +K +     +G   TT +        + FNT+ G P    +  +VL TI+ +     + + G +LLK L  ++      + + RG G    ++  T    DK+                   R +P + + +   D FL  F+
Sbjct:   59 QWLWDVDGSRYLDLFAGVATVSVGHCHPKVLTAAE-------------------QQLKKLWHTTNIYIYPTLHEYCEKL---ASYLPDPLKVIYLTNSGSEA-------NDLAMLMARLHTG--NYDIITFRGSYHGGGPQTLGLT-SNAAYKYPVASGLGCTNTMCPDVFRGPWGGSNCRDSPVQTIRDCSCAQGHCKANEHYIEQLRETLATSVP-TRIAGFFAEPIQGVGGAVQYPKDFLKEAYRLVRERGGICIADEVQTGFGRTGSHFWGFQGHDII--PDMVTMAKGIGNGFPMGAVVTTPEIAASFARGVHFNTFGGNPVACAMASSVLDTIQEDKTQKVSLDVGTYLLKELAKLRD-KYEIIGDVRGKGLMIGVEMVT----DKIF------------------RIKPPMCITMEDADFFLAVFD 433          
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Medaka
Match: oat (ornithine aminotransferase [Source:NCBI gene;Acc:101164599])

HSP 1 Score: 72.4034 bits (176), Expect = 4.803e-13
Identity = 107/433 (24.71%), Postives = 165/433 (38.11%), Query Frame = 3
Query:  333 ENSIGNYIADVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNS--ILSFKGGFHGRTLGALSLTRSKAIHKIDVPLFNWPQADFPIYKYDXXXXXXXXXXQDKICLEMVEETIRKCAEISPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWA--HEKWNLCYPPDIVTFSKKMLLGGYFTT------KDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARD--KMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHVDLFLECFEDLIKRN 1595
            E   G Y+ DV  N   D     S++  G+ HP + +        ++  +R          Y D+L +              T M G          V     G+E GG+  T  ++         G P+N   I+  KG F GRT+ A+S +   + ++   P        F +  Y+           D   LE       K  +   V   +VEP+  E G +     +   +RE+C K  + +I DEVQTG   TG   A  HE       PDIV   K +  G Y  +      +  + I P +  +T+ G P    +  A L+ ++ E L    ++ G  L   L    KL K+ ++  RG G   A+    +   +  K+   LR+ G L        IR  P L   I + D   EC  D+I+R 
Sbjct:  108 ERGKGLYVWDVTGNRYYDFLSAYSAVNQGHCHPKIIAALTEQASRLTLTSRAF--------YNDVLGA---------YAEFITSMFG-------YDKVLPMNTGVE-GGE--TACKIARKWAYSVKGVPRNKAKIIFAKGNFWGRTMAAISSSTDPSSYEGFGPFM----PGFELVPYN-----------DIPALE-------KALQDKNVAAFMVEPIQGEAGVVVPDPGYLTKVRELCTKYNVLWIADEVQTGLARTGRRLAVDHEGVR----PDIVILGKALSGGVYPVSAVLCDDEVMLTIKPGEHGSTYGGNPIACRVAIAALEVMEEEKLAENAQKLGEVLRSEL---SKLPKDIVTTVRGKGLLNAVVIRETKDYNAMKVCLRLRDNGLLAKPTHGDIIRLAPPL---IINKDEMQECI-DIIQRT 480          
BLAST of 4-aminobutyrate aminotransferase vs. Planmine SMEST
Match: SMESG000037567.1 (SMESG000037567.1)

HSP 1 Score: 977.237 bits (2525), Expect = 0.000e+0
Identity = 482/483 (99.79%), Postives = 483/483 (100.00%), Query Frame = 3
Query:  147 MQKTVNIRYSKYFLTKNVSRQFSNEPPKPIMKTAVPGPKSMETIKKLSDFQMVNGIKFIANYENSIGNYIADVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKIDVPLFNWPQADFPIYKYDXXXXXXXXXXQDKICLEMVEETIRKCAEISPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGYFTTKDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHVDLFLECFEDLIKRN 1595
            MQKTVNIRYSKYFLTKNVSRQFSNEPPKPIMKTAVPGPKSMETIKKLSDFQMVNGIKFIANYENSIGNYIADVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKID+PLFNWPQADFPIYKYDLEENLEYNNNQDKICLEMVEETIRKCAEISPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGYFTTKDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHVDLFLECFEDLIKRN
Sbjct:    1 MQKTVNIRYSKYFLTKNVSRQFSNEPPKPIMKTAVPGPKSMETIKKLSDFQMVNGIKFIANYENSIGNYIADVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRTLGALSLTRSKAIHKIDIPLFNWPQADFPIYKYDLEENLEYNNNQDKICLEMVEETIRKCAEISPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGYFTTKDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHVDLFLECFEDLIKRN 483          
