Nuclear pore complex protein Nup85

Overview
NameNuclear pore complex protein Nup85
Smed IDSMED30011390
Length (bp)750
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Nuclear pore complex protein Nup85 (SMED30011390) t-SNE clustered cells

Violin plots show distribution of expression levels for Nuclear pore complex protein Nup85 (SMED30011390) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Nuclear pore complex protein Nup85 (SMED30011390) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Nuclear pore complex protein Nup85 (SMED30011390) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011390

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30011390h1SMcG0019352 SmedASXL_014106SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30011390h1SMcG0019352 SmedASXL_014106SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30011390h1SMcG0019352 SmedASXL_014106SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30011390h1SMcG0019352 SmedASXL_014106SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Nuclear pore complex protein Nup85 vs. Ensembl Human
Match: NUP85 (nucleoporin 85 [Source:HGNC Symbol;Acc:HGNC:8734])

HSP 1 Score: 104.375 bits (259), Expect = 2.990e-26
Identity = 68/254 (26.77%), Postives = 123/254 (48.43%), Query Frame = 1
Query:   22 ETSAAVTSHPSLTLMGLGYLSYCAISGPAFIYQIIDHMSLRTDRMANMIHSWCVKRKFNEIAALICKRICVSNFKTGQIGNSLVWAIKGNDCNFINRIADKLLRDLFQSNESSGDFIHVGIVDCIKDINIG---IMGKKMTFVIKFVEIQALVSAGKFEEAAKMFIHLLESQLVSRHFNLDLLLRMKPLLGHGGSLFSAEDIYKLFELLQDADCKDKL----------------TEVKELREMLIRELSLACLR 726
            E ++ + +HPSL  +G+ Y  YC   G   +   I+ + L T++ A  +   C +R+  E    ICK + +   +  ++G++L W+I+  D  F   ++D+ LRD  +     G F  + ++D     N+G   ++  ++TF+ K+ E   +    +F +AA + + L+ S++  R F + LL    PLL     +FSAE  Y+L   L+D   +  +                T+V+ LR  L R L+ A +R
Sbjct:    8 EYASGLFAHPSLWQLGVDYFDYCPELGRVSLELHIERIPLNTEQKALKVLRICEQRQMTEQVRSICKILAMKAVRNNRLGSALSWSIRAKDAAFATLVSDRFLRDYCE----RGCFSDLDLID-----NLGPAMMLSDRLTFLGKYREFHRMYGEKRFADAASLLLSLMTSRIAPRSFWMTLLTDALPLLEQKQVIFSAEQTYELMRCLEDLTSRRPVHGESDTEQLQDDDIETTKVEMLRLSLARNLARAIIR 252          
BLAST of Nuclear pore complex protein Nup85 vs. Ensembl Human
Match: NUP85 (nucleoporin 85 [Source:HGNC Symbol;Acc:HGNC:8734])

HSP 1 Score: 103.219 bits (256), Expect = 1.408e-25
Identity = 59/211 (27.96%), Postives = 108/211 (51.18%), Query Frame = 1
Query:   22 ETSAAVTSHPSLTLMGLGYLSYCAISGPAFIYQIIDHMSLRTDRMANMIHSWCVKRKFNEIAALICKRICVSNFKTGQIGNSLVWAIKGNDCNFINRIADKLLRDLFQSNESSGDFIHVGIVDCIKDINIG---IMGKKMTFVIKFVEIQALVSAGKFEEAAKMFIHLLESQLVSRHFNLDLLLRMKPLLGHGGSLFSAEDIYKLFELLQD 645
            E ++ + +HPSL  +G+ Y  YC   G   +   I+ + L T++ A  +   C +R+  E    ICK + +   +  ++G++L W+I+  D  F   ++D+ LRD  +     G F  + ++D     N+G   ++  ++TF+ K+ E   +    +F +AA + + L+ S++  R F + LL    PLL     +FSAE  Y+L   L+D
Sbjct:  101 EYASGLFAHPSLWQLGVDYFDYCPELGRVSLELHIERIPLNTEQKALKVLRICEQRQMTEQVRSICKILAMKAVRNNRLGSALSWSIRAKDAAFATLVSDRFLRDYCE----RGCFSDLDLID-----NLGPAMMLSDRLTFLGKYREFHRMYGEKRFADAASLLLSLMTSRIAPRSFWMTLLTDALPLLEQKQVIFSAEQTYELMRCLED 302          
BLAST of Nuclear pore complex protein Nup85 vs. Ensembl Human
Match: NUP85 (nucleoporin 85 [Source:HGNC Symbol;Acc:HGNC:8734])

HSP 1 Score: 103.219 bits (256), Expect = 1.398e-24
Identity = 68/254 (26.77%), Postives = 123/254 (48.43%), Query Frame = 1
Query:   22 ETSAAVTSHPSLTLMGLGYLSYCAISGPAFIYQIIDHMSLRTDRMANMIHSWCVKRKFNEIAALICKRICVSNFKTGQIGNSLVWAIKGNDCNFINRIADKLLRDLFQSNESSGDFIHVGIVDCIKDINIG---IMGKKMTFVIKFVEIQALVSAGKFEEAAKMFIHLLESQLVSRHFNLDLLLRMKPLLGHGGSLFSAEDIYKLFELLQDADCKDKL----------------TEVKELREMLIRELSLACLR 726
            E ++ + +HPSL  +G+ Y  YC   G   +   I+ + L T++ A  +   C +R+  E    ICK + +   +  ++G++L W+I+  D  F   ++D+ LRD  +     G F  + ++D     N+G   ++  ++TF+ K+ E   +    +F +AA + + L+ S++  R F + LL    PLL     +FSAE  Y+L   L+D   +  +                T+V+ LR  L R L+ A +R
Sbjct:  293 EYASGLFAHPSLWQLGVDYFDYCPELGRVSLELHIERIPLNTEQKALKVLRICEQRQMTEQVRSICKILAMKAVRNNRLGSALSWSIRAKDAAFATLVSDRFLRDYCE----RGCFSDLDLID-----NLGPAMMLSDRLTFLGKYREFHRMYGEKRFADAASLLLSLMTSRIAPRSFWMTLLTDALPLLEQKQVIFSAEQTYELMRCLEDLTSRRPVHGESDTEQLQDDDIETTKVEMLRLSLARNLARAIIR 537          
BLAST of Nuclear pore complex protein Nup85 vs. Ensembl Human
Match: NUP85 (nucleoporin 85 [Source:HGNC Symbol;Acc:HGNC:8734])

HSP 1 Score: 103.605 bits (257), Expect = 1.404e-24
Identity = 68/254 (26.77%), Postives = 123/254 (48.43%), Query Frame = 1
Query:   22 ETSAAVTSHPSLTLMGLGYLSYCAISGPAFIYQIIDHMSLRTDRMANMIHSWCVKRKFNEIAALICKRICVSNFKTGQIGNSLVWAIKGNDCNFINRIADKLLRDLFQSNESSGDFIHVGIVDCIKDINIG---IMGKKMTFVIKFVEIQALVSAGKFEEAAKMFIHLLESQLVSRHFNLDLLLRMKPLLGHGGSLFSAEDIYKLFELLQDADCKDKL----------------TEVKELREMLIRELSLACLR 726
            E ++ + +HPSL  +G+ Y  YC   G   +   I+ + L T++ A  +   C +R+  E    ICK + +   +  ++G++L W+I+  D  F   ++D+ LRD  +     G F  + ++D     N+G   ++  ++TF+ K+ E   +    +F +AA + + L+ S++  R F + LL    PLL     +FSAE  Y+L   L+D   +  +                T+V+ LR  L R L+ A +R
Sbjct:  360 EYASGLFAHPSLWQLGVDYFDYCPELGRVSLELHIERIPLNTEQKALKVLRICEQRQMTEQVRSICKILAMKAVRNNRLGSALSWSIRAKDAAFATLVSDRFLRDYCE----RGCFSDLDLID-----NLGPAMMLSDRLTFLGKYREFHRMYGEKRFADAASLLLSLMTSRIAPRSFWMTLLTDALPLLEQKQVIFSAEQTYELMRCLEDLTSRRPVHGESDTEQLQDDDIETTKVEMLRLSLARNLARAIIR 604          
BLAST of Nuclear pore complex protein Nup85 vs. Ensembl Human
Match: NUP85 (nucleoporin 85 [Source:HGNC Symbol;Acc:HGNC:8734])

