Queuosine salvage protein

Overview
NameQueuosine salvage protein
Smed IDSMED30011372
Length (bp)1118
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Queuosine salvage protein (SMED30011372) t-SNE clustered cells

Violin plots show distribution of expression levels for Queuosine salvage protein (SMED30011372) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Queuosine salvage protein (SMED30011372) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Queuosine salvage protein (SMED30011372) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011372

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30011372SMESG000078335.1 SmedASXL_019436SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
X1 cellSMED30011372SMESG000078335.1 SmedASXL_019436SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30011372SMESG000078335.1 SmedASXL_019436SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
cephalic gangliaSMED30011372SMESG000078335.1 dd_Smed_v4_5644_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30011372SMESG000078335.1 dd_Smed_v4_5644_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30011372SMESG000078335.1 dd_Smed_v6_5644_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
neoblastSMED30011372SMESG000078335.1 SMED_12991_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30011372SMESG000078335.1 SMED_12991_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30011372SMESG000078335.1 SmWIOct06_013756GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Queuosine salvage protein vs. Ensembl Human
Match: C9orf64 (chromosome 9 open reading frame 64 [Source:HGNC Symbol;Acc:HGNC:28144])

HSP 1 Score: 308.531 bits (789), Expect = 8.366e-103
Identity = 152/349 (43.55%), Postives = 222/349 (63.61%), Query Frame = 1
Query:   82 PKLSAQYITNKAEHVSINEDGVNKLCEDLLGMFSQGKYGLETWKT-HELNPKSFDDKAISWIFFIDTINFSFWPDENHAKFTVIYNGKTYTGYWSICAAVNRAIEMGINVFDANYMANMTIEQFNSIFYSENHESLPLVNERVNVIREAGSVLLNKFQGNFINCVCQAENSAQKLIQIIVDNFSSYRDVSFYKGKSVCIYKRAQILIADIWCCFGGNDFGKFYDIDSLTAFADYRVPQVLNFFNAIQYSKDLKEHLDNSNNIICLSFPNNRSDKPIEHDHPWEVEIRGVTLQCIEIMVDKINKMIDSNV----AVVNSILVDNYLWDYRRTQEKSIDKVPMHRTRTIYY 1113
            P+ S+++I   +  V I+  GV ++ E LL   +  +  +E WK  HELNP++ D+ A++W+F  DT+NFSFW +++  K  V Y GKTY+GYWS+CAAVNRA++ GI +  A+Y A +T++Q  +I  S+   S+PLV ER  ++ E G +LL KF G+F+NCV ++ENSAQKL+ ++V++F SYRDV+ ++GK V  YKRAQIL+AD W    G   G F DI S+T FADYR+PQVL    A++YS DL + L        LS+ + +           EVEIRG +L C+E++ D + ++I+         +NSIL+D YLWDY     + +  +P HR R IYY
Sbjct:    7 PRESSKFIAENSRDVFIDSGGVRRVAELLLAKAAGPELRVEGWKALHELNPRAADEAAVNWVFVTDTLNFSFWSEQDEHKCVVRYRGKTYSGYWSLCAAVNRALDEGIPITSASYYATVTLDQVRNILRSDTDVSMPLVEERHRILNETGKILLEKFGGSFLNCVRESENSAQKLMHLVVESFPSYRDVTLFEGKRVSFYKRAQILVADTWSVLEGKGDGCFKDISSITMFADYRLPQVLAHLGALKYSDDLLKKLLKGE---MLSYGDRQ-----------EVEIRGCSLWCVELIRDCLLELIEQKGEKPNGEINSILLDYYLWDYAHDHREDMKGIPFHRIRCIYY 341          
BLAST of Queuosine salvage protein vs. Ensembl Human
Match: C9orf64 (chromosome 9 open reading frame 64 [Source:HGNC Symbol;Acc:HGNC:28144])

HSP 1 Score: 186.808 bits (473), Expect = 2.672e-57
Identity = 95/214 (44.39%), Postives = 133/214 (62.15%), Query Frame = 1
Query:  484 LPLVNERVNVIREAGSVLLNKFQGNFINCVCQAENSAQKLIQIIVDNFSSYRDVSFYKGKSVCIYKRAQILIADIWCCFGGNDFGKFYDIDSLTAFADYRVPQVLNFFNAIQYSKDLKEHLDNSNNIICLSFPNNRSDKPIEHDHPWEVEIRGVTLQCIEIMVDKINKMIDSNV----AVVNSILVDNYLWDYRRTQEKSIDKVPMHRTRTIYY 1113
            +PLV ER  ++ E G +LL KF G+F+NCV ++ENSAQKL+ ++V++F SYRDV+ ++GK V  YKRAQIL+AD W    G   G F DI S+T FADYR+PQVL    A++YS DL + L        LS+ + +           EVEIRG +L C+E++ D + ++I+         +NSIL+D YLWDY     + +  +P HR R IYY
Sbjct:    1 MPLVEERHRILNETGKILLEKFGGSFLNCVRESENSAQKLMHLVVESFPSYRDVTLFEGKRVSFYKRAQILVADTWSVLEGKGDGCFKDISSITMFADYRLPQVLAHLGALKYSDDLLKKLLKGE---MLSYGDRQ-----------EVEIRGCSLWCVELIRDCLLELIEQKGEKPNGEINSILLDYYLWDYAHDHREDMKGIPFHRIRCIYY 200          
BLAST of Queuosine salvage protein vs. Ensembl Human
Match: C9orf64 (chromosome 9 open reading frame 64 [Source:HGNC Symbol;Acc:HGNC:28144])

