protein phosphatase 1 regulatory subunit 12C isoform X12

Overview
Nameprotein phosphatase 1 regulatory subunit 12C isoform X12
Smed IDSMED30011384
Length (bp)2463
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of protein phosphatase 1 regulatory subunit 12C isoform X12 (SMED30011384) t-SNE clustered cells

Violin plots show distribution of expression levels for protein phosphatase 1 regulatory subunit 12C isoform X12 (SMED30011384) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of protein phosphatase 1 regulatory subunit 12C isoform X12 (SMED30011384) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for protein phosphatase 1 regulatory subunit 12C isoform X12 (SMED30011384) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011384

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30011384SMESG000010821.1 dd_Smed_v4_8624_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30011384SMESG000010821.1 dd_Smed_v4_8624_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30011384SMESG000010821.1 dd_Smed_v4_8624_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30011384SMESG000010821.1 dd_Smed_v4_8624_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30011384SMESG000010821.1 dd_Smed_v4_8624_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30011384SMESG000010821.1 dd_Smed_v4_8624_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30011384SMESG000010821.1 dd_Smed_v4_8624_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011384SMESG000010821.1 Contig48223newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011384SMESG000010821.1 Contig48223uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30011384SMESG000010821.1 dd_Smed_v4_8624_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Human
Match: PPP1R12B (protein phosphatase 1 regulatory subunit 12B [Source:HGNC Symbol;Acc:HGNC:7619])

HSP 1 Score: 204.142 bits (518), Expect = 7.932e-58
Identity = 115/302 (38.08%), Postives = 165/302 (54.64%), Query Frame = 2
Query:  128 QSNILKRQEQLNLWFDSETDKASNSIKEADK----------IKFPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKARFRRDEK 1003
            +S  ++R EQL  W  S T++     + A +          ++F     F +AC+S D  E+ +LL  G +IN    DGLTALHQACID++ ++V++LV + A ++ QD EGWTPL AA SC YL I  Y I+  A + +V+ +GE+P D +   AM   L+E++KK+ +D  + R  E   ML +  +   +    +     +GAT LHVAA+K Y +VL   L I     LN +D DGW  LH AAHW  + AC IL EA  D D      QT  +VAD+ +  +L    +K    R EK
Sbjct:   13 ESARMRRAEQLRRWRGSLTEQEPAERRGAGRQPLTRRGSPRVRFEDGAVFLAACSSGDTDEVRKLLARGADINTVNVDGLTALHQACIDENLDMVKFLVENRANVNQQDNEGWTPLHAAASCGYLNIAEYFINHGASVGIVNSEGEVPSDLAEEPAMKDLLLEQVKKQGVDLEQSRKEEEQQMLQDARQWLNSGKIEDVRQARSGATALHVAAAKGYSEVLR--LLIQAGYELNVQDYDGWTPLHAAAHWGVKEACSILAEALCDMDIRNKLGQTPFDVADEGLVEHLELLQKKQNVLRSEK 312          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Human
Match: PPP1R12B (protein phosphatase 1 regulatory subunit 12B [Source:HGNC Symbol;Acc:HGNC:7619])

HSP 1 Score: 204.912 bits (520), Expect = 8.368e-57
Identity = 115/302 (38.08%), Postives = 165/302 (54.64%), Query Frame = 2
Query:  128 QSNILKRQEQLNLWFDSETDKASNSIKEADK----------IKFPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKARFRRDEK 1003
            +S  ++R EQL  W  S T++     + A +          ++F     F +AC+S D  E+ +LL  G +IN    DGLTALHQACID++ ++V++LV + A ++ QD EGWTPL AA SC YL I  Y I+  A + +V+ +GE+P D +   AM   L+E++KK+ +D  + R  E   ML +  +   +    +     +GAT LHVAA+K Y +VL   L I     LN +D DGW  LH AAHW  + AC IL EA  D D      QT  +VAD+ +  +L    +K    R EK
Sbjct:   13 ESARMRRAEQLRRWRGSLTEQEPAERRGAGRQPLTRRGSPRVRFEDGAVFLAACSSGDTDEVRKLLARGADINTVNVDGLTALHQACIDENLDMVKFLVENRANVNQQDNEGWTPLHAAASCGYLNIAEYFINHGASVGIVNSEGEVPSDLAEEPAMKDLLLEQVKKQGVDLEQSRKEEEQQMLQDARQWLNSGKIEDVRQARSGATALHVAAAKGYSEVLR--LLIQAGYELNVQDYDGWTPLHAAAHWGVKEACSILAEALCDMDIRNKLGQTPFDVADEGLVEHLELLQKKQNVLRSEK 312          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Human
Match: PPP1R12A (protein phosphatase 1 regulatory subunit 12A [Source:HGNC Symbol;Acc:HGNC:7618])

HSP 1 Score: 206.838 bits (525), Expect = 4.170e-56
Identity = 119/294 (40.48%), Postives = 162/294 (55.10%), Query Frame = 2
Query:  143 KRQEQLNLWFDSETDKASNSIK-EADKIKFPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKARFRRDEKASIKRP 1021
            KR EQL  W  SETD     +K +  K+KF     F +AC+S D  E+ +LL  G +IN    DGLTALHQACIDD+ ++V++LV +GA I+  D EGW PL AA SC YL I  +LI   A +  V+ +G+ PLD +  EAM   L  E+ ++ +D    R  E   ML +  +   +   ++     +G T LHVAA+K Y +VL+  L I     +N KD DGW  LH AAHW    AC ILV+   D + +    QT  +VAD+++  YL E  +K      EK   K P
Sbjct:    9 KRNEQLKRWIGSETDLEPPVVKRQKTKVKFDDGAVFLAACSSGDTDEVLKLLHRGADINYANVDGLTALHQACIDDNVDMVKFLVENGANINQPDNEGWIPLHAAASCGYLDIAEFLIGQGAHVGAVNSEGDTPLDIAEEEAMEELLQNEVNRQGVDIEAARKEEERIMLRDARQWLNSGHINDVRHAKSGGTALHVAAAKGYTEVLK--LLIQAGYDVNIKDYDGWTPLHAAAHWGKEEACRILVDNLCDMEMVNKVGQTAFDVADEDILGYLEELQKKQNLLHSEKRDKKSP 300          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Human
Match: PPP1R12B (protein phosphatase 1 regulatory subunit 12B [Source:HGNC Symbol;Acc:HGNC:7619])

HSP 1 Score: 206.838 bits (525), Expect = 6.868e-55
Identity = 115/302 (38.08%), Postives = 165/302 (54.64%), Query Frame = 2
Query:  128 QSNILKRQEQLNLWFDSETDKASNSIKEADK----------IKFPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKARFRRDEK 1003
            +S  ++R EQL  W  S T++     + A +          ++F     F +AC+S D  E+ +LL  G +IN    DGLTALHQACID++ ++V++LV + A ++ QD EGWTPL AA SC YL I  Y I+  A + +V+ +GE+P D +   AM   L+E++KK+ +D  + R  E   ML +  +   +    +     +GAT LHVAA+K Y +VL   L I     LN +D DGW  LH AAHW  + AC IL EA  D D      QT  +VAD+ +  +L    +K    R EK
Sbjct:   13 ESARMRRAEQLRRWRGSLTEQEPAERRGAGRQPLTRRGSPRVRFEDGAVFLAACSSGDTDEVRKLLARGADINTVNVDGLTALHQACIDENLDMVKFLVENRANVNQQDNEGWTPLHAAASCGYLNIAEYFINHGASVGIVNSEGEVPSDLAEEPAMKDLLLEQVKKQGVDLEQSRKEEEQQMLQDARQWLNSGKIEDVRQARSGATALHVAAAKGYSEVLR--LLIQAGYELNVQDYDGWTPLHAAAHWGVKEACSILAEALCDMDIRNKLGQTPFDVADEGLVEHLELLQKKQNVLRSEK 312          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Human
Match: PPP1R12B (protein phosphatase 1 regulatory subunit 12B [Source:HGNC Symbol;Acc:HGNC:7619])

HSP 1 Score: 206.838 bits (525), Expect = 8.074e-55
Identity = 115/302 (38.08%), Postives = 165/302 (54.64%), Query Frame = 2
Query:  128 QSNILKRQEQLNLWFDSETDKASNSIKEADK----------IKFPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKARFRRDEK 1003
            +S  ++R EQL  W  S T++     + A +          ++F     F +AC+S D  E+ +LL  G +IN    DGLTALHQACID++ ++V++LV + A ++ QD EGWTPL AA SC YL I  Y I+  A + +V+ +GE+P D +   AM   L+E++KK+ +D  + R  E   ML +  +   +    +     +GAT LHVAA+K Y +VL   L I     LN +D DGW  LH AAHW  + AC IL EA  D D      QT  +VAD+ +  +L    +K    R EK
Sbjct:   13 ESARMRRAEQLRRWRGSLTEQEPAERRGAGRQPLTRRGSPRVRFEDGAVFLAACSSGDTDEVRKLLARGADINTVNVDGLTALHQACIDENLDMVKFLVENRANVNQQDNEGWTPLHAAASCGYLNIAEYFINHGASVGIVNSEGEVPSDLAEEPAMKDLLLEQVKKQGVDLEQSRKEEEQQMLQDARQWLNSGKIEDVRQARSGATALHVAAAKGYSEVLR--LLIQAGYELNVQDYDGWTPLHAAAHWGVKEACSILAEALCDMDIRNKLGQTPFDVADEGLVEHLELLQKKQNVLRSEK 312          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Celegans
Match: mel-11 (MEL-11 [Source:UniProtKB/TrEMBL;Acc:G5EEB3])

HSP 1 Score: 191.815 bits (486), Expect = 2.818e-50
Identity = 115/313 (36.74%), Postives = 159/313 (50.80%), Query Frame = 2
Query:  143 KRQEQLNLWFDSETDKASNSIKEADKIKFPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKARFRRDEKASIKRPAPSPNGEFQPSVTKIICQEK 1081
            KR++QL  W  SE +  +    +  K++F     F SAC S D  E+E LL+ G  IN    DGLTALHQ+ ID    +VR+L   GA ++AQD EGWTPL AA  C  + I  YL    A L +V+ D EL LD + +E    +L ++ K++ +D +  R++E   ML +V       ++ +      G T +HVAA + Y  +LE  L I     +  +D +GW  LH AAHW  R AC IL+E   +   LT +   VL VAD E   YL E     + +   K        SP    QP  +  I QEK
Sbjct:   25 KRKDQLRRWQSSEMNAEAARRTKRPKVQFQDSDIFLSACMSGDEEEVEELLNKGANINTCTVDGLTALHQSVIDSKPEMVRFLCEKGADVNAQDNEGWTPLHAAACCGNVAIVRYLCQHGADLSIVNSDKELALDLAVDEQCRDYLDDDYKRQMIDLDACRDQELQTMLKDVNMWMSQGEYRDIPHHRTGGTAMHVAAGRGYTQLLE--LLIKAGGNVRAQDVEGWTPLHAAAHWAERDACKILLENGAELSDLTFTGADVLGVADKECIDYLVELADTVKVQNKRK--------SPGSGSQPPTS--ILQEK 325          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Celegans
Match: mel-11 (MEL-11 [Source:UniProtKB/TrEMBL;Acc:G5EEB3])

HSP 1 Score: 191.43 bits (485), Expect = 2.927e-50
Identity = 115/313 (36.74%), Postives = 159/313 (50.80%), Query Frame = 2
Query:  143 KRQEQLNLWFDSETDKASNSIKEADKIKFPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKARFRRDEKASIKRPAPSPNGEFQPSVTKIICQEK 1081
            KR++QL  W  SE +  +    +  K++F     F SAC S D  E+E LL+ G  IN    DGLTALHQ+ ID    +VR+L   GA ++AQD EGWTPL AA  C  + I  YL    A L +V+ D EL LD + +E    +L ++ K++ +D +  R++E   ML +V       ++ +      G T +HVAA + Y  +LE  L I     +  +D +GW  LH AAHW  R AC IL+E   +   LT +   VL VAD E   YL E     + +   K        SP    QP  +  I QEK
Sbjct:   25 KRKDQLRRWQSSEMNAEAARRTKRPKVQFQDSDIFLSACMSGDEEEVEELLNKGANINTCTVDGLTALHQSVIDSKPEMVRFLCEKGADVNAQDNEGWTPLHAAACCGNVAIVRYLCQHGADLSIVNSDKELALDLAVDEQCRDYLDDDYKRQMIDLDACRDQELQTMLKDVNMWMSQGEYRDIPHHRTGGTAMHVAAGRGYTQLLE--LLIKAGGNVRAQDVEGWTPLHAAAHWAERDACKILLENGAELSDLTFTGADVLGVADKECIDYLVELADTVKVQNKRK--------SPGSGSQPPTS--ILQEK 325          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Celegans
Match: mel-11 (MEL-11 [Source:UniProtKB/TrEMBL;Acc:G5EEB3])

HSP 1 Score: 191.43 bits (485), Expect = 3.171e-50
Identity = 115/313 (36.74%), Postives = 159/313 (50.80%), Query Frame = 2
Query:  143 KRQEQLNLWFDSETDKASNSIKEADKIKFPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKARFRRDEKASIKRPAPSPNGEFQPSVTKIICQEK 1081
            KR++QL  W  SE +  +    +  K++F     F SAC S D  E+E LL+ G  IN    DGLTALHQ+ ID    +VR+L   GA ++AQD EGWTPL AA  C  + I  YL    A L +V+ D EL LD + +E    +L ++ K++ +D +  R++E   ML +V       ++ +      G T +HVAA + Y  +LE  L I     +  +D +GW  LH AAHW  R AC IL+E   +   LT +   VL VAD E   YL E     + +   K        SP    QP  +  I QEK
Sbjct:   25 KRKDQLRRWQSSEMNAEAARRTKRPKVQFQDSDIFLSACMSGDEEEVEELLNKGANINTCTVDGLTALHQSVIDSKPEMVRFLCEKGADVNAQDNEGWTPLHAAACCGNVAIVRYLCQHGADLSIVNSDKELALDLAVDEQCRDYLDDDYKRQMIDLDACRDQELQTMLKDVNMWMSQGEYRDIPHHRTGGTAMHVAAGRGYTQLLE--LLIKAGGNVRAQDVEGWTPLHAAAHWAERDACKILLENGAELSDLTFTGADVLGVADKECIDYLVELADTVKVQNKRK--------SPGSGSQPPTS--ILQEK 325          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Celegans
Match: mel-11 (MEL-11 [Source:UniProtKB/TrEMBL;Acc:G5EEB3])

HSP 1 Score: 191.43 bits (485), Expect = 4.603e-50
Identity = 115/313 (36.74%), Postives = 159/313 (50.80%), Query Frame = 2
Query:  143 KRQEQLNLWFDSETDKASNSIKEADKIKFPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKARFRRDEKASIKRPAPSPNGEFQPSVTKIICQEK 1081
            KR++QL  W  SE +  +    +  K++F     F SAC S D  E+E LL+ G  IN    DGLTALHQ+ ID    +VR+L   GA ++AQD EGWTPL AA  C  + I  YL    A L +V+ D EL LD + +E    +L ++ K++ +D +  R++E   ML +V       ++ +      G T +HVAA + Y  +LE  L I     +  +D +GW  LH AAHW  R AC IL+E   +   LT +   VL VAD E   YL E     + +   K        SP    QP  +  I QEK
Sbjct:   25 KRKDQLRRWQSSEMNAEAARRTKRPKVQFQDSDIFLSACMSGDEEEVEELLNKGANINTCTVDGLTALHQSVIDSKPEMVRFLCEKGADVNAQDNEGWTPLHAAACCGNVAIVRYLCQHGADLSIVNSDKELALDLAVDEQCRDYLDDDYKRQMIDLDACRDQELQTMLKDVNMWMSQGEYRDIPHHRTGGTAMHVAAGRGYTQLLE--LLIKAGGNVRAQDVEGWTPLHAAAHWAERDACKILLENGAELSDLTFTGADVLGVADKECIDYLVELADTVKVQNKRK--------SPGSGSQPPTS--ILQEK 325          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Celegans
Match: gfi-2 (GEI-4 (Four) Interacting protein [Source:UniProtKB/TrEMBL;Acc:Q95ZS1])