HSP 1 Score: 103.605 bits (257), Expect = 1.552e-24
Identity = 68/254 (26.77%), Postives = 123/254 (48.43%), Query Frame = 1
Query:   22 ETSAAVTSHPSLTLMGLGYLSYCAISGPAFIYQIIDHMSLRTDRMANMIHSWCVKRKFNEIAALICKRICVSNFKTGQIGNSLVWAIKGNDCNFINRIADKLLRDLFQSNESSGDFIHVGIVDCIKDINIG---IMGKKMTFVIKFVEIQALVSAGKFEEAAKMFIHLLESQLVSRHFNLDLLLRMKPLLGHGGSLFSAEDIYKLFELLQDADCKDKL----------------TEVKELREMLIRELSLACLR 726
            E ++ + +HPSL  +G+ Y  YC   G   +   I+ + L T++ A  +   C +R+  E    ICK + +   +  ++G++L W+I+  D  F   ++D+ LRD  +     G F  + ++D     N+G   ++  ++TF+ K+ E   +    +F +AA + + L+ S++  R F + LL    PLL     +FSAE  Y+L   L+D   +  +                T+V+ LR  L R L+ A +R
Sbjct:  405 EYASGLFAHPSLWQLGVDYFDYCPELGRVSLELHIERIPLNTEQKALKVLRICEQRQMTEQVRSICKILAMKAVRNNRLGSALSWSIRAKDAAFATLVSDRFLRDYCE----RGCFSDLDLID-----NLGPAMMLSDRLTFLGKYREFHRMYGEKRFADAASLLLSLMTSRIAPRSFWMTLLTDALPLLEQKQVIFSAEQTYELMRCLEDLTSRRPVHGESDTEQLQDDDIETTKVEMLRLSLARNLARAIIR 649          
BLAST of Nuclear pore complex protein Nup85 vs. Ensembl Fly
Match: Nup75 (gene:FBgn0034310 transcript:FBtr0086775)

HSP 1 Score: 72.0182 bits (175), Expect = 4.340e-14
Identity = 51/202 (25.25%), Postives = 95/202 (47.03%), Query Frame = 1
Query:   28 SAAVTSHPSLTLMGLGYLSYCAISGPAFIYQIIDHMSLRTDRMANMIHSWCVKRKFNEIAALICKRICVSNFKTGQIGNSLVWAIKGNDCNFINRIADKLLRDLFQSNESSGDFIHVGIVDCIKDI-NIG---IMGKKMTFVIKFVEIQALVSAGKFEEAAKMFIHLLESQLVSRHFNLDLLLRMKPLL-GHGGSLFSAEDI 618
            S  +TSH ++  +G+ YL  C   G A I  ++  ++LR++R A  + +   +R    +   ICK +   ++   + GN+L WAI+  D   +  +AD +L+           +   G + C   I N+G       ++ F+ K+ E         F  A+++ ++LLES++   +F   LL+   PLL      +F+ E +
Sbjct:  412 SYLMTSH-NMWQLGIDYLDCCKQEGQAAIELLLPRITLRSERQATKLINLARQRGLISVEREICKVLSKRSYDNERYGNALEWAIRSKDVLLVTAVADFILK----------HYSKTGCMLCPDTIANVGGRMFASPRLVFLSKYFEFYEFYRTRDFLSASELLVNLLESKITPDYFWPSLLIDSMPLLESKDPKIFAKETV 602          
BLAST of Nuclear pore complex protein Nup85 vs. Ensembl Zebrafish
Match: NUP85 (nucleoporin 85 [Source:HGNC Symbol;Acc:HGNC:8734])

HSP 1 Score: 85.1149 bits (209), Expect = 2.088e-19
Identity = 53/207 (25.60%), Postives = 103/207 (49.76%), Query Frame = 1
Query:   52 SLTLMGLGYLSYCAISGPAFIYQIIDHMSLRTDRMANMIHSWCVKRKFNEIAALICKRICVSNFKTGQIGNSLVWAIKGNDCNFINRIADKLLRDLFQSNESSGDFIHVGIVDCIKDINIG---IMGKKMTFVIKFVEIQALVSAGKFEEAAKMFIHLLESQLVSRHFNLDLLLRMKPLLGHGGSLFSAEDIYKLFELLQDADCKDK 663
            SL  + + YL +C   G  ++   I+ + L T+R A  +   C  R+ +E    ICK +     +  ++G++L W+I+  D      I+++ L+D   SN+  G F  + ++D     N+G   ++  ++TF+ K+ E   L    +F +AAK+ + L+ +++  R   + LL    PLL     +F+ +  Y+L   L++ +   K
Sbjct:    3 SLWQLAVDYLDHCPEFGRVYLELQIERVPLDTERKAIKVLRICEDRQMSEQVRSICKIMAKRALRNNRLGSALSWSIRAKDAALATLISERFLQDY--SNK--GSFTDLDVLD-----NLGPAMLLSDRLTFLGKYREFHRLYGENRFSDAAKLLLSLMMAKIAPRSLWMTLLTDALPLLEQEEVIFTVDQTYELMSCLEELNSGTK 200          
BLAST of Nuclear pore complex protein Nup85 vs. Ensembl Xenopus
Match: pcmt1 (protein-L-isoaspartate (D-aspartate) O-methyltransferase [Source:Xenbase;Acc:XB-GENE-959017])

HSP 1 Score: 93.5893 bits (231), Expect = 3.808e-21
Identity = 70/235 (29.79%), Postives = 122/235 (51.91%), Query Frame = 1
Query:   28 SAAVTSHPSLTLMGLGYLSYCAISGPAFIYQIIDHMSLRTDRMANMIHSWCVKRKFNEIAALICKRICVSNFKTGQIGNSLVWAIKGNDCNFINRIADKLLRDLFQSNESSGDFIHVGIVDCIKDINIG---IMGKKMTFVIKFVEIQALVSAGKFEEAAKMFIHLLESQLVSRHFNLDLLLRMKPLLGHGGSLFSAEDIYKLFELLQD--ADCKDKLTEVKELREMLIRELSLA 717
            ++ + SH SL  +G+ Y  YC   G  ++   ++ + L T++ A      C KR+  E    ICK + + +   G++G++L W+I+  D  F   I+D+ L++        G+F  + ++D     N+G   ++  ++TF+ K+ E   + S  +F EAA + + L+ +++    F L LLL   PLL     +FSAE  Y+L   L+D  AD  D  T+++ LR  L R L+ A
Sbjct:  374 ASGLFSHHSLWQLGVDYFDYCPNLGHVYLELHMERVPLNTEKKALKALRICEKRQMTEQVRSICKTMAMQSLCNGRLGSALSWSIRAKDAAFATLISDRFLKEY----SERGNFTDLDLID-----NLGSAMLLSDRLTFLGKYREFHRMYSQEQFSEAASLLLSLMTARIAPCSFWLTLLLDALPLLEQKQVIFSAEQTYELMRCLEDRMADSVDS-TKIEMLRLALARNLARA 598          
BLAST of Nuclear pore complex protein Nup85 vs. Ensembl Xenopus
Match: pcmt1 (protein-L-isoaspartate (D-aspartate) O-methyltransferase [Source:Xenbase;Acc:XB-GENE-959017])

HSP 1 Score: 88.5817 bits (218), Expect = 1.661e-19
Identity = 60/209 (28.71%), Postives = 109/209 (52.15%), Query Frame = 1
Query:   28 SAAVTSHPSLTLMGLGYLSYCAISGPAFIYQIIDHMSLRTDRMANMIHSWCVKRKFNEIAALICKRICVSNFKTGQIGNSLVWAIKGNDCNFINRIADKLLRDLFQSNESSGDFIHVGIVDCIKDINIG---IMGKKMTFVIKFVEIQALVSAGKFEEAAKMFIHLLESQLVSRHFNLDLLLRMKPLLGHGGSLFSAEDIYKLFELLQD 645
            ++ + SH SL  +G+ Y  YC   G  ++   ++ + L T++ A      C KR+  E    ICK + + +   G++G++L W+I+  D  F   I+D+ L++  +     G+F  + ++D     N+G   ++  ++TF+ K+ E   + S  +F EAA + + L+ +++    F L LLL   PLL     +FSAE  Y+L   L+D
Sbjct:  406 ASGLFSHHSLWQLGVDYFDYCPNLGHVYLELHMERVPLNTEKKALKALRICEKRQMTEQVRSICKTMAMQSLCNGRLGSALSWSIRAKDAAFATLISDRFLKEYSE----RGNFTDLDLID-----NLGSAMLLSDRLTFLGKYREFHRMYSQEQFSEAASLLLSLMTARIAPCSFWLTLLLDALPLLEQKQVIFSAEQTYELMRCLED 605          
BLAST of Nuclear pore complex protein Nup85 vs. Ensembl Xenopus
Match: pcmt1 (protein-L-isoaspartate (D-aspartate) O-methyltransferase [Source:Xenbase;Acc:XB-GENE-959017])