HSP 1 Score: 74.7146 bits (182), Expect = 1.256e-16
Identity = 30/58 (51.72%), Postives = 46/58 (79.31%), Query Frame = 1
Query:  484 LPLVNERVNVIREAGSVLLNKFQGNFINCVCQAENSAQKLIQIIVDNFSSYRDVSFYK 657
            +PLV ER  ++ E G +LL KF G+F+NCV ++ENSAQKL+ ++V++F SYRDV+ ++
Sbjct:    1 MPLVEERHRILNETGKILLEKFGGSFLNCVRESENSAQKLMHLVVESFPSYRDVTLFE 58          
BLAST of Queuosine salvage protein vs. Ensembl Celegans
Match: C11D2.4 (Queuosine salvage protein [Source:UniProtKB/TrEMBL;Acc:O45069])

HSP 1 Score: 283.493 bits (724), Expect = 2.207e-93
Identity = 147/351 (41.88%), Postives = 213/351 (60.68%), Query Frame = 1
Query:   82 PKLSAQYITNKAEHVSINEDGVNKLCEDLLGMFSQGKYGLETWKTHELNPKSFDDKAISWIFFIDTINFSFWPDENHAKFTVIYNGKTYTGYWSICAAVNRAIEMGINVFDANYMANMTIEQFNSIFYSENHESLPLVNERVNVIREAGSVLLNKFQGNFINCVCQAENSAQKLIQIIVDNFSSYRDVSFYKGKSVCIYKRAQILIADIWCCFGG-NDFGKFYDIDSLTAFADYRVPQVLNFFNAIQYSKDLKEHLDNSNNIICLSFPNNRSDKPIEHDHPWEVEIRGVTLQCIEIMVDKINKMID-----SNVAVVNSILVDNYLWDYRRTQEKSID-KVPMHRTRTIYY 1113
            P  S ++I      V IN+ GV K+ E +LG    G      + + EL+PKS D  A+ W+  +DTINFSFWPDE    + V + GK YTGY++ CAAVN+AI  GI V  A +M N+  E+ + IF S++  S+PL+++RV  I ++G VLL KF G F NCV ++E SAQ L+++IV+NF S+RD + + G+ V + KRAQIL+AD++    G +D G F DI ++T FADYRVPQ L +  A+ YS++L   L                 K +E+    EVE+RG ++   + +V K+N++ +     S+V  VN++ VD Y+W YRR     ++ KVP HRTR IYY
Sbjct:    9 PAESGKFIVEHGNLVKINQAGVRKVAEHILGAAKDGSLKEALFLSPELHPKSGDKDAVQWVLLVDTINFSFWPDEGD-HYDVSWGGKAYTGYFAACAAVNKAIAAGIPVLSAEWMKNVGREEIDRIFKSDSGHSIPLLDDRVKAINDSGKVLLEKFDGQFYNCVIKSEKSAQTLLKLIVENFVSFRDFAEFNGQKVSLLKRAQILVADVYGSLQGHDDAGNFKDITTITMFADYRVPQALAYLGALDYSEELLSQLGEG--------------KRLENGSKAEVELRGASIAVCDEIVAKMNELRETDPRFSDVCEVNAMEVDVYVWGYRRLYAADVEKKVPFHRTRCIYY 344          
BLAST of Queuosine salvage protein vs. Ensembl Fly
Match: CG9752 (gene:FBgn0034614 transcript:FBtr0071616)

HSP 1 Score: 262.692 bits (670), Expect = 2.758e-85
Identity = 131/361 (36.29%), Postives = 218/361 (60.39%), Query Frame = 1
Query:   61 LNNIRMLPKLSAQYITNKAEHVSINEDGVNKLCEDLLGMFSQGKYGLETWKTHEL--NPKSFDD--KAISWIFFIDTINFSFWPDENHAKFTVIYNGKTYTGYWSICAAVNRAIEMGINVFDANYMANMTIEQFNSIFYSENHES-LPLVNERVNVIREAGSVLLNKFQGNFINCVCQAENSAQKLIQIIVDNFSSYRDVSFYKGKSVCIYKRAQILIADIWCCFGGNDFGKFYDIDSLTAFADYRVPQVLNFFNAIQYSKDLKEHLDNSNNIICLSFPNNRSDKPIEHDHPWEVEIRGVTLQCIEIMVDKINKMIDS-----NVAVVNSILVDNYLWDYRRTQEKSIDKVPMHRTRTIYY 1113
            +++ ++ P+ S  YI   A+HV I   G+ KL ++++    + +  +E +  HEL  NP   +D  KA  W+F +DT+NF FW   N+ K+ V      YTGY+++CAA+ RAI+ G++V +  + + + ++   +IF S++ E+ +PL+ +R+  + E G VL++K+ G+F N + +AE SA +L+ ++V+ F  +RD + + GK V I KRAQIL+ D+W C+ G   G F DID +T FADYR+PQVL  F +++Y+ +L E L              ++D  +E+  P EVEIRG ++  IE + D + K++       ++  VNSI++D YLWDYRR     ++ +P H+  +IYY
Sbjct:    1 MSSSKLSPRESGAYIVENAKHVRILPAGIEKLTQEIVKGLIEKRIAVENFSQHELHPNPNQPEDYSKAADWVFVLDTLNFCFWTPNNYTKYKV----DGYTGYFALCAAIKRAIKEGVDVINPKFYSQIDLKTVENIFRSDDGETVIPLLQKRLESLHEVGKVLIDKYDGSFENVIKKAEKSAVRLLDLVVEEFPCFRDEAEFAGKRVSILKRAQILVGDVWSCYRGQGLGFFNDIDQITMFADYRIPQVLVHFGSLEYTSELMEFL--------------KTDTILENGDPREVEIRGASIYIIEQVRDAVVKILKEQHPEISLDNVNSIVIDQYLWDYRRRHNADLEHIPFHKVLSIYY 343          
BLAST of Queuosine salvage protein vs. Ensembl Zebrafish
Match: C8H9orf64 (zgc:136564 [Source:ZFIN;Acc:ZDB-GENE-070410-3])