HSP 1 Score: 139.428 bits (350), Expect = 6.874e-35
Identity = 81/244 (33.20%), Postives = 127/244 (52.05%), Query Frame = 2
Query:  221 IKFPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQ---NEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADD 943
            + F  EV+   A    D++E+ERLL+D    N   DDGLT LHQ  IDD++ ++  L+  GA ++AQD E WTPL AA  C ++ I   LI   A L  V+ +G +P D  ++E     +  E+  R + Q   +E+R     AML++++ +       +    D G+T LHVA++  Y DV   LL      L+  +DND W  +H AA W       +L +   D  + T + +T +++ +D
Sbjct:   53 LHFAAEVELLEATCRADYAEVERLLNDNANPNLHNDDGLTPLHQCAIDDNQQIMLLLLERGANVNAQDTEQWTPLHAAACCAHINIVKILIQAGANLLAVNAEGNMPYDICDHEETLDVIESEMAARGITQSYIDEMRGAPEKAMLDDMKMLHQQGRELDARAPD-GSTYLHVASANGYYDVAAFLLTCSVSPLI--RDNDFWQPVHAAACWAQPDLIELLCQYGGDIHAKTKNGETPMDLCED 293          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Fly
Match: Mbs (gene:FBgn0005536 transcript:FBtr0308216)

HSP 1 Score: 204.142 bits (518), Expect = 9.317e-59
Identity = 119/319 (37.30%), Postives = 186/319 (58.31%), Query Frame = 2
Query:  131 SNILKRQEQLNLWFDSETDKASNSIKE--ADKIKFPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQS---NNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEK-IKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKARFRRDEKASIKRPAPSPNGEFQPSVTKII 1069
            S ++KR EQL  W +S+T++A+ + +     +IKF     F +AC S D  E+ +LLD G +IN    DGLTALHQACIDD+ ++V +LV  GA I+ QD EGWTPL A  SC ++ I  YL+   A +  V+ DG+L LD +    + AM  ++ + +++ N++ +E R  E  AMLN+ +K ++ +    +      GAT LHVAA+K Y  VL  LLA      ++++DNDGW  LH A+HW  R    +LVE+  D D    + Q+ ++VAD ++  +L EE+R  +  +   +S  R + +     + + TK++
Sbjct:   10 SAMMKRAEQLKRWEESDTNRAAPTPRHEHGRRIKFSSGCVFLAACLSGDKDEVVQLLDQGADINTANVDGLTALHQACIDDNLDMVEFLVERGADINRQDNEGWTPLHATASCGFVSIARYLVENGADVAAVNSDGDLALDLAIDVQHMAMIDYMEKMVQELNINVDEARKAEELAMLNDAKKWLRSDAAEVDRPHPKTGATALHVAAAKGYTKVLGLLLA--GRGNVDRQDNDGWTPLHAASHWGQRETAEMLVESLADMDIRNYAGQSCIDVADRKIVKFL-EELRANKRNKRRPSSQIRISDAMENHVEKTPTKLV 325          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Fly
Match: Mbs (gene:FBgn0005536 transcript:FBtr0112851)

HSP 1 Score: 208.764 bits (530), Expect = 1.445e-56
Identity = 115/288 (39.93%), Postives = 173/288 (60.07%), Query Frame = 2
Query:  131 SNILKRQEQLNLWFDSETDKASNSIKE--ADKIKFPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQS---NNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEK-IKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIR 976
            S ++KR EQL  W +S+T++A+ + +     +IKF     F +AC S D  E+ +LLD G +IN    DGLTALHQACIDD+ ++V +LV  GA I+ QD EGWTPL A  SC ++ I  YL+   A +  V+ DG+L LD +    + AM  ++ + +++ N++ +E R  E  AMLN+ +K ++ +    +      GAT LHVAA+K Y  VL  LLA      ++++DNDGW  LH A+HW  R    +LVE+  D D    + Q+ ++VAD ++  +L EE+R
Sbjct:   10 SAMMKRAEQLKRWEESDTNRAAPTPRHEHGRRIKFSSGCVFLAACLSGDKDEVVQLLDQGADINTANVDGLTALHQACIDDNLDMVEFLVERGADINRQDNEGWTPLHATASCGFVSIARYLVENGADVAAVNSDGDLALDLAIDVQHMAMIDYMEKMVQELNINVDEARKAEELAMLNDAKKWLRSDAAEVDRPHPKTGATALHVAAAKGYTKVLGLLLA--GRGNVDRQDNDGWTPLHAASHWGQRETAEMLVESLADMDIRNYAGQSCIDVADRKIVKFL-EELR 294          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Fly
Match: Mbs (gene:FBgn0005536 transcript:FBtr0301575)

HSP 1 Score: 209.149 bits (531), Expect = 2.091e-56
Identity = 115/288 (39.93%), Postives = 173/288 (60.07%), Query Frame = 2
Query:  131 SNILKRQEQLNLWFDSETDKASNSIKE--ADKIKFPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQS---NNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEK-IKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIR 976
            S ++KR EQL  W +S+T++A+ + +     +IKF     F +AC S D  E+ +LLD G +IN    DGLTALHQACIDD+ ++V +LV  GA I+ QD EGWTPL A  SC ++ I  YL+   A +  V+ DG+L LD +    + AM  ++ + +++ N++ +E R  E  AMLN+ +K ++ +    +      GAT LHVAA+K Y  VL  LLA      ++++DNDGW  LH A+HW  R    +LVE+  D D    + Q+ ++VAD ++  +L EE+R
Sbjct:   10 SAMMKRAEQLKRWEESDTNRAAPTPRHEHGRRIKFSSGCVFLAACLSGDKDEVVQLLDQGADINTANVDGLTALHQACIDDNLDMVEFLVERGADINRQDNEGWTPLHATASCGFVSIARYLVENGADVAAVNSDGDLALDLAIDVQHMAMIDYMEKMVQELNINVDEARKAEELAMLNDAKKWLRSDAAEVDRPHPKTGATALHVAAAKGYTKVLGLLLA--GRGNVDRQDNDGWTPLHAASHWGQRETAEMLVESLADMDIRNYAGQSCIDVADRKIVKFL-EELR 294          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Fly
Match: Mbs (gene:FBgn0005536 transcript:FBtr0112852)

HSP 1 Score: 209.92 bits (533), Expect = 2.098e-56
Identity = 119/319 (37.30%), Postives = 184/319 (57.68%), Query Frame = 2
Query:  131 SNILKRQEQLNLWFDSETDKASNSIKE--ADKIKFPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQS---NNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEK-IKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKARFRRDEKASIKRPAPSPNGEFQPSVTKII 1069
            S ++KR EQL  W +S+T++A+ + +     +IKF     F +AC S D  E+ +LLD G +IN    DGLTALHQACIDD+ ++V +LV  GA I+ QD EGWTPL A  SC ++ I  YL+   A +  V+ DG+L LD +    + AM  ++ + +++ N++ +E R  E  AMLN+ +K ++ +    +      GAT LHVAA+K Y  VL  LLA      ++++DNDGW  LH A+HW  R    +LVE+  D D    + Q+ ++VAD ++  +L E     R +R   + I R + +     + + TK++
Sbjct:   10 SAMMKRAEQLKRWEESDTNRAAPTPRHEHGRRIKFSSGCVFLAACLSGDKDEVVQLLDQGADINTANVDGLTALHQACIDDNLDMVEFLVERGADINRQDNEGWTPLHATASCGFVSIARYLVENGADVAAVNSDGDLALDLAIDVQHMAMIDYMEKMVQELNINVDEARKAEELAMLNDAKKWLRSDAAEVDRPHPKTGATALHVAAAKGYTKVLGLLLA--GRGNVDRQDNDGWTPLHAASHWGQRETAEMLVESLADMDIRNYAGQSCIDVADRKIVKFLEELRANKRNKRRPSSQISRISDAMENHVEKTPTKLV 326          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Fly
Match: Mbs (gene:FBgn0005536 transcript:FBtr0301472)

HSP 1 Score: 210.69 bits (535), Expect = 3.029e-56
Identity = 115/288 (39.93%), Postives = 173/288 (60.07%), Query Frame = 2
Query:  131 SNILKRQEQLNLWFDSETDKASNSIKE--ADKIKFPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQS---NNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEK-IKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIR 976
            S ++KR EQL  W +S+T++A+ + +     +IKF     F +AC S D  E+ +LLD G +IN    DGLTALHQACIDD+ ++V +LV  GA I+ QD EGWTPL A  SC ++ I  YL+   A +  V+ DG+L LD +    + AM  ++ + +++ N++ +E R  E  AMLN+ +K ++ +    +      GAT LHVAA+K Y  VL  LLA      ++++DNDGW  LH A+HW  R    +LVE+  D D    + Q+ ++VAD ++  +L EE+R
Sbjct:   10 SAMMKRAEQLKRWEESDTNRAAPTPRHEHGRRIKFSSGCVFLAACLSGDKDEVVQLLDQGADINTANVDGLTALHQACIDDNLDMVEFLVERGADINRQDNEGWTPLHATASCGFVSIARYLVENGADVAAVNSDGDLALDLAIDVQHMAMIDYMEKMVQELNINVDEARKAEELAMLNDAKKWLRSDAAEVDRPHPKTGATALHVAAAKGYTKVLGLLLAGRG--NVDRQDNDGWTPLHAASHWGQRETAEMLVESLADMDIRNYAGQSCIDVADRKIVKFL-EELR 294          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Zebrafish
Match: ppp1r12a (protein phosphatase 1, regulatory subunit 12A [Source:NCBI gene;Acc:445393])

HSP 1 Score: 210.69 bits (535), Expect = 3.943e-56
Identity = 124/293 (42.32%), Postives = 162/293 (55.29%), Query Frame = 2
Query:  143 KRQEQLNLWFDSETDKASNSIKEADKIK-FPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKARFRRDEKASIKR 1018
            KR EQL  W  SETD     +K+      F     F +AC+S D  E+ R+LD G +IN    DGLTALHQACIDD+ ++V +LV HGA I+  D EGW PL AA SC YL I  YLIS  A + VV+ +GE PLD +  EAM   L  E+ ++ +D    R  E   ML +  +   +   ++     +G T LHVAA+K Y +VL+  L I     +N KD DGW  LH AAHW    AC ILVE   D D +    QT  +VAD+++  YL E  +K      EK  +K+
Sbjct:   77 KRNEQLKRWIGSETDLEPPLLKKKKTKVKFDDGAVFLAACSSGDTEEVLRMLDRGADINYANVDGLTALHQACIDDNVDMVTFLVEHGACINQPDNEGWIPLHAAASCGYLDIAEYLISQGASVGVVNSEGETPLDIAEEEAMEELLQNEINRQGVDIEAARKEEERIMLRDARQWLNSGQINDVRHTKSGGTALHVAAAKGYAEVLK--LLIQAGYDVNIKDYDGWTPLHAAAHWGKEEACRILVEHLCDMDVVNKVGQTAFDVADEDILGYLEELQKKQNLLLSEKKDVKK 367          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Zebrafish
Match: ppp1r12c (protein phosphatase 1, regulatory subunit 12C [Source:ZFIN;Acc:ZDB-GENE-010724-11])

HSP 1 Score: 200.675 bits (509), Expect = 3.249e-54
Identity = 196/759 (25.82%), Postives = 335/759 (44.14%), Query Frame = 2
Query:  137 ILKRQEQLNLWFDSETDK----------ASNSIKEAD---------------KIKFPKEVQFFSACNSNDWSEIERLL-------DDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLRE-EIRKARFRRDEKASIKRPAPSPNGEFQPSVTKIICQEKINQISIVESKQVNGDKLVXXXXXXXXXXXHNNQKLNQKTLDENKELVSNVDPMDLKLNSIDVTHKTQIDPSDTEAKXXXXXXXXXXXEINENSQ-PVQEKSDHVIYXXXXXXXXXXXXXXXXQRKDKARHVRSTRRSTQGVTAEDIDEAKKLMSTVQKQEKFNMPSQISTIMENKNDTSDMSTILNHSIKSNHSEPVVTNKENFVNIKESXXXXXXXXXXXXXXXLLSETSETQPVDVQSDLSELNDRKKRTGSHLVNKRRTRERPPTGTIDLK----DIQAAQSEVKILDESEKSVDNMDNPKTVSSEIDYKQLYELECKEKDKLLRNLTRIKKELQESQDQI-RLLQNTNIVSKN----------NKIPQKSIAFQSDSDIKEVEKLREENRKMKEANSALIRVISRLS 2266
            + KR+EQL  W  S TDK             S +  D               ++ F K  +F + C S D  E + +L       +D + +NC   DG+TALHQACID    +V +L++HGA ++  D EGWTPL  A SC  L I  +L+   A L  V+ DG++PLD + +E     L + + K+ +D    +  E   ++++      +   +N      GAT LHVAA+K Y++ ++ L        ++ KD DGW  LH AAHW    AC +L E   D ++ ++  Q+  +VAD+ V   L E   R+A +R +++ S        N + + SV ++  ++KI+     + + V+G+  + +++    S   +     + T+  +       +  ++K N  D   +T + P   + +       ++TS      Q PV+++                      QRK ++R +R +RRSTQGVT  D+ EA++ +       K N P  +S                         +PV  N    V +  +                     E + ++ Q+ L   + RK R           +ER  TG + L     D+ A +   +  +  +  +D+     ++ S +DY++LY    +E   L   L   + +L ES+ Q+ +L QN    S             K+ Q+  AF+ + ++K +  LR +N+++K+ N+ALIRVIS+LS
Sbjct:    6 VAKRREQLTRWSGSSTDKEPAVPRSRWRGETSTRAPDGGRPDTNERQKKNRWRVTFEKTAEFLAVCASGDTEEAKAMLREVLLNGEDDV-VNCANADGITALHQACIDGSMEMVDFLLSHGANVNQVDSEGWTPLHVAASCGNLEIAEFLLQHGASLCSVNCDGDVPLDIAKDEDTQMLLQKHILKQGMDLEAAKRAEEEWIMHDARHWLTDGLPANLCQPRTGATPLHVAAAKGYLEAIKLLCQCGLD--VSAKDCDGWTPLHAAAHWGQSDACRLLAEQLCDMEAHSNRGQSPFDVADESVASLLEELSKRQANWRTEQQNSQTSNVNPANKKRRSSVCRMSSKDKISVQDQSKERGVSGE--LELSDERESSPESSTVSSPESTVPSS----GTTEEKEVKANDQDRASRTAVVPPTPQKRESPAESPSNTSGDGRKYQAPVRDEESEF------------------QRKARSRLMRQSRRSTQGVTLTDLKEAERSIV------KDNEPQHVSV------------------------QPVSPN----VTVTPAERDTD---------------PERESLEAQTKLGVRDRRKGR-----------KERRSTGVVQLAEENDDMDANEDAQQDNNARDHQLDD-----SIHSSLDYRKLYLRVLQENGNLKEKLQETQLQLNESKVQLEKLKQNQENGSDRPALLELERYEKKLLQRR-AFELEDELKVLVDLRADNQRLKDENAALIRVISKLS 671          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Zebrafish
Match: ppp1r16a (protein phosphatase 1, regulatory subunit 16A [Source:ZFIN;Acc:ZDB-GENE-121214-252])

HSP 1 Score: 150.984 bits (380), Expect = 5.399e-38
Identity = 94/288 (32.64%), Postives = 150/288 (52.08%), Query Frame = 2
Query:  143 KRQEQLNLWFDSETDKA--------SNSIKEADKIKFPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQ---NEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLA-IITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVA-DDEVKPYLRE 967
            +R +QL  W   E D A         + +K++ ++ F   V    A   ND  E+ +LL++G+  +   +DGLTALHQ+CIDD   + R L+  GA ++A D E WTPL AA +C +  +   LI   A L  V+ DG +P D   +EA    +   + ++ + Q   +E R  +   ML ++ ++  N    N    + GATMLHVAA+  Y+ V E LL   ++P   +++D DGW  LH AA W   +   +LV      ++ +  ++T L+V  D+EV+  + E
Sbjct:   29 RRAQQLKGWAQMEKDSARGHKADHKGDGVKKSRRVTFNSNVMLLEAAARNDIEEVRQLLNNGVSPDLFNEDGLTALHQSCIDDFLEVARCLLDAGANVNACDSELWTPLHAAATCGHTDLVQMLIEAGADLLAVNADGNMPYDLCEDEATLELIEMIMAEQGITQEKIDECRGAKERVMLTDLREMVTNGADLNVK-DEQGATMLHVAAANGYMSVGELLLEHRLSP---DERDADGWTPLHAAACWGQIQMVELLVAHGASLNAKSELDETPLDVCTDEEVRAKMME 312          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Zebrafish
Match: ppp1r16a (protein phosphatase 1, regulatory subunit 16A [Source:ZFIN;Acc:ZDB-GENE-121214-252])