HSP 1 Score: 88.5817 bits (218), Expect = 1.661e-19
Identity = 60/209 (28.71%), Postives = 109/209 (52.15%), Query Frame = 1
Query:   28 SAAVTSHPSLTLMGLGYLSYCAISGPAFIYQIIDHMSLRTDRMANMIHSWCVKRKFNEIAALICKRICVSNFKTGQIGNSLVWAIKGNDCNFINRIADKLLRDLFQSNESSGDFIHVGIVDCIKDINIG---IMGKKMTFVIKFVEIQALVSAGKFEEAAKMFIHLLESQLVSRHFNLDLLLRMKPLLGHGGSLFSAEDIYKLFELLQD 645
            ++ + SH SL  +G+ Y  YC   G  ++   ++ + L T++ A      C KR+  E    ICK + + +   G++G++L W+I+  D  F   I+D+ L++  +     G+F  + ++D     N+G   ++  ++TF+ K+ E   + S  +F EAA + + L+ +++    F L LLL   PLL     +FSAE  Y+L   L+D
Sbjct:  406 ASGLFSHHSLWQLGVDYFDYCPNLGHVYLELHMERVPLNTEKKALKALRICEKRQMTEQVRSICKTMAMQSLCNGRLGSALSWSIRAKDAAFATLISDRFLKEYSE----RGNFTDLDLID-----NLGSAMLLSDRLTFLGKYREFHRMYSQEQFSEAASLLLSLMTARIAPCSFWLTLLLDALPLLEQKQVIFSAEQTYELMRCLED 605          
BLAST of Nuclear pore complex protein Nup85 vs. Ensembl Xenopus
Match: pcmt1 (protein-L-isoaspartate (D-aspartate) O-methyltransferase [Source:Xenbase;Acc:XB-GENE-959017])

HSP 1 Score: 88.5817 bits (218), Expect = 2.032e-19
Identity = 60/209 (28.71%), Postives = 108/209 (51.67%), Query Frame = 1
Query:   28 SAAVTSHPSLTLMGLGYLSYCAISGPAFIYQIIDHMSLRTDRMANMIHSWCVKRKFNEIAALICKRICVSNFKTGQIGNSLVWAIKGNDCNFINRIADKLLRDLFQSNESSGDFIHVGIVDCIKDINIG---IMGKKMTFVIKFVEIQALVSAGKFEEAAKMFIHLLESQLVSRHFNLDLLLRMKPLLGHGGSLFSAEDIYKLFELLQD 645
            ++ + SH SL  +G+ Y  YC   G  ++   ++ + L T++ A      C KR+  E    ICK + + +   G++G++L W+I+  D  F   I+D+ L++        G+F  + ++D     N+G   ++  ++TF+ K+ E   + S  +F EAA + + L+ +++    F L LLL   PLL     +FSAE  Y+L   L+D
Sbjct:  394 ASGLFSHHSLWQLGVDYFDYCPNLGHVYLELHMERVPLNTEKKALKALRICEKRQMTEQVRSICKTMAMQSLCNGRLGSALSWSIRAKDAAFATLISDRFLKEY----SERGNFTDLDLID-----NLGSAMLLSDRLTFLGKYREFHRMYSQEQFSEAASLLLSLMTARIAPCSFWLTLLLDALPLLEQKQVIFSAEQTYELMRCLED 593          
BLAST of Nuclear pore complex protein Nup85 vs. Ensembl Xenopus
Match: pcmt1 (protein-L-isoaspartate (D-aspartate) O-methyltransferase [Source:Xenbase;Acc:XB-GENE-959017])

HSP 1 Score: 88.5817 bits (218), Expect = 2.075e-19
Identity = 60/209 (28.71%), Postives = 109/209 (52.15%), Query Frame = 1
Query:   28 SAAVTSHPSLTLMGLGYLSYCAISGPAFIYQIIDHMSLRTDRMANMIHSWCVKRKFNEIAALICKRICVSNFKTGQIGNSLVWAIKGNDCNFINRIADKLLRDLFQSNESSGDFIHVGIVDCIKDINIG---IMGKKMTFVIKFVEIQALVSAGKFEEAAKMFIHLLESQLVSRHFNLDLLLRMKPLLGHGGSLFSAEDIYKLFELLQD 645
            ++ + SH SL  +G+ Y  YC   G  ++   ++ + L T++ A      C KR+  E    ICK + + +   G++G++L W+I+  D  F   I+D+ L++  +     G+F  + ++D     N+G   ++  ++TF+ K+ E   + S  +F EAA + + L+ +++    F L LLL   PLL     +FSAE  Y+L   L+D
Sbjct:  397 ASGLFSHHSLWQLGVDYFDYCPNLGHVYLELHMERVPLNTEKKALKALRICEKRQMTEQVRSICKTMAMQSLCNGRLGSALSWSIRAKDAAFATLISDRFLKEYSE----RGNFTDLDLID-----NLGSAMLLSDRLTFLGKYREFHRMYSQEQFSEAASLLLSLMTARIAPCSFWLTLLLDALPLLEQKQVIFSAEQTYELMRCLED 596          
BLAST of Nuclear pore complex protein Nup85 vs. Ensembl Mouse
Match: Nup85 (nucleoporin 85 [Source:MGI Symbol;Acc:MGI:3046173])

HSP 1 Score: 102.449 bits (254), Expect = 2.591e-24
Identity = 70/254 (27.56%), Postives = 124/254 (48.82%), Query Frame = 1
Query:   22 ETSAAVTSHPSLTLMGLGYLSYCAISGPAFIYQIIDHMSLRTDRMANMIHSWCVKRKFNEIAALICKRICVSNFKTGQIGNSLVWAIKGNDCNFINRIADKLLRDLFQSNESSGDFIHVGIVDCIKDINIG---IMGKKMTFVIKFVEIQALVSAGKFEEAAKMFIHLLESQLVSRHFNLDLLLRMKPLLGHGGSLFSAEDIYKLFELLQD-----ADCKD-----------KLTEVKELREMLIRELSLACLR 726
            E ++ + +H SL  +G+ Y  YC   G   +   I+ + L T++ A  +   C +R+  E    ICK + +   +  ++G++L W+I+  D  F   ++D+ LRD  +     G F  + ++D     N+G   ++  ++TF+ K+ E   L    +F +AA + + L+ SQ+  R F + LL    PLL     +FSAE  Y+L   L+D      +C +           + T+V+ LR  L R L+ A +R
Sbjct:  405 EYASGLFAHHSLWQLGVDYFDYCPELGRVSLELHIERIPLNTEQKALKVLRICEQRQMTEQVKSICKILAMKAVRNNRLGSALSWSIRAKDAAFATLVSDRFLRDYCE----RGCFSDLDLID-----NLGSAMMLSDRLTFLGKYREFHRLYGEKRFGDAASLLLSLMTSQIAPRSFWMTLLTDALPLLEQKQVIFSAEQTYELMRCLEDLASGRPECGEPDAQRLQDDDIETTKVEMLRLALARNLARAIIR 649          
BLAST of Nuclear pore complex protein Nup85 vs. Ensembl Mouse
Match: Nup85 (nucleoporin 85 [Source:MGI Symbol;Acc:MGI:3046173])

HSP 1 Score: 61.2326 bits (147), Expect = 1.307e-10
Identity = 36/143 (25.17%), Postives = 72/143 (50.35%), Query Frame = 1
Query:   22 ETSAAVTSHPSLTLMGLGYLSYCAISGPAFIYQIIDHMSLRTDRMANMIHSWCVKRKFNEIAALICKRICVSNFKTGQIGNSLVWAIKGNDCNFINRIADKLLRDLFQSNESSGDFIHVGIVDCIKDINIG---IMGKKMTFV 441
            E ++ + +H SL  +G+ Y  YC   G   +   I+ + L T++ A  +   C +R+  E    ICK + +   +  ++G++L W+I+  D  F   ++D+ LRD  +     G F  + ++D     N+G   ++  ++TF+
Sbjct:  147 EYASGLFAHHSLWQLGVDYFDYCPELGRVSLELHIERIPLNTEQKALKVLRICEQRQMTEQVKSICKILAMKAVRNNRLGSALSWSIRAKDAAFATLVSDRFLRDYCE----RGCFSDLDLID-----NLGSAMMLSDRLTFL 280          
BLAST of Nuclear pore complex protein Nup85 vs. Ensembl Mouse
Match: Nup85 (nucleoporin 85 [Source:MGI Symbol;Acc:MGI:3046173])