HSP 1 Score: 241.121 bits (614), Expect = 9.373e-77
Identity = 123/348 (35.34%), Postives = 197/348 (56.61%), Query Frame = 1
Query:   82 PKLSAQYITNKAEHVSINEDGVNKLCEDLLGMFSQGKYGLETWKT-HELNPKSFDDKAISWIFFIDTINFSFWPDENHAKFTVIYNGKTYTGYWSICAAVNRAIEMGINVFDANYMANMTIEQFNSIFYSENHESLPLVNERVNVIREAGSVLLNKFQGNFINCVCQAENSAQKLIQIIVDNFSSYRDVSFYKGKSVCIYKRAQILIADIWCCFGGNDFGKFYDIDSLTAFADYRVPQVLNFFNAIQYSKDLKEHLDNSNNIICLSFPNNRSDKPIEHDHPWEVEIRGVTLQCIEIMVDKINKMI---DSNVAVVNSILVDNYLWDYRRTQEKSIDKVPMHRTRTIYY 1113
            P+ S ++++ ++  V ++EDGV ++ + +  +    ++    WK  + L P    D AI+W+F  DT+NFSFWP++   +  V+  G TY GY S+CAA+ RA++ G+ + + ++ + ++  +   +  S++   +P++ ER   + EAG VL+ +  G+F   + + EN AQK++Q IV+N  SYRD + Y+GK +  YKRAQIL+AD W        G   ++D LT FADYRVPQ L +  A++YS  L E L N      LS    R           EVEIRG ++ C+E +   + K++   D     +NS L+D YLW Y +   K +  +P+H TR IYY
Sbjct:    7 PRESGRFVSERSRDVFVDEDGVKRVAQMIYELRDSDEFTASGWKKMNPLAPSPDSDDAINWVFVTDTMNFSFWPEKEDEQCEVVCRGDTYRGYMSLCAAITRAMDEGVPITNPSFFSEISESELAKVLRSDSPTPMPMLRERHQALTEAGRVLV-QHGGSFRTFMSRCENDAQKMVQHIVENIPSYRDEATYEGKRISFYKRAQILVADFWGIMEARGEGNIPNLDYLTMFADYRVPQGLVYLGALRYSDALMETLKNGE---LLSSGERR-----------EVEIRGCSIWCVEKIRQHLWKLVEEKDGKSCHINSALIDFYLWPYAKKHHKEMAHIPIHHTRCIYY 339          
BLAST of Queuosine salvage protein vs. Ensembl Zebrafish
Match: C8H9orf64 (zgc:136564 [Source:ZFIN;Acc:ZDB-GENE-070410-3])

HSP 1 Score: 139.428 bits (350), Expect = 2.846e-39
Identity = 62/193 (32.12%), Postives = 116/193 (60.10%), Query Frame = 1
Query:   82 PKLSAQYITNKAEHVSINEDGVNKLCEDLLGMFSQGKYGLETWKT-HELNPKSFDDKAISWIFFIDTINFSFWPDENHAKFTVIYNGKTYTGYWSICAAVNRAIEMGINVFDANYMANMTIEQFNSIFYSENHESLPLVNERVNVIREAGSVLLNKFQGNFINCVCQAENSAQKLIQIIVDNFSSYRDVSFYK 657
            P+ S ++++ ++  V ++EDGV ++ + +  +    ++    WK  + L P    D AI+W+F  DT+NFSFWP++   +  V+  G TY GY S+CAA+ RA++ G+ + + ++ + ++  +   +  S++   +P++ ER   + EAG VL+ +  G+F   + + EN AQK++Q IV+N  SYRD + Y+
Sbjct:    7 PRESGRFVSERSRDVFVDEDGVKRVAQMIYELRDSDEFTASGWKKMNPLAPSPDSDDAINWVFVTDTMNFSFWPEKEDEQCEVVCRGDTYRGYMSLCAAITRAMDEGVPITNPSFFSEISESELAKVLRSDSPTPMPMLRERHQALTEAGRVLV-QHGGSFRTFMSRCENDAQKMVQHIVENIPSYRDEATYE 198          
BLAST of Queuosine salvage protein vs. Ensembl Xenopus
Match: vkorc1l1 (vitamin K epoxide reductase complex subunit 1 like 1 [Source:Xenbase;Acc:XB-GENE-944095])