BLAST of 4-aminobutyrate aminotransferase vs. Planmine SMEST
Match: SMESG000041460.1 (SMESG000041460.1)

HSP 1 Score: 87.4261 bits (215), Expect = 4.370e-18
Identity = 98/448 (21.88%), Postives = 178/448 (39.73%), Query Frame = 3
Query:  348 NYIADVDNNLMLDLFCQISSIPLGYNHPNLKSVAKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGSCAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKGGFHGRT---LGALSL--------TRSKAIHKIDVPLFNWPQA-----DFPIYKYDXXXXXXXXXXQDKICLEMVEETIRKCAEISPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGT-FWAHEKWNLCYPPDIVTFSKKM----LLGGYFTTKDYI-PIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARD---------KMLEELRNRGFLLGGCGDVS--IRFRPALTLKIRHVDLFLECFEDLIKR 1592
             ++ D +N   LDLF  I ++ +G+ HP +    K                   +    L  ++ + + P+   + + +   +    + +K V+    G E     F   +L +          +N I++ +  +HG +   +GA +L        T    I  ++   +  P       D P+      +    +    +  +E +E+ +R     S + G + E +   GG +    NF   +  I +      I DEVQTG G  G  FW  +   +   PDIVT +K +     L    TTK+    +     FNT+ G P    + + VLK I++E+L+N  K+ G + L  L N  K     + + RG G    ++   S             K+ E+L++ G L+G  G      R +P + L  + VD  +  F++ + +
Sbjct:   63 QWLFDHNNKRYLDLFGGIVTVSVGHCHPKVNEALK-------------------RQVDKLWHTTNIYLHPEIHEYAEML---TKKFPSPLKVVYFTNSGSEANDLAFLMAKLYT---------QRNEIITLRNSYHGMSSFSMGATNLSTWRHNAVTNHGFISTMNPDPYRGPWGGSHCRDSPVQTDRKCDCSPGSCGASEKYVEQLEDVLRFSTPKSGIAGFVAETIQGVGGTVQFPKNFLAKVYPIIKNSGGVCIADEVQTGFGRLGEHFWGFQDHGVI--PDIVTMAKGIGNGFPLAAVVTTKEIANSLTGALTFNTYGGNPLACAVGKEVLKVIESENLMNNCKDVGTYFLLKL-NSLKDKYEIIGDVRGKGLMIGLEMVDSKTTKIPLKIDKMAKLFEDLKDMGVLVGKGGFYGNVFRIKPPMCLSKQDVDFSISVFDECLSK 476          
BLAST of 4-aminobutyrate aminotransferase vs. Planmine SMEST
Match: SMESG000041460.1 (SMESG000041460.1)

HSP 1 Score: 84.7297 bits (208), Expect = 1.381e-17
Identity = 67/245 (27.35%), Postives = 109/245 (44.49%), Query Frame = 3
Query:  909 LEMVEETIRKCAEISPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGT-FWAHEKWNLCYPPDIVTFSKKM----LLGGYFTTKDYI-PIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARD---------KMLEELRNRGFLLGGCGDVS--IRFRPALTLKIRHVDLFLECFEDLIKR 1592
            +E +E+ +R     S + G + E +   GG +    NF   +  I +      I DEVQTG G  G  FW  +   +   PDIVT +K +     L    TTK+    +     FNT+ G P    + + VLK I++E+L+N  K+ G + L  L N  K     + + RG G    ++   S             K+ E+L++ G L+G  G      R +P + L  + VD  +  F++ + +
Sbjct:  115 VEQLEDVLRFSTPKSGIAGFVAETIQGVGGTVQFPKNFLAKVYPIIKNSGGVCIADEVQTGFGRLGEHFWGFQDHGVI--PDIVTMAKGIGNGFPLAAVVTTKEIANSLTGALTFNTYGGNPLACAVGKEVLKVIESENLMNNCKDVGTYFLLKL-NSLKDKYEIIGDVRGKGLMIGLEMVDSKTTKIPLKIDKMAKLFEDLKDMGVLVGKGGFYGNVFRIKPPMCLSKQDVDFSISVFDECLSK 356          
BLAST of 4-aminobutyrate aminotransferase vs. Planmine SMEST
Match: SMESG000055175.1 (SMESG000055175.1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.268e-16
Identity = 66/216 (30.56%), Postives = 97/216 (44.91%), Query Frame = 3
Query:  960 CGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGYFTT------KDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEELRNRGFLLGGCGDVSIRFRPALTLKIRHVD----LFLECFE 1577