HSP 1 Score: 150.984 bits (380), Expect = 5.399e-38
Identity = 94/288 (32.64%), Postives = 150/288 (52.08%), Query Frame = 2
Query:  143 KRQEQLNLWFDSETDKA--------SNSIKEADKIKFPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQ---NEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLA-IITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVA-DDEVKPYLRE 967
            +R +QL  W   E D A         + +K++ ++ F   V    A   ND  E+ +LL++G+  +   +DGLTALHQ+CIDD   + R L+  GA ++A D E WTPL AA +C +  +   LI   A L  V+ DG +P D   +EA    +   + ++ + Q   +E R  +   ML ++ ++  N    N    + GATMLHVAA+  Y+ V E LL   ++P   +++D DGW  LH AA W   +   +LV      ++ +  ++T L+V  D+EV+  + E
Sbjct:   29 RRAQQLKGWAQMEKDSARGHKADHKGDGVKKSRRVTFNSNVMLLEAAARNDIEEVRQLLNNGVSPDLFNEDGLTALHQSCIDDFLEVARCLLDAGANVNACDSELWTPLHAAATCGHTDLVQMLIEAGADLLAVNADGNMPYDLCEDEATLELIEMIMAEQGITQEKIDECRGAKERVMLTDLREMVTNGADLNVK-DEQGATMLHVAAANGYMSVGELLLEHRLSP---DERDADGWTPLHAAACWGQIQMVELLVAHGASLNAKSELDETPLDVCTDEEVRAKMME 312          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Zebrafish
Match: ppp1r16a (protein phosphatase 1, regulatory subunit 16A [Source:ZFIN;Acc:ZDB-GENE-121214-252])

HSP 1 Score: 150.984 bits (380), Expect = 5.399e-38
Identity = 94/288 (32.64%), Postives = 150/288 (52.08%), Query Frame = 2
Query:  143 KRQEQLNLWFDSETDKA--------SNSIKEADKIKFPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQ---NEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLA-IITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVA-DDEVKPYLRE 967
            +R +QL  W   E D A         + +K++ ++ F   V    A   ND  E+ +LL++G+  +   +DGLTALHQ+CIDD   + R L+  GA ++A D E WTPL AA +C +  +   LI   A L  V+ DG +P D   +EA    +   + ++ + Q   +E R  +   ML ++ ++  N    N    + GATMLHVAA+  Y+ V E LL   ++P   +++D DGW  LH AA W   +   +LV      ++ +  ++T L+V  D+EV+  + E
Sbjct:   29 RRAQQLKGWAQMEKDSARGHKADHKGDGVKKSRRVTFNSNVMLLEAAARNDIEEVRQLLNNGVSPDLFNEDGLTALHQSCIDDFLEVARCLLDAGANVNACDSELWTPLHAAATCGHTDLVQMLIEAGADLLAVNADGNMPYDLCEDEATLELIEMIMAEQGITQEKIDECRGAKERVMLTDLREMVTNGADLNVK-DEQGATMLHVAAANGYMSVGELLLEHRLSP---DERDADGWTPLHAAACWGQIQMVELLVAHGASLNAKSELDETPLDVCTDEEVRAKMME 312          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Xenopus
Match: PPP1R12A (protein phosphatase 1 regulatory subunit 12A [Source:NCBI gene;Acc:100493563])

HSP 1 Score: 214.542 bits (545), Expect = 1.332e-57
Identity = 127/297 (42.76%), Postives = 167/297 (56.23%), Query Frame = 2
Query:  143 KRQEQLNLWFDSETDKASNSIK-EADKIKFPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLD---QNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKARFRRDEKASIKRP 1021
            KR EQL  W  SETD   + IK +  K+KF     F +AC+S D  E+ +LLD G +IN    DGLTALHQACIDD+ ++V++LV HGA I+  D EGW PL AA SC YL I  YLIS  A + VV+ +G+ PLD +  EAM   L  E+    LD   +   R  E   ML +  +   +   ++     +G T LHVAA+K Y +VL+ LL       +N KD DGW  LH AAHW    AC ILVE   + +++    QT L+VAD+++  YL E  +K      EK   K P
Sbjct:    9 KRNEQLKRWIGSETDLEPHVIKRKKTKVKFDDGAVFLAACSSGDTDEVLKLLDRGADINYANVDGLTALHQACIDDNIDMVKFLVEHGAGINQPDNEGWIPLHAASSCGYLDIAEYLISKGASVGVVNSEGDTPLDIAEEEAMEDLLQNEVDT-PLDIAEEEAARKEEERIMLRDARQWLNSGQINDIRHSKSGGTALHVAAAKGYTEVLKLLLQAGYD--VNVKDFDGWTPLHAAAHWGKEEACKILVENFCNIEAVNKVGQTALDVADEDILSYLEELQKKQNLLLSEKQEKKSP 302          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Xenopus
Match: PPP1R12A (protein phosphatase 1 regulatory subunit 12A [Source:NCBI gene;Acc:100493563])

HSP 1 Score: 211.846 bits (538), Expect = 9.727e-57
Identity = 124/283 (43.82%), Postives = 165/283 (58.30%), Query Frame = 2
Query:  143 KRQEQLNLWFDSETDKASNSIK-EADKIKFPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLD---QNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRK 979
            KR EQL  W  SETD   + IK +  K+KF     F +AC+S D  E+ +LLD G +IN    DGLTALHQACIDD+ ++V++LV HGA I+  D EGW PL AA SC YL I  YLIS  A + VV+ +G+ PLD +  EAM   L  E+    LD   +   R  E   ML +  +   +   ++     +G T LHVAA+K Y +VL+ LL       +N KD DGW  LH AAHW    AC ILVE   + +++    QT L+VAD+++  YL EE++K
Sbjct:    9 KRNEQLKRWIGSETDLEPHVIKRKKTKVKFDDGAVFLAACSSGDTDEVLKLLDRGADINYANVDGLTALHQACIDDNIDMVKFLVEHGAGINQPDNEGWIPLHAASSCGYLDIAEYLISKGASVGVVNSEGDTPLDIAEEEAMEDLLQNEVDT-PLDIAEEEAARKEEERIMLRDARQWLNSGQINDIRHSKSGGTALHVAAAKGYTEVLKLLLQAGYD--VNVKDFDGWTPLHAAAHWGKEEACKILVENFCNIEAVNKVGQTALDVADEDILSYL-EELQK 287          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Xenopus
Match: lcp1 (lymphocyte cytosolic protein 1 (L-plastin) [Source:Xenbase;Acc:XB-GENE-962206])

HSP 1 Score: 197.978 bits (502), Expect = 1.870e-52
Identity = 110/284 (38.73%), Postives = 157/284 (55.28%), Query Frame = 2
Query:  221 IKFPKEVQFFSACNSNDWSEIERLL--DDGIE-INCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLL-AIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKARFRRDEKASIKRPAPSPNGEFQPSVT 1060
            ++F +  +F +AC + D  E E +L  D G E I+ T  DG++ALHQACID++  +V +LV HGA ++  D EGWTPL  A SC Y+ I  YL+  +A +  V+ DG++PLD + ++ M + L  E+ K  +D    +  E   ML +  +        +      GA+ LHVAA+K YI+V+  LL A   P   N +D DGW  LH AAHW    AC +LVE   D ++L S  Q   +VAD++V   L E  +K    R+EK + KR     N E  PS T
Sbjct:   69 VRFERSAEFLAACAAGDLLEAEDMLTRDSGKEVIDSTNTDGISALHQACIDENLEVVEFLVNHGANVNQADNEGWTPLHVAASCGYMEIAEYLLKHSANIAAVNSDGDVPLDIAEDDCMENLLRAEIAKGGVDIEAAKREEEEVMLRDSRQWLNAGKIEDIRHSKTGASALHVAAAKGYIEVMRLLLQANFDP---NARDKDGWTPLHAAAHWGVEEACRLLVEHFCDMNALNSVGQRPCDVADEDVLSLLEELRKKQEDLRNEKEANKRAVIDTNMEQHPSYT 349          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Xenopus
Match: lcp1 (lymphocyte cytosolic protein 1 (L-plastin) [Source:Xenbase;Acc:XB-GENE-962206])

HSP 1 Score: 197.978 bits (502), Expect = 2.500e-52
Identity = 110/284 (38.73%), Postives = 157/284 (55.28%), Query Frame = 2
Query:  221 IKFPKEVQFFSACNSNDWSEIERLL--DDGIE-INCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLL-AIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKARFRRDEKASIKRPAPSPNGEFQPSVT 1060
            ++F +  +F +AC + D  E E +L  D G E I+ T  DG++ALHQACID++  +V +LV HGA ++  D EGWTPL  A SC Y+ I  YL+  +A +  V+ DG++PLD + ++ M + L  E+ K  +D    +  E   ML +  +        +      GA+ LHVAA+K YI+V+  LL A   P   N +D DGW  LH AAHW    AC +LVE   D ++L S  Q   +VAD++V   L E  +K    R+EK + KR     N E  PS T
Sbjct:   69 VRFERSAEFLAACAAGDLLEAEDMLTRDSGKEVIDSTNTDGISALHQACIDENLEVVEFLVNHGANVNQADNEGWTPLHVAASCGYMEIAEYLLKHSANIAAVNSDGDVPLDIAEDDCMENLLRAEIAKGGVDIEAAKREEEEVMLRDSRQWLNAGKIEDIRHSKTGASALHVAAAKGYIEVMRLLLQANFDP---NARDKDGWTPLHAAAHWGVEEACRLLVEHFCDMNALNSVGQRPCDVADEDVLSLLEELRKKQEDLRNEKEANKRAVIDTNMEQHPSYT 349          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Xenopus
Match: lcp1 (lymphocyte cytosolic protein 1 (L-plastin) [Source:Xenbase;Acc:XB-GENE-962206])

HSP 1 Score: 197.593 bits (501), Expect = 3.184e-52
Identity = 110/284 (38.73%), Postives = 157/284 (55.28%), Query Frame = 2
Query:  221 IKFPKEVQFFSACNSNDWSEIERLL--DDGIE-INCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLL-AIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKARFRRDEKASIKRPAPSPNGEFQPSVT 1060
            ++F +  +F +AC + D  E E +L  D G E I+ T  DG++ALHQACID++  +V +LV HGA ++  D EGWTPL  A SC Y+ I  YL+  +A +  V+ DG++PLD + ++ M + L  E+ K  +D    +  E   ML +  +        +      GA+ LHVAA+K YI+V+  LL A   P   N +D DGW  LH AAHW    AC +LVE   D ++L S  Q   +VAD++V   L E  +K    R+EK + KR     N E  PS T
Sbjct:   69 VRFERSAEFLAACAAGDLLEAEDMLTRDSGKEVIDSTNTDGISALHQACIDENLEVVEFLVNHGANVNQADNEGWTPLHVAASCGYMEIAEYLLKHSANIAAVNSDGDVPLDIAEDDCMENLLRAEIAKGGVDIEAAKREEEEVMLRDSRQWLNAGKIEDIRHSKTGASALHVAAAKGYIEVMRLLLQANFDP---NARDKDGWTPLHAAAHWGVEEACRLLVEHFCDMNALNSVGQRPCDVADEDVLSLLEELRKKQEDLRNEKEANKRAVIDTNMEQHPSYT 349          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Mouse
Match: Ppp1r12a (protein phosphatase 1, regulatory subunit 12A [Source:MGI Symbol;Acc:MGI:1309528])

HSP 1 Score: 209.534 bits (532), Expect = 6.066e-56
Identity = 120/294 (40.82%), Postives = 163/294 (55.44%), Query Frame = 2
Query:  143 KRQEQLNLWFDSETDKASNSIK-EADKIKFPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKARFRRDEKASIKRP 1021
            KR EQL  W  SETD     +K +  K+KF     F +AC+S D  E+ +LL  G +IN    DGLTALHQACIDD+ ++V++LV +GA I+  D EGW PL AA SC YL I  +LI   A +  V+ +G+ PLD +  EAM   L  E+ ++ +D    R  E   ML +  +   +   S+     +G T LHVAA+K Y +VL+  L I     +N KD DGW  LH AAHW    AC ILV+   D +++    QT  +VAD+++  YL E  +K      EK   K P
Sbjct:    9 KRNEQLKRWIGSETDLEPPVVKRQKTKVKFDDGAVFLAACSSGDTDEVLKLLHRGADINYANVDGLTALHQACIDDNVDMVKFLVENGANINQPDNEGWIPLHAAASCGYLDIAEFLIGQGAHVGAVNSEGDTPLDIAEEEAMEELLQNEVNRQGVDIEAARKEEERVMLRDARQWLNSGHISDVRHAKSGGTALHVAAAKGYTEVLK--LLIQAGYDVNIKDYDGWTPLHAAAHWGKEEACRILVDNLCDMETVNKVGQTAFDVADEDILGYLEELQKKQTLLHSEKRDKKSP 300          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Mouse
Match: Ppp1r12a (protein phosphatase 1, regulatory subunit 12A [Source:MGI Symbol;Acc:MGI:1309528])

HSP 1 Score: 209.534 bits (532), Expect = 7.041e-56
Identity = 120/294 (40.82%), Postives = 163/294 (55.44%), Query Frame = 2
Query:  143 KRQEQLNLWFDSETDKASNSIK-EADKIKFPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKARFRRDEKASIKRP 1021
            KR EQL  W  SETD     +K +  K+KF     F +AC+S D  E+ +LL  G +IN    DGLTALHQACIDD+ ++V++LV +GA I+  D EGW PL AA SC YL I  +LI   A +  V+ +G+ PLD +  EAM   L  E+ ++ +D    R  E   ML +  +   +   S+     +G T LHVAA+K Y +VL+  L I     +N KD DGW  LH AAHW    AC ILV+   D +++    QT  +VAD+++  YL E  +K      EK   K P
Sbjct:    9 KRNEQLKRWIGSETDLEPPVVKRQKTKVKFDDGAVFLAACSSGDTDEVLKLLHRGADINYANVDGLTALHQACIDDNVDMVKFLVENGANINQPDNEGWIPLHAAASCGYLDIAEFLIGQGAHVGAVNSEGDTPLDIAEEEAMEELLQNEVNRQGVDIEAARKEEERVMLRDARQWLNSGHISDVRHAKSGGTALHVAAAKGYTEVLK--LLIQAGYDVNIKDYDGWTPLHAAAHWGKEEACRILVDNLCDMETVNKVGQTAFDVADEDILGYLEELQKKQTLLHSEKRDKKSP 300          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Mouse
Match: Ppp1r12b (protein phosphatase 1, regulatory subunit 12B [Source:MGI Symbol;Acc:MGI:1916417])

HSP 1 Score: 207.994 bits (528), Expect = 1.775e-55
Identity = 107/262 (40.84%), Postives = 152/262 (58.02%), Query Frame = 2
Query:  218 KIKFPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKARFRRDEK 1003
            +++F     F +AC+S D  E+++LL  G +IN    DGLTALHQACID++ ++V++LV + A ++ QD EGWTPL AA SC YL I  Y IS  A + +V+ +GE+P D +   AM   L+E++KK+ +D  + R  E   ML +  +   +    +     +GAT LHVAA+K Y +VL   L I     LN +D+DGW  LH AAHW  + AC IL EA  D D      QT  +VAD+ +  +L    +K    R EK
Sbjct:   53 RVRFEDGAVFLAACSSGDTDEVKKLLARGADINTVNVDGLTALHQACIDENLDMVKFLVENRANVNQQDNEGWTPLHAAASCGYLNIAEYFISHGASVGIVNSEGEVPSDLAEEPAMKDLLLEQVKKQGVDLEQSRKEEEQQMLQDARQWLNSGRIEDVRQARSGATALHVAAAKGYSEVLR--LLIQAGYELNVQDHDGWTPLHAAAHWGVKEACSILAEALCDMDIRNKLGQTPFDVADEGLVEHLEMLQKKQDVLRSEK 312          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Mouse
Match: Ppp1r12b (protein phosphatase 1, regulatory subunit 12B [Source:MGI Symbol;Acc:MGI:1916417])