HSP 1 Score: 293.123 bits (749), Expect = 7.672e-97
Identity = 138/351 (39.32%), Postives = 216/351 (61.54%), Query Frame = 1
Query:   76 MLPKLSAQYITNKAEHVSINEDGVNKLCEDLLGMFSQGKYGLETWKT-HELNPKSFDDKAISWIFFIDTINFSFWPDENHAKFTVIYNGKTYTGYWSICAAVNRAIEMGINVFDANYMANMTIEQFNSIFYSENHESLPLVNERVNVIREAGSVLLNKFQGNFINCVCQAENSAQKLIQIIVDNFSSYRDVSFYKGKSVCIYKRAQILIADIWCCFGGNDFGKFYDIDSLTAFADYRVPQVLNFFNAIQYSKDLKEHLDNSNNIICLSFPNNRSDKPIEHDHPWEVEIRGVTLQCIEIMVDKINKMIDSNVAV----VNSILVDNYLWDYRRTQEKSIDKVPMHRTRTIYY 1113
            +LP+ + + I   ++ V +  +GV  L E L     + +  L+ WK+ HELNP+   + A++W+FF+DT+NFSFW +    K+ V Y GK Y+GYWS+CAA+NRA++ GI +  A+Y +++T+EQ   I  S++   +P++ ER+ ++ + G +L+ KF G+F+NCV  ++NSA KL+Q++VDNF SYRD   +KGK V  YKRAQIL+ D W    G   G FYDI ++T FADYR+PQ L  F A++YS++L + L          F N             E+EIRG ++  +E++ +++ ++ +         +N +L+D++LWDY R     I+ VP HR R IYY
Sbjct:    5 LLPREAGKLIAENSKDVYVEAEGVRSLAEKLFEKIGRNEITLKGWKSLHELNPQDSGEDAVNWVFFVDTLNFSFWSESEENKYLVKYKGKEYSGYWSLCAAMNRALDEGIPLTTASYYSSLTLEQLKHILRSDSETPIPMIEERLEILHQTGKILMEKFGGSFLNCVQMSQNSAVKLMQLVVDNFPSYRDEGCFKGKKVAFYKRAQILVGDTWGVLEGKGDGCFYDIQNMTMFADYRIPQALAHFGAMKYSEELLKQLKEG-----WLFRNGDVQ---------EMEIRGCSIWAVELICEQLLRLFEKCGKQMSNEINPVLIDHFLWDYARDYRNEINAVPFHRVRCIYY 341          
BLAST of Queuosine salvage protein vs. Ensembl Xenopus
Match: vkorc1l1 (vitamin K epoxide reductase complex subunit 1 like 1 [Source:Xenbase;Acc:XB-GENE-944095])

HSP 1 Score: 190.66 bits (483), Expect = 2.890e-58
Identity = 93/242 (38.43%), Postives = 145/242 (59.92%), Query Frame = 1
Query:  400 INVFDANYMANMTIEQFNSIFYSENHESLPLVNERVNVIREAGSVLLNKFQGNFINCVCQAENSAQKLIQIIVDNFSSYRDVSFYKGKSVCIYKRAQILIADIWCCFGGNDFGKFYDIDSLTAFADYRVPQVLNFFNAIQYSKDLKEHLDNSNNIICLSFPNNRSDKPIEHDHPWEVEIRGVTLQCIEIMVDKINKMIDSNVAV----VNSILVDNYLWDYRRTQEKSIDKVPMHRTRTIYY 1113
            I +  A+Y +++T+EQ   I  S++   +P++ ER+ ++ + G +L+ KF G+F+NCV  ++NSA KL+Q++VDNF SYRD   +KGK V  YKRAQIL+ D W    G   G FYDI ++T FADYR+PQ L  F A++YS++L + L          F N             E+EIRG ++  +E++ +++ ++ +         +N +L+D++LWDY R     I+ VP HR R IYY
Sbjct:   11 IPLTTASYYSSLTLEQLKHILRSDSETPIPMIEERLEILHQTGKILMEKFGGSFLNCVQMSQNSAVKLMQLVVDNFPSYRDEGCFKGKKVAFYKRAQILVGDTWGVLEGKGDGCFYDIQNMTMFADYRIPQALAHFGAMKYSEELLKQLKEG-----WLFRNGDVQ---------EMEIRGCSIWAVELICEQLLRLFEKCGKQMSNEINPVLIDHFLWDYARDYRNEINAVPFHRVRCIYY 238          
BLAST of Queuosine salvage protein vs. Ensembl Mouse
Match: 2210016F16Rik (RIKEN cDNA 2210016F16 gene [Source:MGI Symbol;Acc:MGI:1917403])

HSP 1 Score: 292.738 bits (748), Expect = 6.701e-97
Identity = 144/348 (41.38%), Postives = 221/348 (63.51%), Query Frame = 1
Query:   82 PKLSAQYITNKAEHVSINEDGVNKLCEDLLGMFSQGKYGLETWKT-HELNPKSFDDKAISWIFFIDTINFSFWPDENHAKFTVIYNGKTYTGYWSICAAVNRAIEMGINVFDANYMANMTIEQFNSIFYSENHESLPLVNERVNVIREAGSVLLNKFQGNFINCVCQAENSAQKLIQIIVDNFSSYRDVSFYKGKSVCIYKRAQILIADIWCCFGGNDFGKFYDIDSLTAFADYRVPQVLNFFNAIQYSKDLKEHLDNSNNIICLSFPNNRSDKPIEHDHPWEVEIRGVTLQCIEIMVDKINKMID--SNVAV-VNSILVDNYLWDYRRTQEKSIDKVPMHRTRTIYY 1113
            P+ SA+++   +  V ++ +GV +  E L  + +   + +E WK+ HELNP+  D+ A+ W+F +D++NFSFW +   +K  V Y G  YTGYW++CAAVNRA++ GI +  A+Y A +++EQ   IF S+    +PL+ ER  ++ E G +LL KF G+F+NCV ++  SAQKL+Q+IV+NF SYRD + ++GK +  YKRAQIL+AD W    G   G F DI S+T FADYR+PQ+L +  A++YS +L + L     ++         DK        EVEIRG ++ C+E++ D++ ++++   N  V +NS+L+D +LWDY R   + +  VP HRTR IYY
Sbjct:    7 PRESARFVAENSRDVLVDHEGVRRAAELL--LPAAAAWRVEQWKSLHELNPRGADEAALGWVFLVDSLNFSFWAEREDSKCAVRYGGTPYTGYWALCAAVNRALDQGIPITSASYYATVSLEQVRDIFRSDTAVPMPLMEERHRILNETGKILLEKFGGSFLNCVQKSGRSAQKLMQLIVENFPSYRDEAEFEGKRIAFYKRAQILVADTWSVLEGKGDGCFEDISSITMFADYRLPQILVYLGALKYSDELLKKLLKGEMLL-------NGDKQ-------EVEIRGCSIWCVELIRDRLLELLEKGENSPVEINSVLLDYHLWDYAREHREDMKGVPFHRTRCIYY 338          
BLAST of Queuosine salvage protein vs. UniProt/SwissProt
Match: sp|Q5T6V5|QSPP_HUMAN (Queuosine salvage protein OS=Homo sapiens OX=9606 GN=C9orf64 PE=1 SV=1)