            C  +VEP+  E G +  S  +   +R++C K K+ FI DEVQTG G TG     +  N+   PDIV   K +  G Y  +      +  + I P +  +T+ G P    +    L+ +K E+L   +++ G  L  GL   +KL K  +S  RG G   AI         K+   +R+ G L        IR  P LT+    +D    L  E FE
Sbjct:  218 CAFMVEPIQGEAGVVLPSPGYLKGVRDLCTKYKVLFIADEVQTGLGRTGKLLCVDYDNI--RPDIVVLGKALSGGVYPVSAVLANDEIMLTILPGEHGSTFGGNPLGCKVAMTALEVLKKENLTENSEKMGQRLRAGL---EKLPKEMVSIVRGKGLLNAIVVQKKYDAWKICLAMRDIGILAKPTHGDIIRLAPPLTITAAEIDKSLQLISESFE 428          
BLAST of 4-aminobutyrate aminotransferase vs. Planmine SMEST
Match: SMESG000012656.1 (SMESG000012656.1)

HSP 1 Score: 59.6918 bits (143), Expect = 3.445e-9
Identity = 66/249 (26.51%), Postives = 106/249 (42.57%), Query Frame = 3
Query:  912 EMVEETIRKCAEI-----SPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTG-TFWAHEKWNLCYPPDIVTFSKKMLLG----GYFTTK---DYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDC-----TTSAARDK---MLEELRNRGFLLGGCG--DVSIRFRPALTLKIRHVDLFLECFEDLIK 1589
            ++  E +RK  E        V    +E + + GG +     ++  + +I  +     I DEVQTG G  G +FWA +  +    PDIVT  K M  G       TT+   +     P   FNT+ G P    +  AVL  ++ E L  + +  GN+L + L  +     N + + RGSG F  ID      T   A D+    L  L+ +  ++   G  D  ++F+P +       D  L+    ++K
Sbjct:  205 DLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAFRRGP-DYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMN-DLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNLRVVLK 451          
The following BLAST results are available for this feature:
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABAT1.215e-16551.664-aminobutyrate aminotransferase [Source:HGNC Symb... [more]
ABAT1.215e-16551.664-aminobutyrate aminotransferase [Source:HGNC Symb... [more]
ABAT1.215e-16551.664-aminobutyrate aminotransferase [Source:HGNC Symb... [more]
ABAT2.978e-16551.664-aminobutyrate aminotransferase [Source:HGNC Symb... [more]
ABAT4.869e-14851.074-aminobutyrate aminotransferase [Source:HGNC Symb... [more]
back to top
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gta-11.456e-15147.11Probable 4-aminobutyrate aminotransferase, mitocho... [more]
gta-14.756e-10548.37Probable 4-aminobutyrate aminotransferase, mitocho... [more]
gta-14.756e-10548.37Probable 4-aminobutyrate aminotransferase, mitocho... [more]
oatr-11.816e-1828.75Probable ornithine aminotransferase, mitochondrial... [more]
oatr-11.816e-1828.75Probable ornithine aminotransferase, mitochondrial... [more]
back to top
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gabat3.886e-16851.75gene:FBgn0036927 transcript:FBtr0302049[more]
Gabat3.886e-16851.75gene:FBgn0036927 transcript:FBtr0344085[more]
Gabat3.886e-16851.75gene:FBgn0036927 transcript:FBtr0074908[more]
Gabat3.886e-16851.75gene:FBgn0036927 transcript:FBtr0074909[more]
CG112413.808e-1528.22gene:FBgn0037186 transcript:FBtr0347061[more]
back to top
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abat7.515e-16450.314-aminobutyrate aminotransferase [Source:ZFIN;Acc:... [more]
abat7.515e-16450.314-aminobutyrate aminotransferase [Source:ZFIN;Acc:... [more]
agxt23.891e-1721.75alanine--glyoxylate aminotransferase 2 [Source:ZFI... [more]
oat1.355e-1128.19ornithine aminotransferase [Source:ZFIN;Acc:ZDB-GE... [more]
etnppl5.709e-1124.69ethanolamine-phosphate phospho-lyase [Source:NCBI ... [more]
back to top
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abat1.240e-16850.314-aminobutyrate aminotransferase [Source:NCBI gene... [more]