HSP 1 Score: 205.682 bits (522), Expect = 1.319e-54
Identity = 107/262 (40.84%), Postives = 152/262 (58.02%), Query Frame = 2
Query:  218 KIKFPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKARFRRDEK 1003
            +++F     F +AC+S D  E+++LL  G +IN    DGLTALHQACID++ ++V++LV + A ++ QD EGWTPL AA SC YL I  Y IS  A + +V+ +GE+P D +   AM   L+E++KK+ +D  + R  E   ML +  +   +    +     +GAT LHVAA+K Y +VL   L I     LN +D+DGW  LH AAHW  + AC IL EA  D D      QT  +VAD+ +  +L    +K    R EK
Sbjct:   53 RVRFEDGAVFLAACSSGDTDEVKKLLARGADINTVNVDGLTALHQACIDENLDMVKFLVENRANVNQQDNEGWTPLHAAASCGYLNIAEYFISHGASVGIVNSEGEVPSDLAEEPAMKDLLLEQVKKQGVDLEQSRKEEEQQMLQDARQWLNSGRIEDVRQARSGATALHVAAAKGYSEVLR--LLIQAGYELNVQDHDGWTPLHAAAHWGVKEACSILAEALCDMDIRNKLGQTPFDVADEGLVEHLEMLQKKQDVLRSEK 312          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Mouse
Match: Ppp1r12b (protein phosphatase 1, regulatory subunit 12B [Source:MGI Symbol;Acc:MGI:1916417])

HSP 1 Score: 205.682 bits (522), Expect = 1.319e-54
Identity = 107/262 (40.84%), Postives = 152/262 (58.02%), Query Frame = 2
Query:  218 KIKFPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKARFRRDEK 1003
            +++F     F +AC+S D  E+++LL  G +IN    DGLTALHQACID++ ++V++LV + A ++ QD EGWTPL AA SC YL I  Y IS  A + +V+ +GE+P D +   AM   L+E++KK+ +D  + R  E   ML +  +   +    +     +GAT LHVAA+K Y +VL   L I     LN +D+DGW  LH AAHW  + AC IL EA  D D      QT  +VAD+ +  +L    +K    R EK
Sbjct:   53 RVRFEDGAVFLAACSSGDTDEVKKLLARGADINTVNVDGLTALHQACIDENLDMVKFLVENRANVNQQDNEGWTPLHAAASCGYLNIAEYFISHGASVGIVNSEGEVPSDLAEEPAMKDLLLEQVKKQGVDLEQSRKEEEQQMLQDARQWLNSGRIEDVRQARSGATALHVAAAKGYSEVLR--LLIQAGYELNVQDHDGWTPLHAAAHWGVKEACSILAEALCDMDIRNKLGQTPFDVADEGLVEHLEMLQKKQDVLRSEK 312          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. UniProt/SwissProt
Match: sp|Q6DRG7|MYPT1_DANRE (Protein phosphatase 1 regulatory subunit 12A OS=Danio rerio OX=7955 GN=ppp1r12a PE=2 SV=2)

HSP 1 Score: 210.305 bits (534), Expect = 2.696e-55
Identity = 124/293 (42.32%), Postives = 162/293 (55.29%), Query Frame = 2
Query:  143 KRQEQLNLWFDSETDKASNSIKEADKIK-FPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKARFRRDEKASIKR 1018
            KR EQL  W  SETD     +K+      F     F +AC+S D  E+ R+LD G +IN    DGLTALHQACIDD+ ++V +LV HGA I+  D EGW PL AA SC YL I  YLIS  A + VV+ +GE PLD +  EAM   L  E+ ++ +D    R  E   ML +  +   +   ++     +G T LHVAA+K Y +VL+  L I     +N KD DGW  LH AAHW    AC ILVE   D D +    QT  +VAD+++  YL E  +K      EK  +K+
Sbjct:    9 KRNEQLKRWIGSETDLEPPLLKKKKTKVKFDDGAVFLAACSSGDTEEVLRMLDRGADINYANVDGLTALHQACIDDNVDMVTFLVEHGACINQPDNEGWIPLHAAASCGYLDIAEYLISQGASVGVVNSEGETPLDIAEEEAMEELLQNEINRQGVDIEAARKEEERIMLRDARQWLNSGQINDVRHTKSGGTALHVAAAKGYAEVLK--LLIQAGYDVNIKDYDGWTPLHAAAHWGKEEACRILVEHLCDMDVVNKVGQTAFDVADEDILGYLEELQKKQNLLLSEKKDVKK 299          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. UniProt/SwissProt
Match: sp|Q9DBR7|MYPT1_MOUSE (Protein phosphatase 1 regulatory subunit 12A OS=Mus musculus OX=10090 GN=Ppp1r12a PE=1 SV=2)

HSP 1 Score: 209.534 bits (532), Expect = 4.925e-55
Identity = 120/294 (40.82%), Postives = 163/294 (55.44%), Query Frame = 2
Query:  143 KRQEQLNLWFDSETDKASNSIK-EADKIKFPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKARFRRDEKASIKRP 1021
            KR EQL  W  SETD     +K +  K+KF     F +AC+S D  E+ +LL  G +IN    DGLTALHQACIDD+ ++V++LV +GA I+  D EGW PL AA SC YL I  +LI   A +  V+ +G+ PLD +  EAM   L  E+ ++ +D    R  E   ML +  +   +   S+     +G T LHVAA+K Y +VL+  L I     +N KD DGW  LH AAHW    AC ILV+   D +++    QT  +VAD+++  YL E  +K      EK   K P
Sbjct:    9 KRNEQLKRWIGSETDLEPPVVKRQKTKVKFDDGAVFLAACSSGDTDEVLKLLHRGADINYANVDGLTALHQACIDDNVDMVKFLVENGANINQPDNEGWIPLHAAASCGYLDIAEFLIGQGAHVGAVNSEGDTPLDIAEEEAMEELLQNEVNRQGVDIEAARKEEERVMLRDARQWLNSGHISDVRHAKSGGTALHVAAAKGYTEVLK--LLIQAGYDVNIKDYDGWTPLHAAAHWGKEEACRILVDNLCDMETVNKVGQTAFDVADEDILGYLEELQKKQTLLHSEKRDKKSP 300          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. UniProt/SwissProt
Match: sp|Q10728|MYPT1_RAT (Protein phosphatase 1 regulatory subunit 12A OS=Rattus norvegicus OX=10116 GN=Ppp1r12a PE=1 SV=2)

HSP 1 Score: 209.534 bits (532), Expect = 5.271e-55
Identity = 120/294 (40.82%), Postives = 163/294 (55.44%), Query Frame = 2
Query:  143 KRQEQLNLWFDSETDKASNSIK-EADKIKFPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKARFRRDEKASIKRP 1021
            KR EQL  W  SETD     +K +  K+KF     F +AC+S D  E+ +LL  G +IN    DGLTALHQACIDD+ ++V++LV +GA I+  D EGW PL AA SC YL I  +LI   A +  V+ +G+ PLD +  EAM   L  E+ ++ +D    R  E   ML +  +   +   S+     +G T LHVAA+K Y +VL+  L I     +N KD DGW  LH AAHW    AC ILV+   D +++    QT  +VAD+++  YL E  +K      EK   K P
Sbjct:    9 KRNEQLKRWIGSETDLEPPVVKRQKTKVKFDDGAVFLAACSSGDTDEVLKLLHRGADINYANVDGLTALHQACIDDNVDMVKFLVENGANINQPDNEGWIPLHAAASCGYLDIAEFLIGQGAHVGAVNSEGDTPLDIAEEEAMEELLQNEVNRQGVDIEAARKEEERIMLRDARQWLNSGHISDVRHAKSGGTALHVAAAKGYTEVLK--LLIQAGYDVNIKDYDGWTPLHAAAHWGKEEACRILVDNLCDMETVNKVGQTAFDVADEDILGYLEELQKKQNLLHSEKRDKKSP 300          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. UniProt/SwissProt
Match: sp|Q8BG95|MYPT2_MOUSE (Protein phosphatase 1 regulatory subunit 12B OS=Mus musculus OX=10090 GN=Ppp1r12b PE=1 SV=2)

HSP 1 Score: 207.994 bits (528), Expect = 1.242e-54
Identity = 107/262 (40.84%), Postives = 152/262 (58.02%), Query Frame = 2
Query:  218 KIKFPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKARFRRDEK 1003
            +++F     F +AC+S D  E+++LL  G +IN    DGLTALHQACID++ ++V++LV + A ++ QD EGWTPL AA SC YL I  Y IS  A + +V+ +GE+P D +   AM   L+E++KK+ +D  + R  E   ML +  +   +    +     +GAT LHVAA+K Y +VL   L I     LN +D+DGW  LH AAHW  + AC IL EA  D D      QT  +VAD+ +  +L    +K    R EK
Sbjct:   53 RVRFEDGAVFLAACSSGDTDEVKKLLARGADINTVNVDGLTALHQACIDENLDMVKFLVENRANVNQQDNEGWTPLHAAASCGYLNIAEYFISHGASVGIVNSEGEVPSDLAEEPAMKDLLLEQVKKQGVDLEQSRKEEEQQMLQDARQWLNSGRIEDVRQARSGATALHVAAAKGYSEVLR--LLIQAGYELNVQDHDGWTPLHAAAHWGVKEACSILAEALCDMDIRNKLGQTPFDVADEGLVEHLEMLQKKQDVLRSEK 312          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. UniProt/SwissProt
Match: sp|Q90623|MYPT1_CHICK (Protein phosphatase 1 regulatory subunit 12A OS=Gallus gallus OX=9031 GN=PPP1R12A PE=1 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 2.203e-54
Identity = 122/294 (41.50%), Postives = 165/294 (56.12%), Query Frame = 2
Query:  143 KRQEQLNLWFDSETD-KASNSIKEADKIKFPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKARFRRDEKASIKRP 1021
            KR EQL  W  SETD +     ++  K+KF     F +AC+S D  E+ RLL+ G +IN    DGLTALHQACIDD+ ++V++LV +GA I+  D EGW PL AA SC YL I  YLIS  A +  V+ +G+ PLD +  EAM   L  E+ ++ +D    R  E   ML +  +   +   ++     +G T LHVAA+K Y +VL+  L I     +N KD DGW  LH AAHW    AC ILVE   D +++    QT  +VAD+++  YL E  +K      EK   K P
Sbjct:    9 KRNEQLKRWIGSETDLEPPVVKRKKTKVKFDDGAVFLAACSSGDTEEVLRLLERGADINYANVDGLTALHQACIDDNVDMVKFLVENGANINQPDNEGWIPLHAAASCGYLDIAEYLISQGAHVGAVNSEGDTPLDIAEEEAMEELLQNEVNRQGVDIEAARKEEERIMLRDARQWLNSGHINDVRHAKSGGTALHVAAAKGYTEVLK--LLIQARYDVNIKDYDGWTPLHAAAHWGKEEACRILVENLCDMEAVNKVGQTAFDVADEDILGYLEELQKKQNLLHSEKREKKSP 300          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. TrEMBL
Match: A0A1B6M0P1 (ANK_REP_REGION domain-containing protein (Fragment) OS=Graphocephala atropunctata OX=36148 GN=g.38359 PE=4 SV=1)

HSP 1 Score: 218.394 bits (555), Expect = 2.674e-60
Identity = 117/284 (41.20%), Postives = 164/284 (57.75%), Query Frame = 2
Query:  131 SNILKRQEQLNLWFDSETDKASNSIKEADK-IKFPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRK 979
            S + KR EQL  W +S+T++ S  + E  K IKF  +  F +AC + D  E+ RLLD G  I+    DGL+ALHQACIDD+ ++V +LV HGA ++  D EGWTPL A  SC ++ I  +LI   A +  V+ DGELP+D + ++ M   L + +  + +D +E RN E   ML +  +  +  +         GAT LHVAA+K YI V+E LL       ++ +D DGW  LH AAHW  + +C +LVE   D D      QT L+VAD E+   L EE+RK
Sbjct:    8 SALFKRAEQLRRWEESDTNRESTVVTEKSKRIKFSSDCVFLAACAAGDKEEVLRLLDTGAVIDTVNVDGLSALHQACIDDNLDMVEFLVKHGADVNKGDNEGWTPLHATASCGFISIAKFLIEHGANVASVNNDGELPVDIAESDEMEDMLQQHIDDQGIDCDEARNEEERMMLKDAREWLVTGEVRETPHTKTGATALHVAAAKGYIKVMELLLQARAD--VDGQDVDGWTPLHAAAHWGQKESCELLVEHYCDMDMKNVVGQTALDVADSEMVRVL-EELRK 288          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. TrEMBL
Match: A0A4Z2DPY9 (Protein phosphatase 1 regulatory subunit 12B isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_010169 PE=4 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 4.807e-60
Identity = 121/290 (41.72%), Postives = 173/290 (59.66%), Query Frame = 2
Query:  143 KRQEQLNLWFDSETDKASNSIKEADKIKFPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPEL-LNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKARFRRDEKAS 1009
            +R+ QL  W  SETD AS+ ++E DKIKFP  VQ  +AC+++D  E  RLL  G +IN    DGLT+ H ACI+ D + +++L+++GA I+ QD EGWTPL AA S     +  +LI   A L V+S D ELP+D + +E M + L + +KK+N+D + I++ E   +L++ +    +  +        GAT LHVAA KDY   +E LL I  P L +N KD DGW ALH AAHWN   +  +L  A   FD  T ++Q+V +VAD E+   LR+   + R  R   +S
Sbjct:   14 RRKAQLKEWCGSETDHASSKMREPDKIKFPLSVQLLAACSNSDLDEFSRLLKLGTDINTQNADGLTSTHLACINVDFDFLKFLISNGADINLQDHEGWTPLHAAASVGCCELARFLIENGADLSVLSVDLELPIDVAQDEEMINLLTDAMKKQNVDADAIKHSEEQMLLHDAQHWLTSGQYKPVVDSRTGATPLHVAACKDYTKAMEILLQI--PGLDINAKDFDGWTALHAAAHWNREASARMLANAGASFDEHTRASQSVFDVADKEMIVLLRQLRERQRAERQSNSS 301          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. TrEMBL
Match: A0A3B4DUR9 (Protein phosphatase 1 regulatory subunit OS=Pygocentrus nattereri OX=42514 PE=4 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 1.097e-59
Identity = 126/293 (43.00%), Postives = 164/293 (55.97%), Query Frame = 2
Query:  143 KRQEQLNLWFDSETDKASNSI-KEADKIKFPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKARFRRDEKASIKR 1018
            KR EQL  W  SETD     + K+  K+KF     F +AC+S D  E+ RLLD G +IN    DGLTALHQACIDD+ ++V +LV HGA I+  D EGW PL AA SC Y+ I  YLIS  A + +V+ +GE PLD +  E M   L  E+ ++ +D    R  E   ML +  +   +   S+     +G T LHVAA+K Y +VL+  L I     +N KD DGW  LH AAHW    AC ILVE   D D +    QT  +VAD++V  YL E  +K      EK  +K+
Sbjct:    9 KRNEQLKRWLGSETDLEPPVLRKKKTKVKFDDGAVFLAACSSGDTEEVLRLLDRGADINYANVDGLTALHQACIDDNVDMVTFLVEHGACINQPDNEGWIPLHAAASCGYMDIAEYLISQGANVGMVNSEGETPLDIAEEEPMEELLQNEINRQGVDIEAARKEEERIMLRDARQWLNSGQISDVRHAKSGGTALHVAAAKGYAEVLK--LLIQAGYDVNIKDYDGWTPLHAAAHWGKEEACRILVENMCDMDVINKVGQTAFDVADEDVLGYLEELQKKQNLLMSEKKDVKK 299          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. TrEMBL
Match: G4LWS8 (Protein phosphatase 1 regulatory subunit 12b (Myosin phosphatase targeting subunit 2), putative OS=Schistosoma mansoni OX=6183 GN=Smp_143370 PE=4 SV=1)