HSP 1 Score: 308.531 bits (789), Expect = 4.018e-102
Identity = 152/349 (43.55%), Postives = 222/349 (63.61%), Query Frame = 1
Query:   82 PKLSAQYITNKAEHVSINEDGVNKLCEDLLGMFSQGKYGLETWKT-HELNPKSFDDKAISWIFFIDTINFSFWPDENHAKFTVIYNGKTYTGYWSICAAVNRAIEMGINVFDANYMANMTIEQFNSIFYSENHESLPLVNERVNVIREAGSVLLNKFQGNFINCVCQAENSAQKLIQIIVDNFSSYRDVSFYKGKSVCIYKRAQILIADIWCCFGGNDFGKFYDIDSLTAFADYRVPQVLNFFNAIQYSKDLKEHLDNSNNIICLSFPNNRSDKPIEHDHPWEVEIRGVTLQCIEIMVDKINKMIDSNV----AVVNSILVDNYLWDYRRTQEKSIDKVPMHRTRTIYY 1113
            P+ S+++I   +  V I+  GV ++ E LL   +  +  +E WK  HELNP++ D+ A++W+F  DT+NFSFW +++  K  V Y GKTY+GYWS+CAAVNRA++ GI +  A+Y A +T++Q  +I  S+   S+PLV ER  ++ E G +LL KF G+F+NCV ++ENSAQKL+ ++V++F SYRDV+ ++GK V  YKRAQIL+AD W    G   G F DI S+T FADYR+PQVL    A++YS DL + L        LS+ + +           EVEIRG +L C+E++ D + ++I+         +NSIL+D YLWDY     + +  +P HR R IYY
Sbjct:    7 PRESSKFIAENSRDVFIDSGGVRRVAELLLAKAAGPELRVEGWKALHELNPRAADEAAVNWVFVTDTLNFSFWSEQDEHKCVVRYRGKTYSGYWSLCAAVNRALDEGIPITSASYYATVTLDQVRNILRSDTDVSMPLVEERHRILNETGKILLEKFGGSFLNCVRESENSAQKLMHLVVESFPSYRDVTLFEGKRVSFYKRAQILVADTWSVLEGKGDGCFKDISSITMFADYRLPQVLAHLGALKYSDDLLKKLLKGE---MLSYGDRQ-----------EVEIRGCSLWCVELIRDCLLELIEQKGEKPNGEINSILLDYYLWDYAHDHREDMKGIPFHRIRCIYY 341          
BLAST of Queuosine salvage protein vs. UniProt/SwissProt
Match: sp|Q1JP73|QSPP_BOVIN (Queuosine salvage protein OS=Bos taurus OX=9913 PE=2 SV=1)

HSP 1 Score: 303.523 bits (776), Expect = 2.906e-100
Identity = 148/351 (42.17%), Postives = 220/351 (62.68%), Query Frame = 1
Query:   76 MLPKLSAQYITNKAEHVSINEDGVNKLCEDLLGMFSQGKYGLETWKT-HELNPKSFDDKAISWIFFIDTINFSFWPDENHAKFTVIYNGKTYTGYWSICAAVNRAIEMGINVFDANYMANMTIEQFNSIFYSENHESLPLVNERVNVIREAGSVLLNKFQGNFINCVCQAENSAQKLIQIIVDNFSSYRDVSFYKGKSVCIYKRAQILIADIWCCFGGNDFGKFYDIDSLTAFADYRVPQVLNFFNAIQYSKDLKEHLDNSNNIICLSFPNNRSDKPIEHDHPWEVEIRGVTLQCIEIMVDKINKMI----DSNVAVVNSILVDNYLWDYRRTQEKSIDKVPMHRTRTIYY 1113
            + P+ SA++I   +  V I++ GV ++ E LL   +  +  +E WK  HELNP+  D+ A++W+F  DT+NFSFW + +  K  V + GKTY+GYWS+CAAVNRA++ GI +  A+Y A +T+++   I  S+    +PL+ ER  ++ E G +LL KF G+F+NCV +++ SAQKL+ ++V+NF SYRDV+ ++GK +  YKRAQIL+AD W    G   G F DI S+T FADYR+PQVL +  A++YS +L E L     +    F  NR           EVEIRG ++ C+E++ D + ++I    +     +NSIL+D YLWDY R   + +  +P H TR IYY
Sbjct:    5 LTPRESAKFIAENSRDVFIDDGGVRRVAELLLAKATGPELRIEGWKAIHELNPRGTDEAAVNWVFVTDTLNFSFWSESDEYKCQVGFGGKTYSGYWSLCAAVNRALDEGIPITSASYYATVTLDEVRHILRSDTDVPMPLIEERHRILNETGKILLEKFGGSFLNCVQKSDKSAQKLLHLVVENFPSYRDVTQFEGKRISFYKRAQILVADTWSVLEGKGDGCFKDISSITMFADYRLPQVLVYLGALKYSNELLEKLLKGEML----FYGNRQ----------EVEIRGCSVWCVELIRDCLLELIEKKGEKTTGEINSILLDYYLWDYARDHREDMKGIPFHHTRCIYY 341          
BLAST of Queuosine salvage protein vs. UniProt/SwissProt
Match: sp|A7SNN9|QSPP_NEMVE (Queuosine salvage protein OS=Nematostella vectensis OX=45351 GN=v1g230591 PE=3 SV=1)