abat2.552e-16850.614-aminobutyrate aminotransferase [Source:NCBI gene... [more]
abat1.067e-15248.184-aminobutyrate aminotransferase [Source:NCBI gene... [more]
abat3.516e-15148.114-aminobutyrate aminotransferase [Source:NCBI gene... [more]
abat6.396e-15048.334-aminobutyrate aminotransferase [Source:NCBI gene... [more]
back to top
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Abat9.772e-16852.324-aminobutyrate aminotransferase [Source:MGI Symbo... [more]
Abat6.750e-11443.054-aminobutyrate aminotransferase [Source:MGI Symbo... [more]
Abat1.105e-6147.144-aminobutyrate aminotransferase [Source:MGI Symbo... [more]
Abat2.681e-4351.494-aminobutyrate aminotransferase [Source:MGI Symbo... [more]
Abat2.188e-1848.614-aminobutyrate aminotransferase [Source:MGI Symbo... [more]
back to top
BLAST of 4-aminobutyrate aminotransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P61922|GABT_MOUSE6.835e-16752.324-aminobutyrate aminotransferase, mitochondrial OS... [more]
sp|P50554|GABT_RAT8.874e-16750.854-aminobutyrate aminotransferase, mitochondrial OS... [more]
sp|P80147|GABT_PIG8.427e-16651.884-aminobutyrate aminotransferase, mitochondrial OS... [more]
sp|P80404|GABT_HUMAN5.837e-16551.664-aminobutyrate aminotransferase, mitochondrial OS... [more]
sp|Q55FI1|GABT_DICDI4.481e-16450.534-aminobutyrate aminotransferase OS=Dictyostelium ... [more]
back to top
BLAST of 4-aminobutyrate aminotransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FLE51.120e-17653.49Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8HWU11.487e-17653.49Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1D2NLF31.592e-17051.484-aminobutyrate aminotransferase, mitochondrial OS... [more]
A0A077Z5K24.497e-17053.884 aminobutyrate aminotransferase, mitochondrial OS... [more]
A0A3B3TFY67.081e-17053.734-aminobutyrate aminotransferase OS=Paramormyrops ... [more]
back to top
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abat6.509e-16450.854-aminobutyrate aminotransferase [Source:NCBI gene... [more]
abat9.575e-15148.434-aminobutyrate aminotransferase [Source:NCBI gene... [more]
agxt22.722e-1420.95alanine--glyoxylate aminotransferase 2 [Source:ZFI... [more]
phykpl2.464e-1226.125-phosphohydroxy-L-lysine phospho-lyase-like [Sour... [more]
phykpl3.294e-1226.125-phosphohydroxy-L-lysine phospho-lyase-like [Sour... [more]
back to top
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
abat1.581e-16351.434-aminobutyrate aminotransferase [Source:ZFIN;Acc:... [more]
etnppl2.096e-1327.11ethanolamine-phosphate phospho-lyase [Source:NCBI ... [more]
back to top
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
UGA13.833e-12243.48Gamma-aminobutyrate (GABA) transaminase; also know... [more]
ARG86.200e-2224.94Acetylornithine aminotransferase; catalyzes the fo... [more]
CAR22.291e-2125.93L-ornithine transaminase (OTAse); catalyzes the se... [more]
back to top
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO342798.169e-16050.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO313585.387e-3139.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349141.080e-1421.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO486801.177e-1329.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409822.022e-930.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 4-aminobutyrate aminotransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abat6.085e-16148.164-aminobutyrate aminotransferase [Source:NCBI gene... [more]