HSP 1 Score: 230.72 bits (587), Expect = 1.327e-59
Identity = 120/290 (41.38%), Postives = 173/290 (59.66%), Query Frame = 2
Query:  143 KRQEQLNLWFDSETDKASNSIKEADKIKFPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPEL-LNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKARFRRDEKAS 1009
            +R+ QL  W  SETD AS+ ++E +KIKFP  VQ  +AC+++D  E  RLL  G +IN    DGLT+ H ACI+ D + +++L+++GA I+ QD EGWTPL AA S     +  +LI   A L ++S D ELP+D + +E M + L + +KK+N+D + I++ E   +L++ +    +  +        GAT LHVAA KDY   +E LL I  P L +N KD DGW ALH AAHWN   +  +L  A   FD  T ++Q+V +VAD E+   LR+   + R  R   AS
Sbjct:   14 RRKAQLKEWCGSETDHASSKMREPEKIKFPLSVQLLAACSNSDLDEFSRLLKLGTDINTQNADGLTSTHLACINVDFDFLKFLISNGADINLQDHEGWTPLHAAASVGCCELARFLIENGASLSILSVDLELPIDVAQDEEMINLLTDSMKKQNIDGDTIKHSEEQMLLHDAQHWLTSGQYKPVIDPRTGATPLHVAACKDYTKAMEILLQI--PGLDINAKDFDGWTALHAAAHWNREASARMLANAGASFDEHTRASQSVFDVADKEMIVLLRQLRERQRAERLSNAS 301          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. TrEMBL
Match: A0A1A8RW09 (Protein phosphatase 1 regulatory subunit OS=Nothobranchius rachovii OX=451742 GN=PPP1R12A PE=4 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 1.461e-59
Identity = 126/293 (43.00%), Postives = 166/293 (56.66%), Query Frame = 2
Query:  143 KRQEQLNLWFDSETDKASNSIKEADKIK-FPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKARFRRDEKASIKR 1018
            KR EQL  W  SETD+  + +K+      F     F +AC+S D  E+ RLLD G +IN    DGLTALHQACIDD+ ++V +LV HGA ++  D EGW PL AA SC YL I  YLIS  A + VV+ +GE PLD +   AM   L  E+ ++ LD    R  E   ML +  +   +    +   + +G T LHVAA+K Y++VL+  L I     +N KDNDGW  LH AAHW    AC ILVE + D D +    QT  +VAD++V  YL E  +K      EK  +K+
Sbjct:    7 KRNEQLKQWLGSETDQEPSVLKKKKTKVKFDDGAVFLAACSSGDTEEVLRLLDRGADINYANVDGLTALHQACIDDNVDMVTFLVEHGANLNQPDNEGWIPLHAAASCGYLDIAEYLISQGANVGVVNSEGETPLDIAEEGAMEELLQNEINRQGLDIEAARKEEERIMLRDARQWLNSGQIQDVRHIKSGGTALHVAAAKGYVEVLK--LLIQAGYDVNIKDNDGWTPLHAAAHWGKEEACKILVENQCDMDIINKMGQTAFDVADEDVLGYLEELQKKQNLLTIEKKDVKK 297          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Cavefish
Match: ppp1r12a (protein phosphatase 1 regulatory subunit 12A [Source:NCBI gene;Acc:103046804])

HSP 1 Score: 213.772 bits (543), Expect = 2.005e-57
Identity = 126/293 (43.00%), Postives = 162/293 (55.29%), Query Frame = 2
Query:  143 KRQEQLNLWFDSETDKASNSIKEADKIK-FPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKARFRRDEKASIKR 1018
            KR EQL  W  SETD     +K+      F     F +AC+S D  E+ RLLD G +IN    DGLTALHQACIDD+ ++V +LV HGA I+  D EGW PL AA SC Y+ I  YLIS  A + VV+ +GE PLD +  EAM   L  E+ ++ +D    R  E   ML +  +   +   S+     +G T LHVAA+K Y +VL+  L I     +N KD DGW  LH AAHW    AC ILVE   D D +    QT  +VAD++V  YL E  +K      EK  +K+
Sbjct:    9 KRNEQLKRWLGSETDLEPPVLKKKKTKVKFDDGAVFLAACSSGDTEEVLRLLDRGADINYANVDGLTALHQACIDDNVDMVTFLVEHGACINQPDNEGWIPLHAAASCGYMDIAEYLISQGASVGVVNSEGETPLDIAEEEAMEELLQNEINRQGVDIEAARKEEERIMLRDARQWLNSGQISDVRHAKSGGTALHVAAAKGYAEVLK--LLIQAGYDVNIKDYDGWTPLHAAAHWGKEEACRILVENLCDMDLINKVGQTAFDVADEDVLGYLEELQKKQNLLMSEKKDVKK 299          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Cavefish
Match: ppp1r12a (protein phosphatase 1 regulatory subunit 12A [Source:NCBI gene;Acc:103046804])

HSP 1 Score: 213.386 bits (542), Expect = 2.444e-57
Identity = 126/293 (43.00%), Postives = 162/293 (55.29%), Query Frame = 2
Query:  143 KRQEQLNLWFDSETDKASNSIKEADKIK-FPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKARFRRDEKASIKR 1018
            KR EQL  W  SETD     +K+      F     F +AC+S D  E+ RLLD G +IN    DGLTALHQACIDD+ ++V +LV HGA I+  D EGW PL AA SC Y+ I  YLIS  A + VV+ +GE PLD +  EAM   L  E+ ++ +D    R  E   ML +  +   +   S+     +G T LHVAA+K Y +VL+  L I     +N KD DGW  LH AAHW    AC ILVE   D D +    QT  +VAD++V  YL E  +K      EK  +K+
Sbjct:    9 KRNEQLKRWLGSETDLEPPVLKKKKTKVKFDDGAVFLAACSSGDTEEVLRLLDRGADINYANVDGLTALHQACIDDNVDMVTFLVEHGACINQPDNEGWIPLHAAASCGYMDIAEYLISQGASVGVVNSEGETPLDIAEEEAMEELLQNEINRQGVDIEAARKEEERIMLRDARQWLNSGQISDVRHAKSGGTALHVAAAKGYAEVLK--LLIQAGYDVNIKDYDGWTPLHAAAHWGKEEACRILVENLCDMDLINKVGQTAFDVADEDVLGYLEELQKKQNLLMSEKKDVKK 299          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Cavefish
Match: ppp1r12a (protein phosphatase 1 regulatory subunit 12A [Source:NCBI gene;Acc:103046804])

HSP 1 Score: 213.386 bits (542), Expect = 2.478e-57
Identity = 126/293 (43.00%), Postives = 162/293 (55.29%), Query Frame = 2
Query:  143 KRQEQLNLWFDSETDKASNSIKEADKIK-FPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKARFRRDEKASIKR 1018
            KR EQL  W  SETD     +K+      F     F +AC+S D  E+ RLLD G +IN    DGLTALHQACIDD+ ++V +LV HGA I+  D EGW PL AA SC Y+ I  YLIS  A + VV+ +GE PLD +  EAM   L  E+ ++ +D    R  E   ML +  +   +   S+     +G T LHVAA+K Y +VL+  L I     +N KD DGW  LH AAHW    AC ILVE   D D +    QT  +VAD++V  YL E  +K      EK  +K+
Sbjct:    9 KRNEQLKRWLGSETDLEPPVLKKKKTKVKFDDGAVFLAACSSGDTEEVLRLLDRGADINYANVDGLTALHQACIDDNVDMVTFLVEHGACINQPDNEGWIPLHAAASCGYMDIAEYLISQGASVGVVNSEGETPLDIAEEEAMEELLQNEINRQGVDIEAARKEEERIMLRDARQWLNSGQISDVRHAKSGGTALHVAAAKGYAEVLK--LLIQAGYDVNIKDYDGWTPLHAAAHWGKEEACRILVENLCDMDLINKVGQTAFDVADEDVLGYLEELQKKQNLLMSEKKDVKK 299          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Cavefish
Match: ppp1r12a (protein phosphatase 1 regulatory subunit 12A [Source:NCBI gene;Acc:103046804])

HSP 1 Score: 213.001 bits (541), Expect = 2.770e-57
Identity = 126/293 (43.00%), Postives = 162/293 (55.29%), Query Frame = 2
Query:  143 KRQEQLNLWFDSETDKASNSIKEADKIK-FPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKARFRRDEKASIKR 1018
            KR EQL  W  SETD     +K+      F     F +AC+S D  E+ RLLD G +IN    DGLTALHQACIDD+ ++V +LV HGA I+  D EGW PL AA SC Y+ I  YLIS  A + VV+ +GE PLD +  EAM   L  E+ ++ +D    R  E   ML +  +   +   S+     +G T LHVAA+K Y +VL+  L I     +N KD DGW  LH AAHW    AC ILVE   D D +    QT  +VAD++V  YL E  +K      EK  +K+
Sbjct:    9 KRNEQLKRWLGSETDLEPPVLKKKKTKVKFDDGAVFLAACSSGDTEEVLRLLDRGADINYANVDGLTALHQACIDDNVDMVTFLVEHGACINQPDNEGWIPLHAAASCGYMDIAEYLISQGASVGVVNSEGETPLDIAEEEAMEELLQNEINRQGVDIEAARKEEERIMLRDARQWLNSGQISDVRHAKSGGTALHVAAAKGYAEVLK--LLIQAGYDVNIKDYDGWTPLHAAAHWGKEEACRILVENLCDMDLINKVGQTAFDVADEDVLGYLEELQKKQNLLMSEKKDVKK 299          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Cavefish
Match: ppp1r12a (protein phosphatase 1 regulatory subunit 12A [Source:NCBI gene;Acc:103046804])

HSP 1 Score: 213.386 bits (542), Expect = 2.943e-57
Identity = 126/293 (43.00%), Postives = 162/293 (55.29%), Query Frame = 2
Query:  143 KRQEQLNLWFDSETDKASNSIKEADKIK-FPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKARFRRDEKASIKR 1018
            KR EQL  W  SETD     +K+      F     F +AC+S D  E+ RLLD G +IN    DGLTALHQACIDD+ ++V +LV HGA I+  D EGW PL AA SC Y+ I  YLIS  A + VV+ +GE PLD +  EAM   L  E+ ++ +D    R  E   ML +  +   +   S+     +G T LHVAA+K Y +VL+  L I     +N KD DGW  LH AAHW    AC ILVE   D D +    QT  +VAD++V  YL E  +K      EK  +K+
Sbjct:    9 KRNEQLKRWLGSETDLEPPVLKKKKTKVKFDDGAVFLAACSSGDTEEVLRLLDRGADINYANVDGLTALHQACIDDNVDMVTFLVEHGACINQPDNEGWIPLHAAASCGYMDIAEYLISQGASVGVVNSEGETPLDIAEEEAMEELLQNEINRQGVDIEAARKEEERIMLRDARQWLNSGQISDVRHAKSGGTALHVAAAKGYAEVLK--LLIQAGYDVNIKDYDGWTPLHAAAHWGKEEACRILVENLCDMDLINKVGQTAFDVADEDVLGYLEELQKKQNLLMSEKKDVKK 299          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Sea Lamprey
Match: ppp1r12a (protein phosphatase 1, regulatory subunit 12A [Source:NCBI gene;Acc:445393])

HSP 1 Score: 166.777 bits (421), Expect = 7.858e-43
Identity = 84/205 (40.98%), Postives = 119/205 (58.05%), Query Frame = 2
Query:  353 ACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLRE 967
            ACID++ ++V++LV   A I+  D EGWTPL AA SC Y+ I  YLI+  A +  V+ + ELPLD + +EA+   L EEL K  +DQ+  R  E   M+ +  +   +          +G T LHVAA+K YIDV++ LL       +N +DNDGW  LH AAHW    AC +LVE   + ++L    QT  +V+D++V  YL E
Sbjct:    1 ACIDENFDMVKFLVERDANINQADNEGWTPLHAAASCGYIDIAKYLIAHGANVAAVNSESELPLDITEDEALEDMLQEELSKHGVDQDAARKEEEQVMMRDARQWLNSGRIDEVRHPKSGGTALHVAAAKGYIDVIKLLLQAGFD--VNVRDNDGWTPLHAAAHWGKDEACRVLVENFCNMEALNKVGQTAFDVSDEDVLSYLEE 203          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003334.1 (pep scaffold:Pmarinus_7.0:GL479399:737:27806:-1 gene:ENSPMAG00000003049.1 transcript:ENSPMAT00000003334.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 120.168 bits (300), Expect = 1.305e-30
Identity = 75/251 (29.88%), Postives = 124/251 (49.40%), Query Frame = 2
Query:  143 KRQEQLNLW--FDSETDKASNSI-----KEADKIKFPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEI---RNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRAC 865
            KR EQL  W  FD +  K   +       ++  + FP  ++   A + ND  E+  LL DG+  +   ++GLTALHQAC+   E+L   L++ GA ++A+D   WTPL AA +  +  +   L+   A L  +S DGE P D  ++    ++L  E++ R L +  +   R    ++ ++E+ +   + +  +    D+G  +LH+A +  Y   +  LL +     L   D DGW  LH AA+W   R  
Sbjct:   13 KRAEQLKRWAEFDRQHGKKGRAKKKRLRSKSRAVNFPPSLRLLEAVSRNDVDEVTTLLSDGVSPDSCNEEGLTALHQACLWGWEDLAGLLLSRGASVNARDSGLWTPLHAACAQGFTEVVRLLVPRGADLLALSEDGETPFDVCDDHETIAYLEGEMRHRGLTEKVVEDARKATEDSFISEMTQSVADLNAPD----DHGVVVLHMAVAHGYERAVRVLLEVGARSDL--PDADGWTPLHAAAYWGQVRGA 257          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.0998 bits (183), Expect = 3.746e-14
Identity = 61/218 (27.98%), Postives = 93/218 (42.66%), Query Frame = 2
Query:  281 IERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLD---QSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLA------IITPELLNQKDNDGWNALHVAAHWNHRRACVIL--VEAEIDFDS 901
            +  LL    EI+     G TALH A +    ++VR LV  GA I+AQ + G+TPL+ A   N+L I  +L+   A   V + DG  PL    Q  +E +   L+E   K                     K+++                LH+AA KD  +    LL       + +  +LNQ    G+  LH+AAH+ +     +L  + A +DF +
Sbjct:   59 VTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTK--------------------GKVRL--------------PALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTA 242          

HSP 2 Score: 74.7146 bits (182), Expect = 5.897e-14
Identity = 61/238 (25.63%), Postives = 104/238 (43.70%), Query Frame = 2
Query:  254 ACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNE----------IRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVA 937
            AC  N    +E LL  G  I+ T + GLT +H A      N+V+ L+ +GA  +A +  G TPL  A     L +   L+   AR+ V + + + PL  ++       +V+ L +R  D N             +RE +    +V  + +        +   G T LH+A+    ++V   LL        + K  +G   LHVA H++H++  ++L++      S   +  T L +A
Sbjct:  384 ACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAE-IVQLLLQRGSDPNAPTASGSTPLYFASREGHG---DVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASA--DPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIA 615          

HSP 3 Score: 58.9214 bits (141), Expect = 4.356e-9
Identity = 61/264 (23.11%), Postives = 112/264 (42.42%), Query Frame = 2
Query:  254 ACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLD---QSNNEAMTSFLVEE---LKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVAD-----DEVKPYLREEIRKARFRRDEKASI 1012
            A +  + +    LL+ G  ++ T  +G+T LH A    + N+V+ L+  GAKID + ++G TPL  A    +  +   L+  +A +   + +G  PL    Q  + A    L+     +    LD     +   +     V K+ +++         NG T LH+A  K+ I V+E LL       ++     G   +HVA+   H     +L++     ++     +T L +A      + VK  L+   R     R+++  +
Sbjct:  219 AAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLK--HGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPL 480          

HSP 4 Score: 56.6102 bits (135), Expect = 1.826e-8
Identity = 57/212 (26.89%), Postives = 90/212 (42.45%), Query Frame = 2
Query:  329 DGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKIN---------KDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVA 937
            +GLT LH A   D + +   L+  GA   +  K G+TPL  A   N L +   L+   A  ++++  G  PL  +  E     +V  L  R+   +        AM    ++ K+N          D +  T +    T LHVA+    I ++  LL      L+N K  +G+  LH AA   H      L++ E   + LT++  T L +A
Sbjct:  574 NGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHAD-MVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCY--TPLHVASHYGNIKMVNFLLR--NRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIA 780          