HSP 1 Score: 261.922 bits (668), Expect = 8.278e-84
Identity = 134/362 (37.02%), Postives = 207/362 (57.18%), Query Frame = 1
Query:   61 LNNIRMLPKLSAQYITNKAEHVSINEDGVNKLCEDLLGMFSQGKYGLETWKTHELNPKSFDDKAISWIFFIDTINFSFWPDENHAKFTVIYNGKTYTGYWSICAAVNRAIEMGINVFDANYMANMTIEQFNSIFYSENHESLPLVNERVNVIREAGSVLLNKFQGNFINCVCQAENSAQKLIQIIVDNFSSYRDVSFYKGKSVCIYKRAQILIADIWCCFGGNDFGKFYDIDSLTAFADYRVPQVLNFFNAIQYSKDLKEHLDNSNNIICLSFPNNRSDKPIEHDHPWEVEIRGVTLQCIEIMV----------DKINKMIDSNVA-VVNSILVDNYLWDYRRTQEKSIDKVPMHRTRTIYY 1113
            ++N  MLP+ S  +I + ++ VS+ E+G+++  E +        Y  +TWK HEL+PK      + WIF +DT+NFSFW D+    +T+ + GK + GYW++CA +NRAIE GI++   +Y  N+TI+    IF SE    +PL+ ER   +RE G++L   FQ +F + +  A  SA+ L+ ++++NF  +RD   +  + V  YKRAQILIAD W CF G  FG+F DID LT FADY+VPQ L     +Q+S+ LK+ L               + + I H    E+EIRG ++  +E +            + + M    +A  +NS+++D YLWD+ +  E     +P H+TRTI+Y
Sbjct:    1 MSNQVMLPRESGSFIASHSKDVSLCEEGISRASEIVFKSLKSNAYSYKTWKDHELHPKEMSKATVDWIFVLDTLNFSFWVDDGLEPWTIRHKGKDFQGYWALCAGINRAIEEGIHLTSPSYYRNITIDDLKHIFRSETSTEMPLLEERAKNLRETGNILAQTFQNSFAHMILLANKSAKLLLSMVINNFDCFRDDGDFCNQKVSFYKRAQILIADTWACFEGKGFGEFPDIDFLTMFADYKVPQGLYDLGVLQFSEALKQKL--------------VTGQLIPHGDQLEMEIRGNSIWAVEKIYLAVKLKAKKSPEFSNMDSLELAQYLNSVIIDFYLWDFSKNVEARAS-IPCHKTRTIFY 347          
BLAST of Queuosine salvage protein vs. UniProt/SwissProt
Match: sp|Q9HDZ9|QSPP_SCHPO (Queuosine salvage protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC589.05c PE=3 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 8.072e-74
Identity = 122/359 (33.98%), Postives = 200/359 (55.71%), Query Frame = 1
Query:   94 AQYITNKAEHVSINEDGVNKLCEDLLGMFSQGKYGLETWKTHELNPKSFDDKAISWIFFIDTINFSFWPD-------ENHAKFTVIYNGKTYTGYWSICAAVNRAIEMGINVFDANYMAN---MTIEQFNSIFYSENHESLPLVNERVNVIREAGSVLLNKFQGNFINCVCQAENSAQKLIQIIVDNFSSYRDVSFYKGKSVCIYKRAQILIADIWCCFGGNDFGKFYDIDSLTAFADYRVPQVLNFFNAIQYSKDLKEHLDNSNNIICLSFPNNRSDKPIEHDHPWEVEIRGVTLQCIEIMVDKINKMIDSNVAVVNSILVDNYLWD---------YRRTQEKSIDKVPMHRTRTIYY 1113
            A++I+  +  V +N+ G   +   +             W+ HEL+PK+ D   + WIF +D +NFSFW D       ++  +F++ Y GK YTGYWS+CAA+N+A++ GI +    + A+          S+F S   E +PL+ ER+ ++R +G VL++ + G++   + +  N AQ+LI++++ +F  +RDVS YKG+   + KRAQIL+A+ W CF G ++G+F DIDS+T FADYRVPQ+L     + YS D K+ L                ++ I H+ P E+E+RG ++  +E ++  IN+        VN+I +D +LWD         Y+ + +     +P  R R+IYY
Sbjct:    8 AEFISLNSNDVKVNKGGCAAVATWIKEKLDSLGPQFAEWQNHELHPKTRDVSTLDWIFLVDILNFSFWSDVDVEDSGKHSKRFSIEYKGKLYTGYWSLCAAINKALDAGIPITSPAFYADEKQCPDTLIASVFDSATVEKIPLLEERIRIMRASGRVLVDSYHGSYCGLLKKCHNQAQRLIKLLLADFPDFRDVSVYKGRECYMLKRAQILVAETWACFQGQNYGRFDDIDSITMFADYRVPQILWQLGCLSYSSDFKKRL--------------LKNELIAHNDPMEIEMRGCSIWAVEKILQNINR------KDVNAITIDFFLWDLAKEWQAKGYKPSTQVDEVTIPCIRVRSIYY 346          
BLAST of Queuosine salvage protein vs. UniProt/SwissProt
Match: sp|Q54II8|QSPP_DICDI (Queuosine salvage protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0288723 PE=3 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 4.447e-50
Identity = 116/359 (32.31%), Postives = 171/359 (47.63%), Query Frame = 1
Query:   67 NIRMLPKLSAQYITNKAEHVSINEDGVNKLCEDLLGMFSQGKYGLETWKTH---------ELNPKSFDDKAISWIFFIDTINFSFWPDENHAKFTVIYNGKTYTGYWSICAAVNRAIEMGINVFDANYMANMTIEQFNSIFYSENHESLPLVNERVNVIREAGSVLLNKFQGNFINCVCQAENSAQKLIQIIVDNFSSYRDVSFYKGKSVCIYKRAQILIADIWCCFGGNDFGKFYDIDSLTAFADYRVPQVLNFFNAIQYSKDLKEHLDNSNNIICLSFPNNRSDKPIEHDHPWEVEIRGVTLQCIEIMVDKINKMIDSNVAVVNSILVDNYLWDYRRTQEKSIDKV-PMHRTRTIYY 1113
            N   L + +  +++  ++HV IN + ++K CED L    + K   E W  +         E    +F +    +I  +DT+NF FWPD                 Y  +   +  A+      FDA+ +  +T E  +  F     + LP  +ERV +IRE G+VL+  F G+    +  A N A  L+ ++   F  +RD + YKGK V  YKRAQI + D+W  + G   GKF DI  LT FADYRVPQ+L     I+YS +LKE + N   I            P+  +   E+EIR VT+  +E M D  NK        + ++ +D  LW      E  +DK+ P HRT TI+Y
Sbjct:    2 NPLTLVRETTAWVSGLSKHVKINNEALDKECEDFLNK-HKIKAHKEIWADNWFHYCDIDIENKESTFTELTAKYILVLDTLNFCFWPDSEFE-------------YHHLARGLKNALIANPKCFDADQLIKVTSETIHQWF----GKDLPNTSERVRLIREVGTVLIEYFNGSIKEMILSANNKASVLVDLVTKYFWGFRDSAIYKGKQVFFYKRAQIFVGDLWGAYQGRGLGKFDDIKQLTMFADYRVPQILEELKVIEYSPELKEMIKNKVEI------------PVGSEM--ELEIRAVTVHVVEKMRDYFNK----GHCELLALEIDWMLWG---RGEAMLDKLPPHHRTLTIFY 321          
BLAST of Queuosine salvage protein vs. TrEMBL
Match: A0A2G8LIM2 (Queuosine salvage protein OS=Stichopus japonicus OX=307972 GN=BSL78_03013 PE=3 SV=1)