abat7.799e-10941.234-aminobutyrate aminotransferase [Source:NCBI gene... [more]
agxt25.638e-1921.40alanine--glyoxylate aminotransferase 2 [Source:NCB... [more]
agxt22.176e-1621.25alanine--glyoxylate aminotransferase 2 [Source:NCB... [more]
oat4.803e-1324.71ornithine aminotransferase [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of 4-aminobutyrate aminotransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000037567.10.000e+099.79SMESG000037567.1[more]
SMESG000041460.14.370e-1821.88SMESG000041460.1[more]
SMESG000041460.11.381e-1727.35SMESG000041460.1[more]
SMESG000055175.11.268e-1630.56SMESG000055175.1[more]
SMESG000012656.13.445e-926.51SMESG000012656.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011394 ID=SMED30011394|Name=4-aminobutyrate aminotransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=1697bp
GTTAAATATTAAATAATTTATTTTTTCACCAAAAATTTGGCAATTATTAT
AATTCTGAATTAAAAAATTATTTACTGATTTTATTTCTGAATTAACTATA
TTCTTATAAATACTTTCGAAATAATATTCAAGTAAACCGGTTTATTATGC
AAAAAACAGTCAACATAAGATATTCAAAATATTTTCTGACCAAAAATGTC
TCAAGGCAATTTTCTAATGAGCCACCGAAACCAATAATGAAAACTGCAGT
TCCAGGTCCAAAATCAATGGAAACAATAAAAAAACTGTCAGATTTTCAAA
TGGTGAATGGGATCAAATTTATTGCTAATTACGAAAACTCTATTGGAAAT
TATATTGCTGATGTTGATAATAACCTTATGCTGGATCTTTTCTGTCAAAT
TTCTAGTATTCCATTAGGATACAATCACCCCAATTTGAAGTCTGTAGCTA
AATCGGATGAATTTATTATGTCTGCAATCAACAGGCCTTGCTTGGGGATG
TTTCCACCTAAAGATTATAAAGATTTATTGAAAAGTTCCCTCATGTCAGT
AGCTCCTAAAGGTTTGACACACGTCCAAACAATGATGTGTGGCTCCTGTG
CAATTGAAAATGCAATAAAAGCAGTCTTCATTAGGCAAAAGGGTATTGAA
AGAGGAGGTAAAGAATTCACTAATGAAGAATTGGAATCTTGCATGAAAAA
CGAACCCCCTGGTTGTCCTAAAAATTCTATTCTTTCATTCAAAGGTGGAT
TCCATGGTAGAACATTAGGCGCACTGAGTTTGACTCGATCAAAAGCTATT
CATAAAATAGATGTTCCATTGTTTAATTGGCCGCAAGCAGATTTCCCAAT
TTACAAATATGATTTAGAGGAGAATTTGGAATATAATAATAACCAAGACA
AGATATGCCTGGAAATGGTTGAAGAGACAATTAGAAAATGTGCTGAAATT
TCTCCAGTATGCGGAGTTATTGTTGAGCCAGTGTTGGCTGAAGGCGGGGA
TATACACGGTTCCAATAATTTCTTTTATTCGCTTAGAGAAATTTGCCGCA
AGAAAAAGATCGCATTTATTGTAGATGAAGTTCAAACAGGATGCGGACCT
ACCGGTACATTTTGGGCTCATGAAAAGTGGAATTTATGTTATCCTCCGGA
TATTGTTACTTTTAGTAAGAAAATGCTTCTCGGTGGTTATTTTACAACCA
AAGATTATATTCCCATTGCACCCTATCAAATATTTAACACTTGGCTTGGA
GAACCATCCAAAGTTTTACTTTTAGAAGCAGTTCTGAAAACCATAAAAAC
GGAAGATTTAATAAACGAAACTAAAGAAACTGGAAATCATTTGTTAAAAG
GATTGAAAAATGTCCAGAAACTATCCAAGAATAAATTATCGAATGCTAGA
GGAAGCGGAACATTTTGTGCGATTGATTGTACAACTTCAGCAGCGAGAGA
TAAGATGTTGGAGGAGCTTCGAAATCGTGGATTTTTGTTAGGAGGTTGTG
GAGACGTTTCAATCAGATTTCGGCCGGCTTTAACTTTAAAAATTAGACAT
GTTGATTTGTTCTTAGAATGCTTTGAAGATTTAATCAAGAGAAATTAGAA
ACATTTATCAATTTTTAAATTCAGTTTTAATTTAAGTTATTGTTATTAAT
AAATTTATTCATATTTGGAATTAGTATGGGAACATAAAATAATTTAG
back to top

protein sequence of SMED30011394-orf-1

>SMED30011394-orf-1 ID=SMED30011394-orf-1|Name=SMED30011394-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=484bp
MQKTVNIRYSKYFLTKNVSRQFSNEPPKPIMKTAVPGPKSMETIKKLSDF
QMVNGIKFIANYENSIGNYIADVDNNLMLDLFCQISSIPLGYNHPNLKSV
AKSDEFIMSAINRPCLGMFPPKDYKDLLKSSLMSVAPKGLTHVQTMMCGS
CAIENAIKAVFIRQKGIERGGKEFTNEELESCMKNEPPGCPKNSILSFKG
GFHGRTLGALSLTRSKAIHKIDVPLFNWPQADFPIYKYDLEENLEYNNNQ
DKICLEMVEETIRKCAEISPVCGVIVEPVLAEGGDIHGSNNFFYSLREIC