HSP 5 Score: 48.1358 bits (113), Expect = 8.238e-6
Identity = 43/170 (25.29%), Postives = 69/170 (40.59%), Query Frame = 2
Query:  281 IERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPE 790
            +  LL     I+     GLTA+H A  +D  N+   L  H A ++   K  +TPL  A     + + N+L+   A ++  + +G  PL Q+  +  T  +V  L +     NE                          +  NG T L +A    YI V++  L+I+T E
Sbjct:  657 VALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHT-HVVNALLQHEASPNE--------------------------LTANGNTALAIARRLGYISVVDT-LSILTEE 798          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.0998 bits (183), Expect = 3.968e-14
Identity = 63/241 (26.14%), Postives = 107/241 (44.40%), Query Frame = 2
Query:  254 ACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNE----------IRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLL---AIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVA 937
            AC  N    +E LL  G  I+ T + GLT +H A      N+V+ L+ +GA  +A +  G TPL  A     L +   L+   AR+ V + + + PL  ++       +V+ L +R  D N             +RE +    +V  + +        +   G T LH+A+    ++V   LL   A   P++  Q   +G   LHVA H++H++  ++L++      S   +  T L +A
Sbjct:  377 ACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAE-IVQLLLQRGSDPNAPTASGSTPLYFASREGHG---DVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQ---NGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIA 610          

HSP 2 Score: 69.3218 bits (168), Expect = 2.259e-12
Identity = 71/254 (27.95%), Postives = 108/254 (42.52%), Query Frame = 2
Query:  281 IERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLD---QSNNEAMTSFLVE------------ELKKRNLDQNE---IRNRERNAMLNE---VEKIKINKDFSNFTM----------VD----NGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVA 937
            +  LL    EI+     G TALH A +    ++VR LV  GA I+AQ + G+TPL+ A   N+L I  +L+   A   V + DG  PL    Q  +E +   L+E             +  R  D N    +   E NA +        + I   + N  +          VD    NG T LHVAA +   ++++ LL       ++ K  DG   LH AA   H +   +L+E +    + T +  + L +A
Sbjct:   60 VTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLD--RGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMA 311          

HSP 3 Score: 58.9214 bits (141), Expect = 3.584e-9
Identity = 61/264 (23.11%), Postives = 112/264 (42.42%), Query Frame = 2
Query:  254 ACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLD---QSNNEAMTSFLVEE---LKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVAD-----DEVKPYLREEIRKARFRRDEKASI 1012
            A +  + +    LL+ G  ++ T  +G+T LH A    + N+V+ L+  GAKID + ++G TPL  A    +  +   L+  +A +   + +G  PL    Q  + A    L+     +    LD     +   +     V K+ +++         NG T LH+A  K+ I V+E LL       ++     G   +HVA+   H     +L++     ++     +T L +A      + VK  L+   R     R+++  +
Sbjct:  212 AAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLK--HGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPL 473          

HSP 4 Score: 56.9954 bits (136), Expect = 1.557e-8
Identity = 57/247 (23.08%), Postives = 93/247 (37.65%), Query Frame = 2
Query:  245 FFSACNSNDWSEIERLLDDGIEINCTQDDGLT-----------------------------ALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLD---QSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKI---KINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVE 880
             + A   N    ++ LLD+G   +   +DG T                             ALH A   DD N    L+ H    D   K G+TPL  A     + +   L++  A +D  + +G  PL    +  N  M   L++   K +    +       A  +  EK+    + +D        NG + LH+A   +++  ++ LL    P  ++    D    LHVAAH  H R   +L++
Sbjct:  114 LYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAP--VDDVTLDYLTPLHVAAHCGHYRVAKLLLD 358          

HSP 5 Score: 56.6102 bits (135), Expect = 1.977e-8
Identity = 57/212 (26.89%), Postives = 90/212 (42.45%), Query Frame = 2
Query:  329 DGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKIN---------KDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVA 937
            +GLT LH A   D + +   L+  GA   +  K G+TPL  A   N L +   L+   A  ++++  G  PL  +  E     +V  L  R+   +        AM    ++ K+N          D +  T +    T LHVA+    I ++  LL      L+N K  +G+  LH AA   H      L++ E   + LT++  T L +A
Sbjct:  569 NGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHAD-MVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCY--TPLHVASHYGNIKMVNFLLR--NRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIA 775          

HSP 6 Score: 48.1358 bits (113), Expect = 7.432e-6
Identity = 43/170 (25.29%), Postives = 69/170 (40.59%), Query Frame = 2
Query:  281 IERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPE 790
            +  LL     I+     GLTA+H A  +D  N+   L  H A ++   K  +TPL  A     + + N+L+   A ++  + +G  PL Q+  +  T  +V  L +     NE                          +  NG T L +A    YI V++  L+I+T E
Sbjct:  652 VALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHT-HVVNALLQHEASPNE--------------------------LTANGNTALAIARRLGYISVVDT-LSILTEE 793          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009608.1 (pep scaffold:Pmarinus_7.0:GL477242:23155:61557:-1 gene:ENSPMAG00000008655.1 transcript:ENSPMAT00000009608.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.0106 bits (162), Expect = 1.688e-11
Identity = 70/287 (24.39%), Postives = 113/287 (39.37%), Query Frame = 2
Query:  233 KEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNF--------------------------TMVDNGA----------TMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKAR 985
            K      A   N    ++ LL  G +++     GL  LH AC      +   LV HGA ++A D   +TPL  A S N + + + L+S  A   +++   +  +D +    +   LV E +  +L Q       R A +  V+K  +  D  NF                           ++  GA          T LHVA+ K + DV++ LL       +N  D+ G  +LH AAH  H   C +L+    D +  +    T  ++ ++ V+  L E     R
Sbjct:  334 KSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLVKHGASVNAMDLWQFTPLHEAASKNRVEVCSLLLSYGADPTLLNCHSKSAIDLAPTSELKERLVYEFRGHSLLQ-----AAREADVTRVKK-HLGLDIINFKHPQTHETALHCAVASPYPKRKQVSELLLRKGANVNEKTKDLLTPLHVASDKAHNDVIDVLLK--HGAKINVTDSLGQTSLHRAAHAGHLTTCRLLLSHGCDPNLPSLQGFTAAQLGNESVQQILHESSLPVR 612          

HSP 2 Score: 58.9214 bits (141), Expect = 4.171e-9
Identity = 57/201 (28.36%), Postives = 89/201 (44.28%), Query Frame = 2
Query:  284 ERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVE-ELKKRNLD-QNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVE 880
            E LL  G  +N    D LT LH A      +++  L+ HGAKI+  D  G T L  A    +L     L+S     ++ S  G     Q  NE++   L E  L  RN D ++++    +   L+ V+++   +  +   M    +T LH AA  + + V+E LL       ++ KD  G   LH A  + H     +LV+
Sbjct:  507 ELLLRKGANVNEKTKDLLTPLHVASDKAHNDVIDVLLKHGAKINVTDSLGQTSLHRAAHAGHLTTCRLLLSHGCDPNLPSLQG-FTAAQLGNESVQQILHESSLPVRNSDVEHQLLEAAKAGDLDTVKQLCTTQTVNCRDMEGRHSTPLHFAAGYNRVSVVEYLLQHGAD--VHAKDKGGLVPLHNACSYGHYEVAELLVK 704          

HSP 3 Score: 55.8398 bits (133), Expect = 3.704e-8
Identity = 51/200 (25.50%), Postives = 87/200 (43.50%), Query Frame = 2
Query:  281 IERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVE 880
            +E LL +G  ++   D GL  LH AC      +V  L+  GA  +A+D   +TPL  A     + +   L+   A   + + DG+  LD +   A      E  K   L+     N E+  ++  +  + +N   S+       +T LH+AA  + + +++ LL       ++ KD  G   LH A  + H     +LV+
Sbjct:  197 VEHLLQNGANVHARDDGGLIPLHNACSFGHAEVVNLLLRQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPGIRNTDGKTALDLAEPTAKAVLTGEYKKDELLEAARSGNEEK--LMALLTPLNVNCHASD----GRKSTPLHLAAGYNRVRIVQLLLQHGAD--VHAKDKGGLVPLHNACSYGHYEVTELLVK 388          

HSP 4 Score: 53.1434 bits (126), Expect = 2.844e-7
Identity = 54/209 (25.84%), Postives = 89/209 (42.58%), Query Frame = 2
Query:  254 ACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVE 880
            A   N  S +E LL  G +++     GL  LH AC      +   LV  GA ++  D   +TPL  A +     I   L+   A     + DG  PLD    E  T   +++L + +     + +  +   L  V+K+   ++ +        +T LH+AA  + ++V E LL       +N +D  G   LH AA + H     +L++
Sbjct:  657 AAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKRGAVVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDLV-KEGDTD--IQDLLRGD---AALLDAAKKGCLARVQKLCSGENVNCRDSQGRNSTPLHLAAGYNNLEVAEYLLEHGAD--VNAQDKGGLIPLHNAASYGHVDIAALLIK 857          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Yeast
Match: NAS6 (Evolutionarily conserved 19S regulatory particle assembly-chaperone; proteasome-interacting protein involved in the assembly of the base subcomplex of the 19S proteasomal regulatory particle (RP); ortholog of human oncoprotein gankyrin, also known as p28, which interacts with the Rb tumor suppressor and CDK4/6 [Source:SGD;Acc:S000003464])

HSP 1 Score: 48.521 bits (114), Expect = 1.075e-6
Identity = 60/210 (28.57%), Postives = 98/210 (46.67%), Query Frame = 2
Query:  344 LHQACIDDDENLVRYLVTHGAKIDAQ-DKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSF----------LVEELKKRNL--DQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATM----------LHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVE---AEIDF 895
            LHQAC++++   V+ L+     +  Q D++G  PL  ++S     IT++L+S   +++ V+ D     D  ++   T F          +V+ L  R L  D N+I N+    +   V K     + S F +++NGA++          LH AAS   + ++E LL  +    +N +D  GW  L  A    H  A V+LVE   AE D 
Sbjct:    6 LHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLS---KMENVNLD-----DYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWF--EVSQF-LIENGASVRIKDKFNQIPLHRAASVGSLKLIE-LLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDL 203          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Yeast
Match: PHO81 (Cyclin-dependent kinase (CDK) inhibitor; regulates Pho80p-Pho85p and Pcl7p-Pho85p cyclin-CDK complexes in response to phosphate levels; inhibitory activity for Pho80p-Pho85p requires myo-D-inositol heptakisphosphate (IP7) generated by Vip1p; relative distribution to the nucleus increases upon DNA replication stress [Source:SGD;Acc:S000003465])

HSP 1 Score: 48.1358 bits (113), Expect = 6.091e-6
Identity = 36/118 (30.51%), Postives = 59/118 (50.00%), Query Frame = 2
Query:  332 GLTALH-QACIDDDENLVRYLVTHGA---KIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLD----QSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVE 661
            GL  LH  A I  D  L++ L+ +GA   +ID  +K  WTP+F A+   +  +   L+  NARLD+   +G  PL     +S+ + + + L   L   +   NEI ++     LN ++
Sbjct:  557 GLCTLHIVAKIGGDPQLIQLLIRYGADPNEIDGFNK--WTPIFYAVRSGHSEVITELLKHNARLDIEDDNGHSPLFYALWESHVDVLNALLQRPLNLPSAPLNEINSQSSTQRLNTID 672          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Nematostella
Match: EDO43690 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXV8])

HSP 1 Score: 184.496 bits (467), Expect = 1.628e-52
Identity = 109/263 (41.44%), Postives = 154/263 (58.56%), Query Frame = 2
Query:  119 SSEQSNIL-KRQEQLNLWFDSETDKAS-NSIKEADKIKFPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDS 901
             S  SN L KRQ+ L  W  SETD+   +  ++  KI+F   + F SA +S D  E+++LL  G +IN    DGLTALHQACID++ +LV+ LV  GA +D +D EGWT L AA SC  + I  YLI   A +  V+ +GELPLD +  E M   L +E++ + +D ++ R  E   MLN+ +   +NK+  N +     A+ LHVA+SK Y+ V+  LL +     +N KD D W  LH AAHW  + AC +L E   DF++
Sbjct:    9 GSRASNALQKRQDSLRRWKGSETDRQPVDRSRKKPKIQFNSGIVFLSAVSSGDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEEDMEDLLTDEIENQGIDVDDARAVEEKIMLNDAQSW-LNKNCINESKDKTEASALHVASSKGYLKVIGLLLQLGVE--INAKDADNWTPLHAAAHWGQKDACELLSENGADFNA 268          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Nematostella
Match: EDO36720 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHV7])

HSP 1 Score: 80.8777 bits (198), Expect = 7.910e-17
Identity = 61/225 (27.11%), Postives = 113/225 (50.22%), Query Frame = 2
Query:  311 INCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFT-MVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKA 982
            ++   +DGLTAL +AC   +  LV+ LV++GA +D QDKEGW+ L AA     L I  YL++  A + V +  GELP+D + +      L E +K+  L +   +   +   L  + K  + +   N   + D+G ++LH  A +   + ++ LL       +N++  +G + LH A    +    ++L+ +  D  + T      +++A +     +R+ +R+A
Sbjct:   39 VDLLDEDGLTALQRACFTGNLKLVQLLVSYGANLDIQDKEGWSVLHAAAVAGNLSILRYLVAVGADVSVRNDLGELPIDVATDVHCVIVLAEGMKRAGLRKLTDKFFAKRPQLKTLIKDSLIQGLDNVNDLNDSGISLLHEMAGRGDSESVQFLLE--HGAEVNRQSLNGSSPLHEAVQSGNIDCTLLLLRSGADLYAETDGGFLPIDIARENT---IRDILRRA 258          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Nematostella
Match: EDO47759 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKX6])

HSP 1 Score: 72.7886 bits (177), Expect = 5.927e-14
Identity = 39/121 (32.23%), Postives = 67/121 (55.37%), Query Frame = 2
Query:  233 KEVQFFSACNSNDWSEIERLLDDGI-EINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEEL 592
            KE+    A   ND ++++ +L   I  IN   ++ +TALH +C+     +VR L+ HGA ++ +D +GWT L  A +  +L +T+ L+S  A    +S+DG+L +D +  E M   L   +
Sbjct:   13 KEIILRQAIEDNDLAQVKFVLRFHIGRINDQDENRMTALHHSCLYGRIEIVRLLLEHGADLEVRDSKGWTALHFAANGGFLDVTSLLLSSCADAAALSYDGQLSIDVATGEGMVFLLASAI 133          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Nematostella
Match: EDO48893 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHQ3])

HSP 1 Score: 67.3958 bits (163), Expect = 2.965e-13
Identity = 42/144 (29.17%), Postives = 71/144 (49.31%), Query Frame = 2
Query:  218 KIKFPKEVQFFSACNSNDWSEIERLL-----DDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNN----EAMTSFLVEELKKRNLDQNEI 622
            K+KFP E+ F       D +E+   L     D    IN TQ +   ALHQ   + +   VR LV  GA ++ Q++EG+TPL      N   +  +L+  +A  D+  ++G+ P+D + +    E    F  +E +++++ Q  I
Sbjct:    4 KVKFPHELVFHEMVKEGDSAEMSMFLKRPSVDPKSIINGTQGNQGPALHQLVFEGNLKCVRMLVNLGADVNMQNEEGFTPLHYCALSNNFDMAKFLMKKSANPDIADYNGKTPVDYTEDFDLIELFLMFSPDEQRRKSMSQPTI 147          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Nematostella
Match: EDO49727 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFI4])

HSP 1 Score: 61.2326 bits (147), Expect = 1.371e-11
Identity = 29/93 (31.18%), Postives = 51/93 (54.84%), Query Frame = 2
Query:  302 GIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFL 580
            G++++     G+TAL Q  +D     V+ L+  GA +D  D+ GW PL  A +  Y+ I   L+  NA +  ++  G +P+D +++EA+   L
Sbjct:   12 GLDLDAINASGMTALTQCALDGSLRGVKILLELGADVDKTDRYGWAPLHHAAAEGYIDIVRLLLRANANVRALNQHGHMPMDLADDEAVRKLL 104          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Medaka
Match: ppp1r12a (protein phosphatase 1 regulatory subunit 12A [Source:NCBI gene;Acc:101161524])