HSP 1 Score: 325.865 bits (834), Expect = 2.124e-106
Identity = 155/349 (44.41%), Postives = 225/349 (64.47%), Query Frame = 1
Query:   79 LPKLSAQYITNKAEHVSINEDGVNKLCEDLLGMFSQGKYGLETWKTHELNPKSFDDKAISWIFFIDTINFSFWPDENHAKFTVIYNGKTYTGYWSICAAVNRAIEMGINVFDANYMANMTIEQFNSIFYSENHESLPLVNERVNVIREAGSVLLNKFQGNFINCVCQAENSAQKLIQIIVDNFSSYRDVSFYKGKSVCIYKRAQILIADIWCCFGGNDFGKFYDIDSLTAFADYRVPQVLNFFNAIQYSKDLKEHLDNSNNIICLSFPNNRSDKPIEHDHPWEVEIRGVTLQCIEIMVDKINKMIDSN----VAVVNSILVDNYLWDYRRTQEKSIDKVPMHRTRTIYY 1113
            LP+ S+Q+I    + V+INE  V+ L E L   F + +Y ++ WK H+L+P+    + + WIF +DT+NFSFW + N  ++ V +NG+ ++GYW++CAA+ RA+E GI + D +Y A +T EQ   +F S  +  +PL+ +R   + EAG VLL KF G+F+NC+ + + SAQKL+ +IV NF SYRDV  YKGK V I KRAQILIADIW CF    FG+F+DIDSLT FADYRVPQVLN+F  ++YS  L + L              R D+ I +  P E+EIRG ++  +E+++  + K   +N    +A VNS++VD YLWDY +   + +  +P+HR R+ YY
Sbjct:   11 LPRESSQFIAENCDEVTINEAAVDVLAEKLFNSFKKQEYSIQEWKHHKLHPQKMVQETVDWIFIMDTLNFSFWSESNDKRYLVEFNGEKHSGYWALCAAIKRAVEEGIPITDPSYYAKITEEQLKQVFRSATNTPIPLLEQRRKNLHEAGKVLLEKFGGSFVNCILECDKSAQKLLDLIVTNFPSYRDVGTYKGKRVSILKRAQILIADIWACFEAKSFGEFHDIDSLTMFADYRVPQVLNYFGILEYSDVLMKAL--------------REDE-ISNGDPLELEIRGCSIWAVELILKAVRKKAQTNGGKALANVNSVVVDFYLWDYSKDHWQDMKHIPIHRLRSTYY 344          
BLAST of Queuosine salvage protein vs. TrEMBL
Match: A0A267G8R3 (Queuosine salvage protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025852g2 PE=3 SV=1)