HSP 1 Score: 51.2174 bits (121), Expect = 3.134e-7
Identity = 25/94 (26.60%), Postives = 48/94 (51.06%), Query Frame = 1
Query:   22 ETSAAVTSHPSLTLMGLGYLSYCAISGPAFIYQIIDHMSLRTDRMANMIHSWCVKRKFNEIAALICKRICVSNFKTGQIGNSLVWAIKGNDCNF 303
            E ++ + +H SL  +G+ Y  YC   G   +   I+ + L T++ A  +   C +R+  E    ICK + +   +  ++G++L W+I+  D  F
Sbjct:  180 EYASGLFAHHSLWQLGVDYFDYCPELGRVSLELHIERIPLNTEQKALKVLRICEQRQMTEQVKSICKILAMKAVRNNRLGSALSWSIRAKDAAF 273          
BLAST of Nuclear pore complex protein Nup85 vs. UniProt/SwissProt
Match: sp|Q9BW27|NUP85_HUMAN (Nuclear pore complex protein Nup85 OS=Homo sapiens OX=9606 GN=NUP85 PE=1 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 7.451e-24
Identity = 68/254 (26.77%), Postives = 123/254 (48.43%), Query Frame = 1
Query:   22 ETSAAVTSHPSLTLMGLGYLSYCAISGPAFIYQIIDHMSLRTDRMANMIHSWCVKRKFNEIAALICKRICVSNFKTGQIGNSLVWAIKGNDCNFINRIADKLLRDLFQSNESSGDFIHVGIVDCIKDINIG---IMGKKMTFVIKFVEIQALVSAGKFEEAAKMFIHLLESQLVSRHFNLDLLLRMKPLLGHGGSLFSAEDIYKLFELLQDADCKDKL----------------TEVKELREMLIRELSLACLR 726
            E ++ + +HPSL  +G+ Y  YC   G   +   I+ + L T++ A  +   C +R+  E    ICK + +   +  ++G++L W+I+  D  F   ++D+ LRD  +     G F  + ++D     N+G   ++  ++TF+ K+ E   +    +F +AA + + L+ S++  R F + LL    PLL     +FSAE  Y+L   L+D   +  +                T+V+ LR  L R L+ A +R
Sbjct:  405 EYASGLFAHPSLWQLGVDYFDYCPELGRVSLELHIERIPLNTEQKALKVLRICEQRQMTEQVRSICKILAMKAVRNNRLGSALSWSIRAKDAAFATLVSDRFLRDYCE----RGCFSDLDLID-----NLGPAMMLSDRLTFLGKYREFHRMYGEKRFADAASLLLSLMTSRIAPRSFWMTLLTDALPLLEQKQVIFSAEQTYELMRCLEDLTSRRPVHGESDTEQLQDDDIETTKVEMLRLSLARNLARAIIR 649          
BLAST of Nuclear pore complex protein Nup85 vs. UniProt/SwissProt
Match: sp|Q4QQS8|NUP85_RAT (Nuclear pore complex protein Nup85 OS=Rattus norvegicus OX=10116 GN=Nup85 PE=2 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.202e-23
Identity = 70/254 (27.56%), Postives = 124/254 (48.82%), Query Frame = 1
Query:   22 ETSAAVTSHPSLTLMGLGYLSYCAISGPAFIYQIIDHMSLRTDRMANMIHSWCVKRKFNEIAALICKRICVSNFKTGQIGNSLVWAIKGNDCNFINRIADKLLRDLFQSNESSGDFIHVGIVDCIKDINIG---IMGKKMTFVIKFVEIQALVSAGKFEEAAKMFIHLLESQLVSRHFNLDLLLRMKPLLGHGGSLFSAEDIYKLFELLQD-----ADCKD-----------KLTEVKELREMLIRELSLACLR 726
            E ++ + +H SL  +G+ Y  YC   G   +   I+ + L T++ A  +   C +R+  E    ICK + +   +  ++G++L W+I+  D  F   ++D+ LRD  +     G F  + ++D     N+G   ++  ++TF+ K+ E   L    +F +AA + + L+ SQ+  R F + LL    PLL     +FSAE  Y+L   L+D      +C +           + T+V+ LR  L R L+ A +R
Sbjct:  405 EYASGLFAHHSLWQLGVDYFDYCPELGRVSLELHIERIPLNTEQKALKVLRICEQRQMTEQVGSICKILAMKAVRNNRLGSALSWSIRAKDAAFATLVSDRFLRDYCE----RGCFSDLDLID-----NLGPAMMLSDRLTFLGKYREFHRLYGEKRFGDAASLLLSLMTSQIAPRSFWMTLLTDALPLLEQKQVIFSAEQTYELMRCLEDLASRRPECGEPDAQRLQDDDIETTKVEMLRLALARNLARAIIR 649          
BLAST of Nuclear pore complex protein Nup85 vs. UniProt/SwissProt
Match: sp|Q8R480|NUP85_MOUSE (Nuclear pore complex protein Nup85 OS=Mus musculus OX=10090 GN=Nup85 PE=1 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 1.812e-23
Identity = 70/254 (27.56%), Postives = 124/254 (48.82%), Query Frame = 1
Query:   22 ETSAAVTSHPSLTLMGLGYLSYCAISGPAFIYQIIDHMSLRTDRMANMIHSWCVKRKFNEIAALICKRICVSNFKTGQIGNSLVWAIKGNDCNFINRIADKLLRDLFQSNESSGDFIHVGIVDCIKDINIG---IMGKKMTFVIKFVEIQALVSAGKFEEAAKMFIHLLESQLVSRHFNLDLLLRMKPLLGHGGSLFSAEDIYKLFELLQD-----ADCKD-----------KLTEVKELREMLIRELSLACLR 726
            E ++ + +H SL  +G+ Y  YC   G   +   I+ + L T++ A  +   C +R+  E    ICK + +   +  ++G++L W+I+  D  F   ++D+ LRD  +     G F  + ++D     N+G   ++  ++TF+ K+ E   L    +F +AA + + L+ SQ+  R F + LL    PLL     +FSAE  Y+L   L+D      +C +           + T+V+ LR  L R L+ A +R
Sbjct:  405 EYASGLFAHHSLWQLGVDYFDYCPELGRVSLELHIERIPLNTEQKALKVLRICEQRQMTEQVKSICKILAMKAVRNNRLGSALSWSIRAKDAAFATLVSDRFLRDYCE----RGCFSDLDLID-----NLGSAMMLSDRLTFLGKYREFHRLYGEKRFGDAASLLLSLMTSQIAPRSFWMTLLTDALPLLEQKQVIFSAEQTYELMRCLEDLASGRPECGEPDAQRLQDDDIETTKVEMLRLALARNLARAIIR 649          
BLAST of Nuclear pore complex protein Nup85 vs. UniProt/SwissProt
Match: sp|Q3ZC98|NUP85_BOVIN (Nuclear pore complex protein Nup85 OS=Bos taurus OX=9913 GN=NUP85 PE=2 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 2.681e-21
Identity = 59/211 (27.96%), Postives = 106/211 (50.24%), Query Frame = 1
Query:   22 ETSAAVTSHPSLTLMGLGYLSYCAISGPAFIYQIIDHMSLRTDRMANMIHSWCVKRKFNEIAALICKRICVSNFKTGQIGNSLVWAIKGNDCNFINRIADKLLRDLFQSNESSGDFIHVGIVDCIKDINIG---IMGKKMTFVIKFVEIQALVSAGKFEEAAKMFIHLLESQLVSRHFNLDLLLRMKPLLGHGGSLFSAEDIYKLFELLQD 645
            E ++ + +H SL  +G+ Y  +C   G   +   I+ + L T++ A  +   C +R+  E    ICK + +   +  ++G++L W+I+  D  F   ++D+ LRD  +     G F  + ++D     N+G   ++  ++TF+ K+ E   L     F +AA + + L+ SQ+  R F + LL    PLL     +FSAE  Y+L   L+D
Sbjct:  405 EYASGLFAHHSLWQLGVDYCDHCPELGRVSLELHIERIPLTTEQKALKVLRVCEQRQMTEQVRSICKVLAMKAVRNNRLGSALSWSIRAKDAAFATLVSDRFLRDYCE----RGCFSDLDLID-----NLGPAMMLSDRLTFLGKYREFHRLYGEKCFVDAASLLLSLMTSQIAPRSFWMTLLTDALPLLEQKQVIFSAEQTYELLRCLED 606          
BLAST of Nuclear pore complex protein Nup85 vs. UniProt/SwissProt
Match: sp|Q6DBY0|NUP85_DANRE (Nuclear pore complex protein Nup85 OS=Danio rerio OX=7955 GN=nup85 PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 2.745e-20
Identity = 59/228 (25.88%), Postives = 114/228 (50.00%), Query Frame = 1
Query:   22 ETSAAVTSHPSLTLMGLGYLSYCAISGPAFIYQIIDHMSLRTDRMANMIHSWCVKRKFNEIAALICKRICVSNFKTGQIGNSLVWAIKGNDCNFINRIADKLLRDLFQSNESSGDFIHVGIVDCIKDINIG---IMGKKMTFVIKFVEIQALVSAGKFEEAAKMFIHLLESQLVSRHFNLDLLLRMKPLLGHGGSLFSAEDIYKLFELLQDADCKDKLTEVKELREML 696
            E ++ + +H SL  + + YL +C   G  ++   I+ + L T+R AN +   C  R+ +E    ICK +     +  ++G++L W+I+  D      I+++ L+D   SN+  G F  + ++D     N+G   ++  ++TF+ K+ E   L    +F +AAK+ + L+ +++  R   + LL    PLL     +F+ +  Y+L   L++ +   K +   E  E L
Sbjct:  403 EYASGLFTHHSLWQLAVDYLDHCPEFGRVYLELQIERVPLDTERKANKVLRICEDRQMSEQVRSICKIMAKRALRNNRLGSALSWSIRAKDAALATLISERFLQDY--SNK--GSFTDLDVLD-----NLGPAMLLSDRLTFLGKYREFHRLYGENRFSDAAKLLLSLMMAKIAPRSLWMTLLTDALPLLEQEEVIFTVDQTYELMSCLEELNSGTKDSNQMEQEEDL 621          
BLAST of Nuclear pore complex protein Nup85 vs. TrEMBL
Match: A0A2K6T555 (Nuclear pore complex protein Nup85 OS=Saimiri boliviensis boliviensis OX=39432 GN=NUP85 PE=3 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 7.274e-25
Identity = 71/254 (27.95%), Postives = 126/254 (49.61%), Query Frame = 1
Query:   22 ETSAAVTSHPSLTLMGLGYLSYCAISGPAFIYQIIDHMSLRTDRMANMIHSWCVKRKFNEIAALICKRICVSNFKTGQIGNSLVWAIKGNDCNFINRIADKLLRDLFQSNESSGDFIHVGIVDCIKDINIG---IMGKKMTFVIKFVEIQALVSAGKFEEAAKMFIHLLESQLVSRHFNLDLLLRMKPLLGHGGSLFSAEDIYKLFELLQD-------------ADCKD---KLTEVKELREMLIRELSLACLR 726
            E ++ + +HPSL  +G+ Y  YC   G   +   I+ + L T++ A  +   C +R+  E    ICK + +   +  ++G++L W+I+  D  F   ++D+ LRD  +     G F  + ++D     N+G   ++  ++TF+ K+ E   +    +F +AA + + L+ SQ+  R F + LL    PLL     +FSAE  Y+L + L+D               C+D   + T+V+ LR  L R L+ A +R
Sbjct:    8 EYASGLFAHPSLWQLGVDYFDYCPELGRVSLELHIERIPLNTEQKALKVLRICEQRQMTEQVRSICKILAMKAVRNNRLGSALSWSIRAKDAAFATLVSDRFLRDYCE----RGCFSDLDLID-----NLGPAMMLSDRLTFLGKYREFHRVYGEKRFADAASLLLSLMTSQIAPRSFWMTLLTDALPLLEQKQVIFSAEQTYELMQCLEDLTSGRPVHRGPDTQQCQDDDIETTKVEMLRLALARNLARAIVR 252          
BLAST of Nuclear pore complex protein Nup85 vs. TrEMBL
Match: A0A2K5E6G8 (Nuclear pore complex protein Nup85 OS=Aotus nancymaae OX=37293 GN=NUP85 PE=3 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 3.103e-23
Identity = 71/254 (27.95%), Postives = 126/254 (49.61%), Query Frame = 1
Query:   22 ETSAAVTSHPSLTLMGLGYLSYCAISGPAFIYQIIDHMSLRTDRMANMIHSWCVKRKFNEIAALICKRICVSNFKTGQIGNSLVWAIKGNDCNFINRIADKLLRDLFQSNESSGDFIHVGIVDCIKDINIG---IMGKKMTFVIKFVEIQALVSAGKFEEAAKMFIHLLESQLVSRHFNLDLLLRMKPLLGHGGSLFSAEDIYKLFELLQD-------------ADCKD---KLTEVKELREMLIRELSLACLR 726
            E ++ + +HPSL  +G+ Y  YC   G   +   I+ + L T++ A  +   C +R+  E    ICK + +   +  ++G++L W+I+  D  F   ++D+ LRD  +     G F  + ++D     N+G   ++  ++TF+ K+ E   +    +F +AA + + L+ SQ+  R F + LL    PLL     +FSAE  Y+L + L+D               C+D   + T+V+ LR  L R L+ A +R
Sbjct:  360 EYASGLFAHPSLWQLGVDYFDYCPELGRVSLELHIERIPLNTEQKALKVLRICEQRQMTEQVRSICKILAMKAVRNNRLGSALSWSIRAKDAAFATLVSDRFLRDYCE----RGCFSDLDLID-----NLGPAMMLSDRLTFLGKYREFHRVYGEKRFADAASLLLSLMTSQIAPRSFWMTLLTDALPLLEQKQVIFSAEQTYELMQCLEDLTSGRPVHGGPDTQQCQDDDIETTKVEMLRLALARNLARAIIR 604          
BLAST of Nuclear pore complex protein Nup85 vs. TrEMBL
Match: A0A2K5E6K9 (Nuclear pore complex protein Nup85 OS=Aotus nancymaae OX=37293 GN=NUP85 PE=3 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 3.237e-23
Identity = 71/254 (27.95%), Postives = 126/254 (49.61%), Query Frame = 1
Query:   22 ETSAAVTSHPSLTLMGLGYLSYCAISGPAFIYQIIDHMSLRTDRMANMIHSWCVKRKFNEIAALICKRICVSNFKTGQIGNSLVWAIKGNDCNFINRIADKLLRDLFQSNESSGDFIHVGIVDCIKDINIG---IMGKKMTFVIKFVEIQALVSAGKFEEAAKMFIHLLESQLVSRHFNLDLLLRMKPLLGHGGSLFSAEDIYKLFELLQD-------------ADCKD---KLTEVKELREMLIRELSLACLR 726
            E ++ + +HPSL  +G+ Y  YC   G   +   I+ + L T++ A  +   C +R+  E    ICK + +   +  ++G++L W+I+  D  F   ++D+ LRD  +     G F  + ++D     N+G   ++  ++TF+ K+ E   +    +F +AA + + L+ SQ+  R F + LL    PLL     +FSAE  Y+L + L+D               C+D   + T+V+ LR  L R L+ A +R
Sbjct:  398 EYASGLFAHPSLWQLGVDYFDYCPELGRVSLELHIERIPLNTEQKALKVLRICEQRQMTEQVRSICKILAMKAVRNNRLGSALSWSIRAKDAAFATLVSDRFLRDYCE----RGCFSDLDLID-----NLGPAMMLSDRLTFLGKYREFHRVYGEKRFADAASLLLSLMTSQIAPRSFWMTLLTDALPLLEQKQVIFSAEQTYELMQCLEDLTSGRPVHGGPDTQQCQDDDIETTKVEMLRLALARNLARAIIR 642          
BLAST of Nuclear pore complex protein Nup85 vs. TrEMBL
Match: A0A2J8Y0F7 (Nuclear pore complex protein Nup85 OS=Pongo abelii OX=9601 GN=CR201_G0021363 PE=3 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 3.416e-23
Identity = 68/254 (26.77%), Postives = 123/254 (48.43%), Query Frame = 1
Query:   22 ETSAAVTSHPSLTLMGLGYLSYCAISGPAFIYQIIDHMSLRTDRMANMIHSWCVKRKFNEIAALICKRICVSNFKTGQIGNSLVWAIKGNDCNFINRIADKLLRDLFQSNESSGDFIHVGIVDCIKDINIG---IMGKKMTFVIKFVEIQALVSAGKFEEAAKMFIHLLESQLVSRHFNLDLLLRMKPLLGHGGSLFSAEDIYKLFELLQDADCKDKL----------------TEVKELREMLIRELSLACLR 726
            E ++ + +HPSL  +G+ Y  YC   G   +   I+ + L T++ A  +   C +R+  E    ICK + +   +  ++G++L W+I+  D  F   ++D+ LRD  +     G F  + ++D     N+G   ++  ++TF+ K+ E   +    +F +AA + + L+ S++  R F + LL    PLL     +FSAE  Y+L   L+D   +  +                T+V+ LR  L R L+ A +R
Sbjct:    8 EYASGLFAHPSLWQLGVDYFDYCPELGRVSLELHIERIPLNTEQKALKVLRICEQRQMTEQVRSICKILAMKAVRNNRLGSALSWSIRAKDAAFATLVSDRFLRDYCE----RGCFSDLDLID-----NLGPAMMLSDRLTFLGKYREFHRMYGEKRFADAASLLLSLMTSRIAPRSFWMTLLTDALPLLEQKQVIFSAEQTYELMRCLEDLTSRRPVHGESDTEQLQDDDIETTKVEMLRLALARNLARAIIR 252          
BLAST of Nuclear pore complex protein Nup85 vs. TrEMBL
Match: A0A2K5E6C8 (Nuclear pore complex protein Nup85 OS=Aotus nancymaae OX=37293 GN=NUP85 PE=3 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 3.459e-23
Identity = 71/254 (27.95%), Postives = 126/254 (49.61%), Query Frame = 1
Query:   22 ETSAAVTSHPSLTLMGLGYLSYCAISGPAFIYQIIDHMSLRTDRMANMIHSWCVKRKFNEIAALICKRICVSNFKTGQIGNSLVWAIKGNDCNFINRIADKLLRDLFQSNESSGDFIHVGIVDCIKDINIG---IMGKKMTFVIKFVEIQALVSAGKFEEAAKMFIHLLESQLVSRHFNLDLLLRMKPLLGHGGSLFSAEDIYKLFELLQD-------------ADCKD---KLTEVKELREMLIRELSLACLR 726
            E ++ + +HPSL  +G+ Y  YC   G   +   I+ + L T++ A  +   C +R+  E    ICK + +   +  ++G++L W+I+  D  F   ++D+ LRD  +     G F  + ++D     N+G   ++  ++TF+ K+ E   +    +F +AA + + L+ SQ+  R F + LL    PLL     +FSAE  Y+L + L+D               C+D   + T+V+ LR  L R L+ A +R
Sbjct:  405 EYASGLFAHPSLWQLGVDYFDYCPELGRVSLELHIERIPLNTEQKALKVLRICEQRQMTEQVRSICKILAMKAVRNNRLGSALSWSIRAKDAAFATLVSDRFLRDYCE----RGCFSDLDLID-----NLGPAMMLSDRLTFLGKYREFHRVYGEKRFADAASLLLSLMTSQIAPRSFWMTLLTDALPLLEQKQVIFSAEQTYELMQCLEDLTSGRPVHGGPDTQQCQDDDIETTKVEMLRLALARNLARAIIR 649          
BLAST of Nuclear pore complex protein Nup85 vs. Ensembl Cavefish
Match: nup85 (nucleoporin 85 [Source:NCBI gene;Acc:103044893])