HSP 1 Score: 221.861 bits (564), Expect = 4.349e-60
Identity = 122/293 (41.64%), Postives = 162/293 (55.29%), Query Frame = 2
Query:  143 KRQEQLNLWFDSETDKASNSIKEADKIKFPKE-VQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKARFRRDEKASIKR 1018
            KR EQL  W  SETD+     K+        +   F +AC+S D  E+ R+LD G +IN    DGLTALHQACIDD+ ++V +LV HGA ++  D EGW PL AA SC YL I  YLIS  A + VV+ +GE PLD +  EAM   L  E+ ++ +D    R  E   ML +  +   +    +     +G T LHVAA+K Y++VL+  L I     +N KD DGW  LH AAHW    AC ILVE   D D +    QT  +VAD+++  YL E  +K      EK  +K+
Sbjct:    9 KRNEQLKRWMGSETDQEPPVFKKKKTKVKFDDGAVFLAACSSGDTEEVLRMLDRGADINYANVDGLTALHQACIDDNVDMVTFLVEHGASVNQPDNEGWIPLHAAASCGYLDIAEYLISQGASVGVVNSEGETPLDIAEEEAMGELLKNEINRQGVDIEAARKEEERIMLRDARQWLNSGQIQDVRHAKSGGTALHVAAAKGYVEVLK--LLIQAGYDVNIKDYDGWTPLHAAAHWGKDEACRILVENLCDMDVVNKMGQTAFDVADEDILGYLEELQKKQTLLMSEKKDVKK 299          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Medaka
Match: ppp1r12a (protein phosphatase 1 regulatory subunit 12A [Source:NCBI gene;Acc:101161524])

HSP 1 Score: 221.861 bits (564), Expect = 5.174e-60
Identity = 122/293 (41.64%), Postives = 162/293 (55.29%), Query Frame = 2
Query:  143 KRQEQLNLWFDSETDKASNSIKEADKIKFPKE-VQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKARFRRDEKASIKR 1018
            KR EQL  W  SETD+     K+        +   F +AC+S D  E+ R+LD G +IN    DGLTALHQACIDD+ ++V +LV HGA ++  D EGW PL AA SC YL I  YLIS  A + VV+ +GE PLD +  EAM   L  E+ ++ +D    R  E   ML +  +   +    +     +G T LHVAA+K Y++VL+  L I     +N KD DGW  LH AAHW    AC ILVE   D D +    QT  +VAD+++  YL E  +K      EK  +K+
Sbjct:    9 KRNEQLKRWMGSETDQEPPVFKKKKTKVKFDDGAVFLAACSSGDTEEVLRMLDRGADINYANVDGLTALHQACIDDNVDMVTFLVEHGASVNQPDNEGWIPLHAAASCGYLDIAEYLISQGASVGVVNSEGETPLDIAEEEAMGELLKNEINRQGVDIEAARKEEERIMLRDARQWLNSGQIQDVRHAKSGGTALHVAAAKGYVEVLK--LLIQAGYDVNIKDYDGWTPLHAAAHWGKDEACRILVENLCDMDVVNKMGQTAFDVADEDILGYLEELQKKQTLLMSEKKDVKK 299          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Medaka
Match: ppp1r12a (protein phosphatase 1 regulatory subunit 12A [Source:NCBI gene;Acc:101161524])

HSP 1 Score: 221.861 bits (564), Expect = 5.936e-60
Identity = 122/293 (41.64%), Postives = 162/293 (55.29%), Query Frame = 2
Query:  143 KRQEQLNLWFDSETDKASNSIKEADKIKFPKE-VQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKARFRRDEKASIKR 1018
            KR EQL  W  SETD+     K+        +   F +AC+S D  E+ R+LD G +IN    DGLTALHQACIDD+ ++V +LV HGA ++  D EGW PL AA SC YL I  YLIS  A + VV+ +GE PLD +  EAM   L  E+ ++ +D    R  E   ML +  +   +    +     +G T LHVAA+K Y++VL+  L I     +N KD DGW  LH AAHW    AC ILVE   D D +    QT  +VAD+++  YL E  +K      EK  +K+
Sbjct:    9 KRNEQLKRWMGSETDQEPPVFKKKKTKVKFDDGAVFLAACSSGDTEEVLRMLDRGADINYANVDGLTALHQACIDDNVDMVTFLVEHGASVNQPDNEGWIPLHAAASCGYLDIAEYLISQGASVGVVNSEGETPLDIAEEEAMGELLKNEINRQGVDIEAARKEEERIMLRDARQWLNSGQIQDVRHAKSGGTALHVAAAKGYVEVLK--LLIQAGYDVNIKDYDGWTPLHAAAHWGKDEACRILVENLCDMDVVNKMGQTAFDVADEDILGYLEELQKKQTLLMSEKKDVKK 299          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Medaka
Match: ppp1r12a (protein phosphatase 1 regulatory subunit 12A [Source:NCBI gene;Acc:101161524])

HSP 1 Score: 221.861 bits (564), Expect = 6.133e-60
Identity = 122/293 (41.64%), Postives = 162/293 (55.29%), Query Frame = 2
Query:  143 KRQEQLNLWFDSETDKASNSIKEADKIKFPKE-VQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKARFRRDEKASIKR 1018
            KR EQL  W  SETD+     K+        +   F +AC+S D  E+ R+LD G +IN    DGLTALHQACIDD+ ++V +LV HGA ++  D EGW PL AA SC YL I  YLIS  A + VV+ +GE PLD +  EAM   L  E+ ++ +D    R  E   ML +  +   +    +     +G T LHVAA+K Y++VL+  L I     +N KD DGW  LH AAHW    AC ILVE   D D +    QT  +VAD+++  YL E  +K      EK  +K+
Sbjct:    9 KRNEQLKRWMGSETDQEPPVFKKKKTKVKFDDGAVFLAACSSGDTEEVLRMLDRGADINYANVDGLTALHQACIDDNVDMVTFLVEHGASVNQPDNEGWIPLHAAASCGYLDIAEYLISQGASVGVVNSEGETPLDIAEEEAMGELLKNEINRQGVDIEAARKEEERIMLRDARQWLNSGQIQDVRHAKSGGTALHVAAAKGYVEVLK--LLIQAGYDVNIKDYDGWTPLHAAAHWGKDEACRILVENLCDMDVVNKMGQTAFDVADEDILGYLEELQKKQTLLMSEKKDVKK 299          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Medaka
Match: ppp1r12a (protein phosphatase 1 regulatory subunit 12A [Source:NCBI gene;Acc:101161524])

HSP 1 Score: 221.09 bits (562), Expect = 1.150e-59
Identity = 122/293 (41.64%), Postives = 162/293 (55.29%), Query Frame = 2
Query:  143 KRQEQLNLWFDSETDKASNSIKEADKIKFPKE-VQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKARFRRDEKASIKR 1018
            KR EQL  W  SETD+     K+        +   F +AC+S D  E+ R+LD G +IN    DGLTALHQACIDD+ ++V +LV HGA ++  D EGW PL AA SC YL I  YLIS  A + VV+ +GE PLD +  EAM   L  E+ ++ +D    R  E   ML +  +   +    +     +G T LHVAA+K Y++VL+  L I     +N KD DGW  LH AAHW    AC ILVE   D D +    QT  +VAD+++  YL E  +K      EK  +K+
Sbjct:    9 KRNEQLKRWMGSETDQEPPVFKKKKTKVKFDDGAVFLAACSSGDTEEVLRMLDRGADINYANVDGLTALHQACIDDNVDMVTFLVEHGASVNQPDNEGWIPLHAAASCGYLDIAEYLISQGASVGVVNSEGETPLDIAEEEAMGELLKNEINRQGVDIEAARKEEERIMLRDARQWLNSGQIQDVRHAKSGGTALHVAAAKGYVEVLK--LLIQAGYDVNIKDYDGWTPLHAAAHWGKDEACRILVENLCDMDVVNKMGQTAFDVADEDILGYLEELQKKQTLLMSEKKDVKK 299          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Planmine SMEST
Match: SMESG000010821.1 (SMESG000010821.1)

HSP 1 Score: 1305.04 bits (3376), Expect = 0.000e+0
Identity = 707/730 (96.85%), Postives = 711/730 (97.40%), Query Frame = 2
Query:  116 MSSEQSNILKRQEQLNLWFDSETDKASNSIKEADKIKFPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKARFRRDEKASIKRPAPSPNGEFQPSVTKIICQEKINQISIVESKQVNGDKLVXXXXXXXXXXXHNNQKLNQKTLDENKELVSNVDPMDLKLNSIDVTHKTQIDPSDTEAKXXXXXXXXXXXEINENSQPVQEKSDHVIYXXXXXXXXXXXXXXXXQRKDKARHVRSTRRSTQGVTAEDIDEAKKLMSTVQKQEKFNMPSQISTIMENKNDTSDMSTILNHSIKSNHSEPVVTNKENFVNIKESXXXXXXXXXXXXXXXLLSETSETQPVDVQSDLSELNDRKKRTGSHLVNKRRTRERPPTGTIDLKDIQAAQSEVKILDESEKSVDNMDNPKTVSSEIDYKQLYELECKEKDKLLRNLTRIKKELQESQDQIRLLQNTNIVSKNNKIPQKSIAFQSDSDIKEVEKLREENRKMKEANSALIRVISRLSHPPAVTKSTAGST 2305
            MSSEQSNILKRQEQLNLWFDSETDKASNSIKEA+KIKFPKEVQFFSACNSNDWSEIERLLDDGI+INCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLD NEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALH                AEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKARFRRDEKASIKRPAPSPNGEFQPSVTKIICQEKINQISIVESKQVNGDKLVTITETSTISTTHNNQKLNQKTL ENKELVSNVDPMDLKLNSIDVTHKTQIDPSDTEAKTLTPSLSTSTSEINENSQPVQEKSDHVIYEKSDSKTKIKSIESESQRKDKARHVRSTRRSTQGVTAEDIDEAKKLMSTVQKQEKFNMPSQISTIMENKNDTSDMSTILNHSIKSNHSEPVVTNKENFVNIKESVNIVPPYPTVITPTNLLSETSETQPVDVQSDLSELNDRKKRTGSHLVNKRRTRERPPTGTIDLKDIQAAQSEVKILDESEKSVDNMDNP TVSSEIDYKQLYELECKEKDKLLRNLTRIKKELQESQDQIRLLQNTNIVSKNNKIPQKS+AFQSDSD+KEVEKLREENRKMKEANSALIRVISRLSHPPAVTKSTAGST
Sbjct:    1 MSSEQSNILKRQEQLNLWFDSETDKASNSIKEAEKIKFPKEVQFFSACNSNDWSEIERLLDDGIDINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDPNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALH----------------AEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKARFRRDEKASIKRPAPSPNGEFQPSVTKIICQEKINQISIVESKQVNGDKLVTITETSTISTTHNNQKLNQKTLVENKELVSNVDPMDLKLNSIDVTHKTQIDPSDTEAKTLTPSLSTSTSEINENSQPVQEKSDHVIYEKSDSKTKIKSIESESQRKDKARHVRSTRRSTQGVTAEDIDEAKKLMSTVQKQEKFNMPSQISTIMENKNDTSDMSTILNHSIKSNHSEPVVTNKENFVNIKESVNIVPPYPTVITPTNLLSETSETQPVDVQSDLSELNDRKKRTGSHLVNKRRTRERPPTGTIDLKDIQAAQSEVKILDESEKSVDNMDNPNTVSSEIDYKQLYELECKEKDKLLRNLTRIKKELQESQDQIRLLQNTNIVSKNNKIPQKSVAFQSDSDMKEVEKLREENRKMKEANSALIRVISRLSHPPAVTKSTAGST 714          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Planmine SMEST
Match: SMESG000078392.1 (SMESG000078392.1)

HSP 1 Score: 208.764 bits (530), Expect = 2.651e-56
Identity = 110/289 (38.06%), Postives = 172/289 (59.52%), Query Frame = 2
Query:  143 KRQEQLNLWFDSETDKASNSIKEADKIKFPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELP---LDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKARFRRDE 1000
            ++ EQ+  W +SE  K  +S++ + K+ F    +F  AC +    EI  LL+ GI++NC   D LTA+HQACI+   +LV YL+   A I+  DKEGWTPL  A       +  +LI   ARLD+ + DG+LP   +D+     +  ++ +E+ KRN++ +E  N ER  ML +V++  +N  +         +T +HVAA+K+Y++VL  LL ++T + +N +D DGW ALH AAHW H+ AC +L+    D D  T +N+TVL+  D  +K  L EEI+KA+  +++
Sbjct:   12 RKIEQIKRWNNSEISKEKSSLR-SKKVHFDSTTRFLDACINFYKDEINELLNLGIDVNCADKDNLTAIHQACINSRIDLVEYLLIKNANINVCDKEGWTPLHIAADIGSYELAKFLIDHGARLDIANHDGDLPVMLVDEKEYPDLKIYIQKEMDKRNINVDESSNYERTVMLEDVKRWSLNNKYDPPIDHVYRSTPVHVAAAKNYVEVLYKLLPLLTVDDINAQDVDGWTALHAAAHWGHKEACTLLILNGADIDIRTRANETVLDTVDPILKTELIEEIKKAQIEKEK 299          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Planmine SMEST
Match: SMESG000078392.1 (SMESG000078392.1)

HSP 1 Score: 208.764 bits (530), Expect = 2.808e-56
Identity = 110/289 (38.06%), Postives = 172/289 (59.52%), Query Frame = 2
Query:  143 KRQEQLNLWFDSETDKASNSIKEADKIKFPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELP---LDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKARFRRDE 1000
            ++ EQ+  W +SE  K  +S++ + K+ F    +F  AC +    EI  LL+ GI++NC   D LTA+HQACI+   +LV YL+   A I+  DKEGWTPL  A       +  +LI   ARLD+ + DG+LP   +D+     +  ++ +E+ KRN++ +E  N ER  ML +V++  +N  +         +T +HVAA+K+Y++VL  LL ++T + +N +D DGW ALH AAHW H+ AC +L+    D D  T +N+TVL+  D  +K  L EEI+KA+  +++
Sbjct:   12 RKIEQIKRWNNSEISKEKSSLR-SKKVHFDSTTRFLDACINFYKDEINELLNLGIDVNCADKDNLTAIHQACINSRIDLVEYLLIKNANINVCDKEGWTPLHIAADIGSYELAKFLIDHGARLDIANHDGDLPVMLVDEKEYPDLKIYIQKEMDKRNINVDESSNYERTVMLEDVKRWSLNNKYDPPIDHVYRSTPVHVAAAKNYVEVLYKLLPLLTVDDINAQDVDGWTALHAAAHWGHKEACTLLILNGADIDIRTRANETVLDTVDPILKTELIEEIKKAQIEKEK 299          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Planmine SMEST
Match: SMESG000078392.1 (SMESG000078392.1)

HSP 1 Score: 206.068 bits (523), Expect = 1.795e-55
Identity = 110/289 (38.06%), Postives = 172/289 (59.52%), Query Frame = 2
Query:  143 KRQEQLNLWFDSETDKASNSIKEADKIKFPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELP---LDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKARFRRDE 1000
            ++ EQ+  W +SE  K  +S++ + K+ F    +F  AC +    EI  LL+ GI++NC   D LTA+HQACI+   +LV YL+   A I+  DKEGWTPL  A       +  +LI   ARLD+ + DG+LP   +D+     +  ++ +E+ KRN++ +E  N ER  ML +V++  +N  +         +T +HVAA+K+Y++VL  LL ++T + +N +D DGW ALH AAHW H+ AC +L+    D D  T +N+TVL+  D  +K  L EEI+KA+  +++
Sbjct:   12 RKIEQIKRWNNSEISKEKSSLR-SKKVHFDSTTRFLDACINFYKDEINELLNLGIDVNCADKDNLTAIHQACINSRIDLVEYLLIKNANINVCDKEGWTPLHIAADIGSYELAKFLIDHGARLDIANHDGDLPVMLVDEKEYPDLKIYIQKEMDKRNINVDESSNYERTVMLEDVKRWSLNNKYDPPIDHVYRSTPVHVAAAKNYVEVLYKLLPLLTVDDINAQDVDGWTALHAAAHWGHKEACTLLILNGADIDIRTRANETVLDTVDPILKTELIEEIKKAQIEKEK 299          
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Planmine SMEST
Match: SMESG000063189.1 (SMESG000063189.1)