RKKKIAFIVDEVQTGCGPTGTFWAHEKWNLCYPPDIVTFSKKMLLGGYFT
TKDYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLL
KGLKNVQKLSKNKLSNARGSGTFCAIDCTTSAARDKMLEELRNRGFLLGG
CGDVSIRFRPALTLKIRHVDLFLECFEDLIKRN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0042802identical protein binding
GO:0003824catalytic activity
GO:0030170pyridoxal phosphate binding
GO:0008483transaminase activity
GO:00038674-aminobutyrate transaminase activity
GO:0016740transferase activity
GO:0032145succinate-semialdehyde dehydrogenase binding
GO:0042803protein homodimerization activity
GO:0046872metal ion binding
GO:0047298(S)-3-amino-2-methylpropionate transaminase activity
GO:0051536iron-sulfur cluster binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR0046314NH2But_aminotransferase_euk
IPR015422PyrdxlP-dep_Trfase_dom1
IPR015421PyrdxlP-dep_Trfase_major
IPR005814Aminotrans_3
IPR015424PyrdxlP-dep_Trfase
Vocabulary: biological process
TermDefinition
GO:0001666response to hypoxia
GO:0007568aging
GO:0007620copulation
GO:0007626locomotory behavior
GO:0009448gamma-aminobutyric acid metabolic process
GO:0009449gamma-aminobutyric acid biosynthetic process
GO:0010039response to iron ion
GO:0014053negative regulation of gamma-aminobutyric acid secretion
GO:0021549cerebellum development
GO:0031652positive regulation of heat generation
GO:0032024positive regulation of insulin secretion
GO:0033602negative regulation of dopamine secretion
GO:0035094response to nicotine
GO:0035640exploration behavior
GO:0042135neurotransmitter catabolic process
GO:0042220response to cocaine
GO:0042493response to drug
GO:0045471response to ethanol
GO:0045776negative regulation of blood pressure
GO:0045964positive regulation of dopamine metabolic process
GO:0048148behavioral response to cocaine
GO:0070474positive regulation of uterine smooth muscle contraction
GO:0090331negative regulation of platelet aggregation
GO:0097151positive regulation of inhibitory postsynaptic potential
GO:1902722positive regulation of prolactin secretion
GO:1904450positive regulation of aspartate secretion
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
GO:0005759mitochondrial matrix
GO:00321444-aminobutyrate transaminase complex
GO:0043005neuron projection
GO:0070062extracellular exosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015422Pyridoxal phosphate-dependent transferase domain 1GENE3DG3DSA:3.90.1150.10coord: 31..476
e-value: 1.0E-183
score: 613.0
IPR005814Aminotransferase class-IIIPIRSFPIRSF000521Transaminase_4ab_Lys_Orncoord: 2..483
e-value: 2.2E-189
score: 627.5
IPR005814Aminotransferase class-IIIPFAMPF00202Aminotran_3coord: 57..480
e-value: 6.2E-102
score: 341.3
IPR005814Aminotransferase class-IIICDDcd00610OAT_likecoord: 67..480
e-value: 3.36814E-96
score: 294.476
IPR015421Pyridoxal phosphate-dependent transferase, major domainGENE3DG3DSA:3.40.640.10coord: 94..387
e-value: 1.0E-183
score: 613.0
IPR0046314-aminobutyrate aminotransferase, eukaryoticTIGRFAMTIGR00699TIGR00699coord: 21..480
e-value: 1.7E-179
score: 595.4
NoneNo IPR availablePANTHERPTHR43206FAMILY NOT NAMEDcoord: 9..482
NoneNo IPR availablePANTHERPTHR43206:SF14-AMINOBUTYRATE AMINOTRANSFERASE, MITOCHONDRIALcoord: 9..482
IPR015424Pyridoxal phosphate-dependent transferaseSUPERFAMILYSSF53383PLP-dependent transferasescoord: 42..482