HSP 1 Score: 91.6633 bits (226), Expect = 9.213e-21
Identity = 55/211 (26.07%), Postives = 107/211 (50.71%), Query Frame = 1
Query:   22 ETSAAVTSHPSLTLMGLGYLSYCAISGPAFIYQIIDHMSLRTDRMANMIHSWCVKRKFNEIAALICKRICVSNFKTGQIGNSLVWAIKGNDCNFINRIADKLLRDLFQSNESSGDFIHVGIVDCIKDINIG---IMGKKMTFVIKFVEIQALVSAGKFEEAAKMFIHLLESQLVSRHFNLDLLLRMKPLLGHGGSLFSAEDIYKLFELLQD 645
            E ++ + SH SL  + + Y  +C   G  ++   ++ + L T+R A  +   C +R+ NE    ICK +        ++G++L W+I+  D  F   I+++ L+D  +     G F  + ++D     N+G   ++  ++TF+ K+ E   L    +F EAAK+ + L+ +++  R F + LL+   PLL     +FS +  ++L   L++
Sbjct:  405 EYASGLFSHHSLWQLAVDYFDHCPEFGRVYLELQLERVPLETERKALKVLRICEQRQMNEQVRSICKIMAKRALSNNRLGSALSWSIRAKDAAFATLISERFLQDYCK----RGSFSDLDLID-----NLGPAMLLSDRLTFLGKYREFHRLYGEKRFTEAAKLLLSLMTAKIAPRSFWMTLLVDALPLLEQKEVIFSVDQTHELMFCLEE 606          
BLAST of Nuclear pore complex protein Nup85 vs. Ensembl Cavefish
Match: nup85 (nucleoporin 85 [Source:NCBI gene;Acc:103044893])