HSP 1 Score: 140.969 bits (354), Expect = 5.265e-36
Identity = 82/280 (29.29%), Postives = 141/280 (50.36%), Query Frame = 2
Query:  143 KRQEQLNLWFDSETDKASNSIKEAD---------KIKFPKEVQFFSACNSNDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKIDAQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEAMTSFLVEELKKRNLDQNEIRNRERNA---MLNEVEKIKINKDFSNFTMVDN-GATMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRACVILVEAEIDFDSLTSSNQTVLEVADD 943
            KR  QL  W+  +       I+            ++ FP+ +    A    D  E++RLL +G   +   +DGLTALHQ CID+  ++ + L+  GA ++A D E WTPL AA +C ++ I   LI   A L  ++ +G +P D    E     +   +  R + Q+EI  + +     ML +++++K+     N   +D+ GA+ LH+AAS  Y++V   L+    P  ++  D +GW  +H+AA W        L+   ++ D++T S +TV ++ +D
Sbjct:   29 KRITQLKNWYQYDKIMEKQKIRVGKPQKSNFLVKRVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPLHAAAACAHIEICACLIDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRN--GNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVP--IDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCED 304          
The following BLAST results are available for this feature:
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPP1R12B7.932e-5838.08protein phosphatase 1 regulatory subunit 12B [Sour... [more]
PPP1R12B8.368e-5738.08protein phosphatase 1 regulatory subunit 12B [Sour... [more]
PPP1R12A4.170e-5640.48protein phosphatase 1 regulatory subunit 12A [Sour... [more]
PPP1R12B6.868e-5538.08protein phosphatase 1 regulatory subunit 12B [Sour... [more]
PPP1R12B8.074e-5538.08protein phosphatase 1 regulatory subunit 12B [Sour... [more]
back to top
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mel-112.818e-5036.74MEL-11 [Source:UniProtKB/TrEMBL;Acc:G5EEB3][more]
mel-112.927e-5036.74MEL-11 [Source:UniProtKB/TrEMBL;Acc:G5EEB3][more]
mel-113.171e-5036.74MEL-11 [Source:UniProtKB/TrEMBL;Acc:G5EEB3][more]
mel-114.603e-5036.74MEL-11 [Source:UniProtKB/TrEMBL;Acc:G5EEB3][more]
gfi-26.874e-3533.20GEI-4 (Four) Interacting protein [Source:UniProtK... [more]
back to top
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mbs9.317e-5937.30gene:FBgn0005536 transcript:FBtr0308216[more]
Mbs1.445e-5639.93gene:FBgn0005536 transcript:FBtr0112851[more]
Mbs2.091e-5639.93gene:FBgn0005536 transcript:FBtr0301575[more]
Mbs2.098e-5637.30gene:FBgn0005536 transcript:FBtr0112852[more]
Mbs3.029e-5639.93gene:FBgn0005536 transcript:FBtr0301472[more]
back to top
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp1r12a3.943e-5642.32protein phosphatase 1, regulatory subunit 12A [Sou... [more]
ppp1r12c3.249e-5425.82protein phosphatase 1, regulatory subunit 12C [Sou... [more]
ppp1r16a5.399e-3832.64protein phosphatase 1, regulatory subunit 16A [Sou... [more]
ppp1r16a5.399e-3832.64protein phosphatase 1, regulatory subunit 16A [Sou... [more]
ppp1r16a5.399e-3832.64protein phosphatase 1, regulatory subunit 16A [Sou... [more]
back to top
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPP1R12A1.332e-5742.76protein phosphatase 1 regulatory subunit 12A [Sour... [more]
PPP1R12A9.727e-5743.82protein phosphatase 1 regulatory subunit 12A [Sour... [more]
lcp11.870e-5238.73lymphocyte cytosolic protein 1 (L-plastin) [Source... [more]
lcp12.500e-5238.73lymphocyte cytosolic protein 1 (L-plastin) [Source... [more]
lcp13.184e-5238.73lymphocyte cytosolic protein 1 (L-plastin) [Source... [more]
back to top
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ppp1r12a6.066e-5640.82protein phosphatase 1, regulatory subunit 12A [Sou... [more]
Ppp1r12a7.041e-5640.82protein phosphatase 1, regulatory subunit 12A [Sou... [more]
Ppp1r12b1.775e-5540.84protein phosphatase 1, regulatory subunit 12B [Sou... [more]
Ppp1r12b1.319e-5440.84protein phosphatase 1, regulatory subunit 12B [Sou... [more]
Ppp1r12b1.319e-5440.84protein phosphatase 1, regulatory subunit 12B [Sou... [more]
back to top
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6DRG7|MYPT1_DANRE2.696e-5542.32Protein phosphatase 1 regulatory subunit 12A OS=Da... [more]
sp|Q9DBR7|MYPT1_MOUSE4.925e-5540.82Protein phosphatase 1 regulatory subunit 12A OS=Mu... [more]
sp|Q10728|MYPT1_RAT5.271e-5540.82Protein phosphatase 1 regulatory subunit 12A OS=Ra... [more]
sp|Q8BG95|MYPT2_MOUSE1.242e-5440.84Protein phosphatase 1 regulatory subunit 12B OS=Mu... [more]
sp|Q90623|MYPT1_CHICK2.203e-5441.50Protein phosphatase 1 regulatory subunit 12A OS=Ga... [more]
back to top
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1B6M0P12.674e-6041.20ANK_REP_REGION domain-containing protein (Fragment... [more]
A0A4Z2DPY94.807e-6041.72Protein phosphatase 1 regulatory subunit 12B isofo... [more]
A0A3B4DUR91.097e-5943.00Protein phosphatase 1 regulatory subunit OS=Pygoce... [more]
G4LWS81.327e-5941.38Protein phosphatase 1 regulatory subunit 12b (Myos... [more]
A0A1A8RW091.461e-5943.00Protein phosphatase 1 regulatory subunit OS=Nothob... [more]
back to top
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp1r12a2.005e-5743.00protein phosphatase 1 regulatory subunit 12A [Sour... [more]
ppp1r12a2.444e-5743.00protein phosphatase 1 regulatory subunit 12A [Sour... [more]
ppp1r12a2.478e-5743.00protein phosphatase 1 regulatory subunit 12A [Sour... [more]
ppp1r12a2.770e-5743.00protein phosphatase 1 regulatory subunit 12A [Sour... [more]
ppp1r12a2.943e-5743.00protein phosphatase 1 regulatory subunit 12A [Sour... [more]
back to top
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp1r12a7.858e-4340.98protein phosphatase 1, regulatory subunit 12A [Sou... [more]
ENSPMAT00000003334.11.305e-3029.88pep scaffold:Pmarinus_7.0:GL479399:737:27806:-1 ge... [more]
ENSPMAT00000000093.13.746e-1427.98pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 g... [more]
ENSPMAT00000000095.13.968e-1426.14pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 g... [more]
ENSPMAT00000009608.11.688e-1124.39pep scaffold:Pmarinus_7.0:GL477242:23155:61557:-1 ... [more]
back to top
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
NAS61.075e-628.57Evolutionarily conserved 19S regulatory particle a... [more]
PHO816.091e-630.51Cyclin-dependent kinase (CDK) inhibitor; regulates... [more]
back to top
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO436901.628e-5241.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO367207.910e-1727.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477595.927e-1432.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO488932.965e-1329.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO497271.371e-1131.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp1r12a4.349e-6041.64protein phosphatase 1 regulatory subunit 12A [Sour... [more]
ppp1r12a5.174e-6041.64protein phosphatase 1 regulatory subunit 12A [Sour... [more]
ppp1r12a5.936e-6041.64protein phosphatase 1 regulatory subunit 12A [Sour... [more]
ppp1r12a6.133e-6041.64protein phosphatase 1 regulatory subunit 12A [Sour... [more]
ppp1r12a1.150e-5941.64protein phosphatase 1 regulatory subunit 12A [Sour... [more]
back to top
BLAST of protein phosphatase 1 regulatory subunit 12C isoform X12 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000010821.10.000e+096.85SMESG000010821.1[more]
SMESG000078392.12.651e-5638.06SMESG000078392.1[more]
SMESG000078392.12.808e-5638.06SMESG000078392.1[more]
SMESG000078392.11.795e-5538.06SMESG000078392.1[more]
SMESG000063189.15.265e-3629.29SMESG000063189.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011384 ID=SMED30011384|Name=protein phosphatase 1 regulatory subunit 12C isoform X12|organism=Schmidtea mediterranea sexual|type=transcript|length=2463bp
TGTTTATCTTCTTTCAAAATTGAAATGAATATTTAGTGATTTTAATTTTA
AATTTTTGCTTCTTACTTTTCGTTAAATTTTGGATTCTTTTTTAAATTAA
CTAAACGAAGAAATAATGTCAAGTGAACAAAGCAACATTTTGAAGCGTCA
AGAACAACTAAATCTTTGGTTTGATTCTGAAACAGACAAGGCTTCTAATT
CTATAAAAGAAGCTGATAAAATAAAATTTCCAAAAGAAGTTCAATTTTTT
AGTGCATGCAATTCTAATGATTGGTCGGAAATTGAAAGATTATTAGATGA
CGGAATTGAGATTAATTGTACTCAAGATGATGGTTTAACAGCTTTACATC
AGGCATGCATAGATGATGATGAAAATTTAGTTAGATATTTAGTTACACAT
GGTGCTAAAATAGATGCTCAAGATAAAGAAGGATGGACTCCACTTTTTGC
GGCAATTTCTTGTAATTATTTGCCAATAACAAACTACCTCATTTCATGCA
ATGCTAGACTTGATGTAGTCAGTTTCGATGGAGAATTACCGCTTGACCAA
TCAAATAACGAAGCAATGACGTCTTTTTTAGTTGAAGAATTGAAAAAGAG
AAACTTAGACCAAAATGAGATTCGGAATCGGGAACGGAATGCAATGCTCA
ATGAGGTAGAAAAAATTAAAATCAATAAAGACTTTAGTAATTTTACCATG
GTTGATAATGGAGCGACTATGTTGCACGTTGCAGCTTCTAAAGATTATAT
AGACGTGCTGGAAAATTTGCTTGCCATTATCACTCCAGAATTGCTCAATC
AAAAAGACAATGATGGTTGGAATGCATTACACGTTGCTGCCCATTGGAAT
CACAGGAGGGCTTGTGTTATTCTTGTAGAGGCTGAAATTGATTTTGATTC
TCTAACATCATCTAATCAAACTGTTCTCGAAGTGGCTGATGACGAAGTGA
AACCATACTTACGGGAAGAAATTCGAAAGGCAAGATTCAGACGAGACGAA
AAAGCATCTATAAAGAGACCTGCACCGTCACCGAACGGCGAATTTCAGCC
GAGTGTCACAAAGATTATATGTCAAGAGAAAATCAACCAAATATCTATTG
TTGAAAGCAAACAGGTCAATGGTGATAAACTTGTCACGATTACAGAAACT
TCGACAATTTCGACTACTCACAATAATCAAAAATTAAATCAGAAAACTCT
TGATGAGAATAAAGAATTAGTGTCAAATGTCGATCCAATGGACTTAAAAT
TAAATTCCATTGATGTAACGCACAAAACTCAAATTGATCCTTCTGATACC
GAGGCTAAAACTTTAACGCCAAGTTTATCAACATCGACATCAGAGATTAA
TGAAAATTCACAGCCAGTTCAAGAAAAATCAGATCATGTGATTTATGAAA
AGAGTGACTCTAAAACAAAAATTAAAAGTATAGAATCTGAGAGTCAACGA
AAAGATAAAGCGCGACATGTGCGCTCAACAAGACGATCAACGCAGGGAGT
CACTGCGGAAGATATTGACGAAGCAAAAAAATTAATGTCCACTGTTCAGA
AACAAGAGAAGTTCAACATGCCTTCTCAAATTTCAACGATAATGGAGAAC
AAAAACGACACGTCTGATATGTCGACAATTCTAAATCATTCAATAAAGTC
AAATCATTCAGAACCAGTAGTTACAAATAAAGAAAATTTTGTCAATATCA
AGGAATCCGTTAATATTGTGCCACCGTACCCTACCGTTATAACTCCCACG
AATTTATTATCAGAAACATCAGAAACTCAACCGGTTGATGTACAATCAGA
TTTATCAGAGTTAAATGATCGAAAAAAACGAACTGGTAGTCATTTGGTGA
ATAAAAGACGAACACGTGAAAGACCACCTACTGGAACAATCGATTTAAAA
GATATTCAGGCAGCTCAATCAGAAGTAAAAATCTTAGATGAATCTGAAAA
AAGTGTGGATAATATGGATAATCCTAAAACAGTTAGTTCAGAAATTGATT
ACAAACAATTGTATGAGCTCGAGTGTAAGGAAAAAGATAAATTACTCAGA
AATCTGACCAGAATTAAAAAGGAATTACAAGAATCTCAAGACCAAATAAG
GCTTTTACAAAATACTAACATCGTTTCAAAGAATAATAAAATACCACAGA
AATCAATCGCTTTTCAATCAGATTCAGATATTAAAGAAGTTGAAAAACTC
AGAGAAGAAAACAGAAAGATGAAAGAAGCTAATAGTGCTTTGATACGTGT
AATAAGTCGACTATCTCATCCTCCTGCGGTTACTAAATCAACTGCAGGAT
CTACCTGATATATATGCTCATAGAGCAATACGGATCTGTTTTGATTTTAT
ATTATATATTTATAATTATTATAATTATATTATTATTATTTATTAATAAT
TATTACGTTTCTGGTCACCGAGCAATTCTTTATGTTATTGATATTTTCTA
CATTAGATTGAAG
back to top

protein sequence of SMED30011384-orf-1

>SMED30011384-orf-1 ID=SMED30011384-orf-1|Name=SMED30011384-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=731bp
MSSEQSNILKRQEQLNLWFDSETDKASNSIKEADKIKFPKEVQFFSACNS
NDWSEIERLLDDGIEINCTQDDGLTALHQACIDDDENLVRYLVTHGAKID
AQDKEGWTPLFAAISCNYLPITNYLISCNARLDVVSFDGELPLDQSNNEA
MTSFLVEELKKRNLDQNEIRNRERNAMLNEVEKIKINKDFSNFTMVDNGA
TMLHVAASKDYIDVLENLLAIITPELLNQKDNDGWNALHVAAHWNHRRAC
VILVEAEIDFDSLTSSNQTVLEVADDEVKPYLREEIRKARFRRDEKASIK
RPAPSPNGEFQPSVTKIICQEKINQISIVESKQVNGDKLVTITETSTIST
THNNQKLNQKTLDENKELVSNVDPMDLKLNSIDVTHKTQIDPSDTEAKTL
TPSLSTSTSEINENSQPVQEKSDHVIYEKSDSKTKIKSIESESQRKDKAR
HVRSTRRSTQGVTAEDIDEAKKLMSTVQKQEKFNMPSQISTIMENKNDTS
DMSTILNHSIKSNHSEPVVTNKENFVNIKESVNIVPPYPTVITPTNLLSE
TSETQPVDVQSDLSELNDRKKRTGSHLVNKRRTRERPPTGTIDLKDIQAA
QSEVKILDESEKSVDNMDNPKTVSSEIDYKQLYELECKEKDKLLRNLTRI
KKELQESQDQIRLLQNTNIVSKNNKIPQKSIAFQSDSDIKEVEKLREENR
KMKEANSALIRVISRLSHPPAVTKSTAGST*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
IPR031775PRKG1_interact
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0019901protein kinase binding
GO:0046982protein heterodimerization activity
GO:007188914-3-3 protein binding
GO:0019208phosphatase regulator activity
Vocabulary: cellular component
TermDefinition
GO:0031672A band
GO:0072357PTW/PP1 phosphatase complex
GO:0005737cytoplasm
GO:0030018Z disc
Vocabulary: biological process
TermDefinition
GO:0035507regulation of myosin-light-chain-phosphatase activity
GO:0051017actin filament bundle assembly
GO:0060028convergent extension involved in axis elongation
GO:0070650actin filament bundle distribution
GO:0001889liver development
GO:0008360regulation of cell shape
GO:0021555midbrain-hindbrain boundary morphogenesis
GO:0030155regulation of cell adhesion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 311..338
NoneNo IPR availableCOILSCoilCoilcoord: 263..293
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 8..47
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 175..214
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..90
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 48..75
NoneNo IPR availablePANTHERPTHR24179FAMILY NOT NAMEDcoord: 29..343
IPR031775cGMP-dependent protein kinase, interacting domainPFAMPF15898PRKG1_interactcoord: 254..343
e-value: 1.2E-14
score: 55.0