HSP 1 Score: 86.6557 bits (213), Expect = 5.077e-19
Identity = 51/190 (26.84%), Postives = 97/190 (51.05%), Query Frame = 1
Query:   22 ETSAAVTSHPSLTLMGLGYLSYCAISGPAFIYQIIDHMSLRTDRMANMIHSWCVKRKFNEIAALICKRICVSNFKTGQIGNSLVWAIKGNDCNFINRIADKLLRDLFQSNESSGDFIHVGIVDCIKDINIG---IMGKKMTFVIKFVEIQALVSAGKFEEAAKMFIHLLESQLVSRHFNLDLLLRMKPLL 582
            E ++ + SH SL  + + Y  +C   G  ++   ++ + L T+R A  +   C +R+ NE    ICK +        ++G++L W+I+  D  F   I+++ L+D  +     G F  + ++D     N+G   ++  ++TF+ K+ E   L    +F EAAK+ + L+ +++  R F + LL+   PLL
Sbjct:  377 EYASGLFSHHSLWQLAVDYFDHCPEFGRVYLELQLERVPLETERKALKVLRICEQRQMNEQVRSICKIMAKRALSNNRLGSALSWSIRAKDAAFATLISERFLQDYCK----RGSFSDLDLID-----NLGPAMLLSDRLTFLGKYREFHRLYGEKRFTEAAKLLLSLMTAKIAPRSFWMTLLVDALPLL 557          
BLAST of Nuclear pore complex protein Nup85 vs. Ensembl Nematostella
Match: EDO44859 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUI7])

HSP 1 Score: 95.5153 bits (236), Expect = 1.507e-22
Identity = 58/209 (27.75%), Postives = 108/209 (51.67%), Query Frame = 1
Query:   22 ETSAAVTSHPSLTLMGLGYLSYCAISGPAFIYQIIDHMSLRTDRMANMIHSWCVKRKFNEIAALICKRICVSNFKTGQIGNSLVWAIKGNDCNFINRIADKLLRDLFQSNESSGDFIHVGIVDCI-KDINIGIMGKKMTFVIKFVEIQALVSAGKFEEAAKMFIHLLESQLVSRHFNLDLLLRMKPLLGHGGSLFSAEDIYKLFELLQD 645
            E SA++ SH SL  + + YL +C   G A + + I+H+ L TD+ A  +   C        A  ICK + +   K  ++G++L W ++  D  F   I+++ L +  +    +GDF ++ ++D +  D+   ++ +++TF+ K+ E   + +   F  AA + + LL S+L  + F L LL    PLL     +F++   Y+L   L++
Sbjct:  345 EYSASLMSHHSLWQVAVDYLKHCPQYGRAHLEEYIEHLPLETDKKAMKVLRVCKHLDLPYQAQSICKTMSMRALKMDRLGSALSWCLRSKDSAFAAFISERFLEEYCK----NGDFTNLDLIDHLGSDM---LLNERLTFLGKYREFHRMYAEADFRGAATLLVSLLTSRLSPKSFWLTLLTDALPLLESNEIIFTSNQTYELMHCLEE 546          
BLAST of Nuclear pore complex protein Nup85 vs. Ensembl Medaka
Match: nup85 (nucleoporin 85 [Source:NCBI gene;Acc:101168712])

HSP 1 Score: 95.9005 bits (237), Expect = 2.900e-22
Identity = 67/254 (26.38%), Postives = 128/254 (50.39%), Query Frame = 1
Query:   22 ETSAAVTSHPSLTLMGLGYLSYCAISGPAFIYQIIDHMSLRTDRMANMIHSWCVKRKFNEIAALICKRICVSNFKTGQIGNSLVWAIKGNDCNFINRIADKLLRDLFQSNESSGDFIHVGIVDCIKDINIG---IMGKKMTFVIKFVEIQALVSAGKFEEAAKMFIHLLESQLVSRHFNLDLLLRMKPLLGHGGSLFSAEDIYKLFELLQD--------ADCKDK--------LTEVKELREMLIRELSLACLR 726
            E ++ + +H SL  + + Y  +C   G  ++   I+ + L T+R A  +   C +R+ +E    ICK + +   +  ++G++L W+I+  D  F   I+++ L+D      + G F  + ++D     N+G   ++  ++TF+ K+ E   L    +F+EAAK+ + L+ +++  R F + LL    PLL     +FSA+  Y+L   L++        +   DK        LT+V+ LR  L R L++A ++
Sbjct:  402 EYASGLFTHHSLWQLAVDYFDHCLEFGRVYLELQIERVPLDTERKALKVLRICEQRQMSEQVRSICKIMAMRALRNNRLGSALSWSIRAKDAAFATLISERFLQDYC----AKGTFSDLDLID-----NLGPAMLLSDRLTFLGKYREFHKLYGEKRFKEAAKLLLSLMTAKIAPRSFWMTLLTDALPLLEQKEVIFSADQTYELMFCLEELTSSLNTPSSDSDKSMQEEDVELTKVELLRLALSRNLAMAIVK 646          
BLAST of Nuclear pore complex protein Nup85 vs. Ensembl Medaka
Match: nup85 (nucleoporin 85 [Source:NCBI gene;Acc:101168712])

HSP 1 Score: 87.8113 bits (216), Expect = 1.768e-19
Identity = 61/238 (25.63%), Postives = 118/238 (49.58%), Query Frame = 1
Query:   22 ETSAAVTSHPSLTLMGLGYLSYCAISGPAFIYQIIDHMSLRTDRMANMIHSWCVKRKFNEIAALICKRICVSNFKTGQIGNSLVWAIKGNDCNFINRIADKLLRDLFQSNESSGDFIHVGIVDCIKDINIG---IMGKKMTFVIKFVEIQALVSAGKFEEAAKMFIHLLESQLVSRHFNLDLLLRMKPLLGHGGSLFSAEDIYKLFELLQDADCKDKLTEVKELREMLIRELSLACLR 726
            E ++ + +H SL  + + Y  +C   G  ++   I+ + L T+R A  +   C +R+ +E    ICK + +   +  ++G++L W+I+  D  F   I+++ L+D      + G F  + ++D     N+G   ++  ++TF+ K+ E   L    +F+EAAK+ + L+ +++  R F + LL    PLL         ED+              +LT+V+ LR  L R L++A ++
Sbjct:  394 EYASGLFTHHSLWQLAVDYFDHCLEFGRVYLELQIERVPLDTERKALKVLRICEQRQMSEQVRSICKIMAMRALRNNRLGSALSWSIRAKDAAFATLISERFLQDYC----AKGTFSDLDLID-----NLGPAMLLSDRLTFLGKYREFHKLYGEKRFKEAAKLLLSLMTAKIAPRSFWMTLLTDALPLLEQK----EEEDV--------------ELTKVELLRLALSRNLAMAIVK 604          
BLAST of Nuclear pore complex protein Nup85 vs. Planmine SMEST
Match: SMESG000067092.1 (SMESG000067092.1)

HSP 1 Score: 462.996 bits (1190), Expect = 2.700e-163
Identity = 224/234 (95.73%), Postives = 228/234 (97.44%), Query Frame = 1
Query:   22 ETSAAVTSHPSLTLMGLGYLSYCAISGPAFIYQIIDHMSLRTDRMANMIHSWCVKRKFNEIAALICKRICVSNFKTGQIGNSLVWAIKGNDCNFINRIADKLLRDLFQSNESSGDFIHVGIVDCIKDINIGIMGKKMTFVIKFVEIQALVSAGKFEEAAKMFIHLLESQLVSRHFNLDLLLRMKPLLGHGGSLFSAEDIYKLFELLQDADCKDKLTEVKELREMLIRELSLACL 723
            + ++   SHPSLTLMGLGYLSYCAISGPAFIYQIIDHMSLRTDRMANMIHSWCVKRKFNEIAALICKRICVSNFKTGQIGNSLVWAIKGNDCNFINRIADKLLRDLFQSNESSGDFIHVGIVDCIKDINIGIMGKKMTFVIKFVEIQALVSAGKFEEAAKMFIHLLESQLVSRHFNLDLLLRMKPLLGHG  LFS+EDIYKLFELLQDADCKDKLTEVKELREMLIRELSLACL
Sbjct:  301 QYASGFVSHPSLTLMGLGYLSYCAISGPAFIYQIIDHMSLRTDRMANMIHSWCVKRKFNEIAALICKRICVSNFKTGQIGNSLVWAIKGNDCNFINRIADKLLRDLFQSNESSGDFIHVGIVDCIKDINIGIMGKKMTFVIKFVEIQALVSAGKFEEAAKMFIHLLESQLVSRHFNLDLLLRMKPLLGHGSGLFSSEDIYKLFELLQDADCKDKLTEVKELREMLIRELSLACL 534          
BLAST of Nuclear pore complex protein Nup85 vs. Planmine SMEST
Match: SMESG000067092.1 (SMESG000067092.1)

HSP 1 Score: 463.381 bits (1191), Expect = 1.846e-162
Identity = 224/234 (95.73%), Postives = 228/234 (97.44%), Query Frame = 1
Query:   22 ETSAAVTSHPSLTLMGLGYLSYCAISGPAFIYQIIDHMSLRTDRMANMIHSWCVKRKFNEIAALICKRICVSNFKTGQIGNSLVWAIKGNDCNFINRIADKLLRDLFQSNESSGDFIHVGIVDCIKDINIGIMGKKMTFVIKFVEIQALVSAGKFEEAAKMFIHLLESQLVSRHFNLDLLLRMKPLLGHGGSLFSAEDIYKLFELLQDADCKDKLTEVKELREMLIRELSLACL 723
            + ++   SHPSLTLMGLGYLSYCAISGPAFIYQIIDHMSLRTDRMANMIHSWCVKRKFNEIAALICKRICVSNFKTGQIGNSLVWAIKGNDCNFINRIADKLLRDLFQSNESSGDFIHVGIVDCIKDINIGIMGKKMTFVIKFVEIQALVSAGKFEEAAKMFIHLLESQLVSRHFNLDLLLRMKPLLGHG  LFS+EDIYKLFELLQDADCKDKLTEVKELREMLIRELSLACL
Sbjct:  368 QYASGFVSHPSLTLMGLGYLSYCAISGPAFIYQIIDHMSLRTDRMANMIHSWCVKRKFNEIAALICKRICVSNFKTGQIGNSLVWAIKGNDCNFINRIADKLLRDLFQSNESSGDFIHVGIVDCIKDINIGIMGKKMTFVIKFVEIQALVSAGKFEEAAKMFIHLLESQLVSRHFNLDLLLRMKPLLGHGSGLFSSEDIYKLFELLQDADCKDKLTEVKELREMLIRELSLACL 601          
BLAST of Nuclear pore complex protein Nup85 vs. Planmine SMEST
Match: SMESG000067087.1 (SMESG000067087.1)

HSP 1 Score: 462.996 bits (1190), Expect = 1.596e-161
Identity = 223/234 (95.30%), Postives = 228/234 (97.44%), Query Frame = 1
Query:   22 ETSAAVTSHPSLTLMGLGYLSYCAISGPAFIYQIIDHMSLRTDRMANMIHSWCVKRKFNEIAALICKRICVSNFKTGQIGNSLVWAIKGNDCNFINRIADKLLRDLFQSNESSGDFIHVGIVDCIKDINIGIMGKKMTFVIKFVEIQALVSAGKFEEAAKMFIHLLESQLVSRHFNLDLLLRMKPLLGHGGSLFSAEDIYKLFELLQDADCKDKLTEVKELREMLIRELSLACL 723
            + ++   SHPSLTLMGLGYLSYCAISGPAFIYQIIDHMSLRTDRMANMIHSWCVKRKFNEIAALICKRICVSNFKTGQIGNSLVWAIKGNDCNFINRIADKLLRDLFQSN+SSGDFIHVGIVDCIKDINIGIMGKKMTFVIKFVEIQALVSAGKFEEAAKMFIHLLESQLVSRHFNLDLLLRMKPLLGHG  LFS+EDIYKLFELLQDADCKDKLTEVKELREMLIRELSLACL
Sbjct:  427 QYASGFVSHPSLTLMGLGYLSYCAISGPAFIYQIIDHMSLRTDRMANMIHSWCVKRKFNEIAALICKRICVSNFKTGQIGNSLVWAIKGNDCNFINRIADKLLRDLFQSNKSSGDFIHVGIVDCIKDINIGIMGKKMTFVIKFVEIQALVSAGKFEEAAKMFIHLLESQLVSRHFNLDLLLRMKPLLGHGSGLFSSEDIYKLFELLQDADCKDKLTEVKELREMLIRELSLACL 660          
BLAST of Nuclear pore complex protein Nup85 vs. Planmine SMEST
Match: SMESG000067087.1 (SMESG000067087.1)

HSP 1 Score: 370.548 bits (950), Expect = 8.087e-132
Identity = 182/186 (97.85%), Postives = 184/186 (98.92%), Query Frame = 1
Query:  166 IHSWCVKRKFNEIAALICKRICVSNFKTGQIGNSLVWAIKGNDCNFINRIADKLLRDLFQSNESSGDFIHVGIVDCIKDINIGIMGKKMTFVIKFVEIQALVSAGKFEEAAKMFIHLLESQLVSRHFNLDLLLRMKPLLGHGGSLFSAEDIYKLFELLQDADCKDKLTEVKELREMLIRELSLACL 723
            IHSWCVKRKFNEIAALICKRICVSNFKTGQIGNSLVWAIKGNDCNFINRIADKLLRDLFQSN+SSGDFIHVGIVDCIKDINIGIMGKKMTFVIKFVEIQALVSAGKFEEAAKMFIHLLESQLVSRHFNLDLLLRMKPLLGHG  LFS+EDIYKLFELLQDADCKDKLTEVKELREMLIRELSLACL
Sbjct:    8 IHSWCVKRKFNEIAALICKRICVSNFKTGQIGNSLVWAIKGNDCNFINRIADKLLRDLFQSNKSSGDFIHVGIVDCIKDINIGIMGKKMTFVIKFVEIQALVSAGKFEEAAKMFIHLLESQLVSRHFNLDLLLRMKPLLGHGSGLFSSEDIYKLFELLQDADCKDKLTEVKELREMLIRELSLACL 193          
BLAST of Nuclear pore complex protein Nup85 vs. Planmine SMEST
Match: SMESG000019960.1 (SMESG000019960.1)

HSP 1 Score: 182.956 bits (463), Expect = 2.041e-58
Identity = 95/116 (81.90%), Postives = 101/116 (87.07%), Query Frame = 1
Query:  166 IHSWCVKRKFNEIAA---LICKRICVSNFKTGQIGNSLVWAIKGNDCNFINRIADKLLRDLFQSNESSGDFIHVGIVDCIKD-INIGIMGKKMTFVIKFVEIQALVSAGKFEEAAK 501
            IHSW VKR+FNEIAA   LICK I V NFKT QIG SLVW IKGNDCNFI+RIADKLLRDLFQSNE SGDFI+VGI DC+KD INIGI+GK MTF+IKFVEIQALVSAGKFEEA K
Sbjct:   23 IHSWSVKREFNEIAAAAALICKGISVPNFKTSQIGISLVWTIKGNDCNFISRIADKLLRDLFQSNEISGDFINVGIADCVKDIINIGIVGKTMTFIIKFVEIQALVSAGKFEEARK 138          
The following BLAST results are available for this feature:
BLAST of Nuclear pore complex protein Nup85 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NUP852.990e-2626.77nucleoporin 85 [Source:HGNC Symbol;Acc:HGNC:8734][more]
NUP851.408e-2527.96nucleoporin 85 [Source:HGNC Symbol;Acc:HGNC:8734][more]
NUP851.398e-2426.77nucleoporin 85 [Source:HGNC Symbol;Acc:HGNC:8734][more]
NUP851.404e-2426.77nucleoporin 85 [Source:HGNC Symbol;Acc:HGNC:8734][more]
NUP851.552e-2426.77nucleoporin 85 [Source:HGNC Symbol;Acc:HGNC:8734][more]
back to top
BLAST of Nuclear pore complex protein Nup85 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nuclear pore complex protein Nup85 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Nup754.340e-1425.25gene:FBgn0034310 transcript:FBtr0086775[more]
back to top
BLAST of Nuclear pore complex protein Nup85 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
NUP852.088e-1925.60nucleoporin 85 [Source:HGNC Symbol;Acc:HGNC:8734][more]
back to top
BLAST of Nuclear pore complex protein Nup85 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcmt13.808e-2129.79protein-L-isoaspartate (D-aspartate) O-methyltrans... [more]
pcmt11.661e-1928.71protein-L-isoaspartate (D-aspartate) O-methyltrans... [more]
pcmt11.661e-1928.71protein-L-isoaspartate (D-aspartate) O-methyltrans... [more]
pcmt12.032e-1928.71protein-L-isoaspartate (D-aspartate) O-methyltrans... [more]
pcmt12.075e-1928.71protein-L-isoaspartate (D-aspartate) O-methyltrans... [more]
back to top
BLAST of Nuclear pore complex protein Nup85 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Nup852.591e-2427.56nucleoporin 85 [Source:MGI Symbol;Acc:MGI:3046173][more]
Nup851.307e-1025.17nucleoporin 85 [Source:MGI Symbol;Acc:MGI:3046173][more]
Nup853.134e-726.60nucleoporin 85 [Source:MGI Symbol;Acc:MGI:3046173][more]
back to top
BLAST of Nuclear pore complex protein Nup85 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9BW27|NUP85_HUMAN7.451e-2426.77Nuclear pore complex protein Nup85 OS=Homo sapiens... [more]
sp|Q4QQS8|NUP85_RAT1.202e-2327.56Nuclear pore complex protein Nup85 OS=Rattus norve... [more]
sp|Q8R480|NUP85_MOUSE1.812e-2327.56Nuclear pore complex protein Nup85 OS=Mus musculus... [more]
sp|Q3ZC98|NUP85_BOVIN2.681e-2127.96Nuclear pore complex protein Nup85 OS=Bos taurus O... [more]
sp|Q6DBY0|NUP85_DANRE2.745e-2025.88Nuclear pore complex protein Nup85 OS=Danio rerio ... [more]
back to top
BLAST of Nuclear pore complex protein Nup85 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2K6T5557.274e-2527.95Nuclear pore complex protein Nup85 OS=Saimiri boli... [more]
A0A2K5E6G83.103e-2327.95Nuclear pore complex protein Nup85 OS=Aotus nancym... [more]
A0A2K5E6K93.237e-2327.95Nuclear pore complex protein Nup85 OS=Aotus nancym... [more]
A0A2J8Y0F73.416e-2326.77Nuclear pore complex protein Nup85 OS=Pongo abelii... [more]
A0A2K5E6C83.459e-2327.95Nuclear pore complex protein Nup85 OS=Aotus nancym... [more]
back to top
BLAST of Nuclear pore complex protein Nup85 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nup859.213e-2126.07nucleoporin 85 [Source:NCBI gene;Acc:103044893][more]
nup855.077e-1926.84nucleoporin 85 [Source:NCBI gene;Acc:103044893][more]
back to top
BLAST of Nuclear pore complex protein Nup85 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nuclear pore complex protein Nup85 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nuclear pore complex protein Nup85 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO448591.507e-2227.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Nuclear pore complex protein Nup85 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nup852.900e-2226.38nucleoporin 85 [Source:NCBI gene;Acc:101168712][more]
nup851.768e-1925.63nucleoporin 85 [Source:NCBI gene;Acc:101168712][more]
back to top
BLAST of Nuclear pore complex protein Nup85 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000067092.12.700e-16395.73SMESG000067092.1[more]
SMESG000067092.11.846e-16295.73SMESG000067092.1[more]
SMESG000067087.11.596e-16195.30SMESG000067087.1[more]
SMESG000067087.18.087e-13297.85SMESG000067087.1[more]
SMESG000019960.12.041e-5881.90SMESG000019960.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011390 ID=SMED30011390|Name=Nuclear pore complex protein Nup85|organism=Schmidtea mediterranea sexual|type=transcript|length=750bp
GCAGTGAGGTAAATCGCAAATGAAACAAGCGCAGCGGTGACATCGCATCC
GAGCTTGACATTGATGGGATTGGGATATTTAAGTTATTGTGCGATATCTG
GTCCAGCATTCATTTATCAAATTATCGATCACATGAGCTTGCGAACTGAT
CGGATGGCTAATATGATTCACAGCTGGTGTGTCAAAAGGAAATTCAATGA
AATTGCCGCATTGATTTGCAAACGAATTTGTGTATCGAATTTCAAAACCG
GTCAAATCGGCAACAGCTTAGTGTGGGCTATCAAAGGAAACGATTGCAAT
TTCATCAATCGAATTGCGGACAAATTGCTGAGAGATCTATTTCAGAGCAA
CGAAAGCAGCGGGGATTTCATCCACGTCGGCATTGTCGATTGTATCAAAG
ATATCAATATCGGAATCATGGGGAAAAAGATGACATTCGTTATCAAATTT
GTCGAGATTCAAGCTCTCGTCAGCGCTGGGAAATTCGAGGAGGCCGCCAA
AATGTTTATCCATCTGCTCGAGTCGCAATTGGTTTCTCGGCATTTCAATC
TCGACCTGTTGCTGAGAATGAAACCGTTGCTTGGTCACGGTGGTAGCCTG
TTCAGTGCTGAGGACATTTACAAGCTATTTGAGCTGCTGCAAGATGCCGA
CTGCAAGGACAAGCTGACGGAAGTCAAGGAACTCAGGGAGATGCTAATCA
GAGAATTATCCTTGGCTTGCTTAAGGGGTTGGTAATAATAAATTTGATAT
back to top

protein sequence of SMED30011390-orf-1

>SMED30011390-orf-1 ID=SMED30011390-orf-1|Name=SMED30011390-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=224bp
MGLGYLSYCAISGPAFIYQIIDHMSLRTDRMANMIHSWCVKRKFNEIAAL
ICKRICVSNFKTGQIGNSLVWAIKGNDCNFINRIADKLLRDLFQSNESSG
DFIHVGIVDCIKDINIGIMGKKMTFVIKFVEIQALVSAGKFEEAAKMFIH
LLESQLVSRHFNLDLLLRMKPLLGHGGSLFSAEDIYKLFELLQDADCKDK
LTEVKELREMLIRELSLACLRGW*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006913nucleocytoplasmic transport
GO:0006406mRNA export from nucleus
GO:0006409tRNA export from nucleus
GO:0006606protein import into nucleus
GO:0006810transport
GO:0006935chemotaxis
GO:0007062sister chromatid cohesion
GO:0007077mitotic nuclear envelope disassembly
GO:0010827regulation of glucose transport
GO:0015031protein transport
GO:0016032viral process
GO:0016925protein sumoylation
GO:0019083viral transcription
GO:0030032lamellipodium assembly
GO:0031047gene silencing by RNA
GO:0045893positive regulation of transcription, DNA-templated
GO:0048246macrophage chemotaxis
GO:0051028mRNA transport
GO:0075733intracellular transport of virus
GO:1900034regulation of cellular response to heat
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR011502Nucleoporin_Nup85
Vocabulary: cellular component
TermDefinition
GO:0000775chromosome, centromeric region
GO:0000776kinetochore
GO:0000777condensed chromosome kinetochore
GO:0005634nucleus
GO:0005635nuclear envelope
GO:0005643nuclear pore
GO:0005694chromosome
GO:0005737cytoplasm
GO:0005819spindle
GO:0005829cytosol
GO:0005856cytoskeleton
GO:0016020membrane
GO:0031080nuclear pore outer ring
GO:0031965nuclear membrane
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0017056structural constituent of nuclear pore