HSP 1 Score: 319.701 bits (818), Expect = 4.436e-104
Identity = 147/350 (42.00%), Postives = 222/350 (63.43%), Query Frame = 1
Query:   76 MLPKLSAQYITNKAEHVSINEDGVNKLCEDLLGMFSQGKYGLETWKTHELNPKSFDDKAISWIFFIDTINFSFWPD-ENHAKFTVIYNGKTYTGYWSICAAVNRAIEMGINVFDANYMANMTIEQFNSIFYSENHESLPLVNERVNVIREAGSVLLNKFQGNFINCVCQAENSAQKLIQIIVDNFSSYRDVSFYKGKSVCIYKRAQILIADIWCCFGGNDFGKFYDIDSLTAFADYRVPQVLNFFNAIQYSKDLKEHLDNSNNIICLSFPNNRSDKPIEHDHPWEVEIRGVTLQCIEIMVDKINKMIDSNV---AVVNSILVDNYLWDYRRTQEKSIDKVPMHRTRTIYY 1113
            M P+ +A +I ++A+HV++ E G+  L + L  +F +G+Y L +W+ H LNPKS D +A+SW+F  DT+NFSFW D E  AKF V Y G+ +TGYWS+CAA+NR ++ G ++ D      +T+++   +   +  E +PL+ ER++ ++E G +L++++ G+F N +  A  SA++L++++V  F  YRDVS YKG  V +YKRAQIL+ADIW    G     F DID LTAFADYR+PQ L +F  +QY   L+E L+    +     PN          HP EVEIRG T+  +E++  ++ +   ++     ++NS+L+D+YLWDYRR     ID +P HRTR IYY
Sbjct:   13 MWPREAASWIVSQADHVTVLEAGIRSLADTLQPVFERGEYSLASWRRHPLNPKSADGRAVSWVFLADTLNFSFWSDAEADAKFCVTYAGERHTGYWSLCAAINRTLDEGFDLLDPKLWPGLTLDRLIHLLRGDRSE-MPLMQERLDCLQETGRILVDRYGGDFNNVLLAAAGSARRLLELVVTEFPCYRDVSVYKGCRVGLYKRAQILVADIWGALEGAGPADFNDIDCLTAFADYRIPQALEYFGVLQYGPSLREALNERRML-----PNG---------HPMEVEIRGATIHAVELLASEMRRRFSTSGNGHRLINSVLLDHYLWDYRRQFADKIDHLPFHRTRCIYY 347          
BLAST of Queuosine salvage protein vs. TrEMBL
Match: V3ZRN5 (Queuosine salvage protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_195975 PE=3 SV=1)

HSP 1 Score: 319.316 bits (817), Expect = 5.273e-104
Identity = 153/348 (43.97%), Postives = 221/348 (63.51%), Query Frame = 1
Query:   82 PKLSAQYITNKAEHVSINEDGVNKLCEDLLGMFSQGKYGLETWKTHELNPKSFDDKAISWIFFIDTINFSFWPDENHAKFTVIYNGKTYTGYWSICAAVNRAIEMGINVFDANYMANMTIEQFNSIFYSENHESLPLVNERVNVIREAGSVLLNKFQGNFINCVCQAENSAQKLIQIIVDNFSSYRDVSFYKGKSVCIYKRAQILIADIWCCFGGNDFGKFYDIDSLTAFADYRVPQVLNFFNAIQYSKDLKEHLDNSNNIICLSFPNNRSDKPIEHDHPWEVEIRGVTLQCIEIMVDKINKMIDSNVAV----VNSILVDNYLWDYRRTQEKSIDKVPMHRTRTIYY 1113
            P+ S +YI   +E VSI  +GV K+ + +     +  Y ++ WK HELNPK+ D  A+ W+F  DT+NFSF+ D+   K+ V YNGK +TGYWS+CAA+NRAI+ G+ V D N+ A +T E+   I  S+    +PL+ ERV V+ EAG VL+ K+ G+FINC+ +AE SAQ L+ +IV+ F +YRD   Y GK V  YKRAQILI+D+W C  G  FG+F DIDS+T FADYR+PQ L +  A++YS +L E L  +     L+  + R           E EIRG ++   E++V++  K++ ++       +N+ILVD+YLWDYRR +   +  +P H+TR I+Y
Sbjct:    7 PRESGRYIAETSEDVSIATEGVKKVAQLVFEHVKKDSYSVKAWKEHELNPKTGDKAAVDWVFLADTLNFSFYSDDESKKYKVKYNGKEHTGYWSLCAAINRAIDEGVEVTDPNFYATITKEKLAHILRSDTEFDIPLLEERVEVLHEAGKVLIKKYDGSFINCIKKAEKSAQNLLALIVEEFPAYRDEGEYTGKQVSFYKRAQILISDVWGCCEGEGFGEFTDIDSMTMFADYRIPQCLVYMGAMKYSDNLMETLKKNEK---LANGDRR-----------ETEIRGCSIWATELIVEETRKLLTADSETKGVEMNAILVDHYLWDYRREKADEMRVIPYHKTRCIFY 340          
BLAST of Queuosine salvage protein vs. TrEMBL
Match: A0A1I8GJ18 (Queuosine salvage protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 319.316 bits (817), Expect = 7.003e-104
Identity = 147/350 (42.00%), Postives = 222/350 (63.43%), Query Frame = 1
Query:   76 MLPKLSAQYITNKAEHVSINEDGVNKLCEDLLGMFSQGKYGLETWKTHELNPKSFDDKAISWIFFIDTINFSFWPD-ENHAKFTVIYNGKTYTGYWSICAAVNRAIEMGINVFDANYMANMTIEQFNSIFYSENHESLPLVNERVNVIREAGSVLLNKFQGNFINCVCQAENSAQKLIQIIVDNFSSYRDVSFYKGKSVCIYKRAQILIADIWCCFGGNDFGKFYDIDSLTAFADYRVPQVLNFFNAIQYSKDLKEHLDNSNNIICLSFPNNRSDKPIEHDHPWEVEIRGVTLQCIEIMVDKINKMIDSNV---AVVNSILVDNYLWDYRRTQEKSIDKVPMHRTRTIYY 1113
            M P+ +A +I ++A+HV++ E G+  L + L  +F +G+Y L +W+ H LNPKS D +A+SW+F  DT+NFSFW D E  AKF V Y G+ +TGYWS+CAA+NR ++ G ++ D      +T+++   +   +  E +PL+ ER++ ++E G +L++++ G+F N +  A  SA++L++++V  F  YRDVS YKG  V +YKRAQIL+ADIW    G     F DID LTAFADYR+PQ L +F  +QY   L+E L+    +     PN          HP EVEIRG T+  +E++  ++ +   ++     ++NS+L+D+YLWDYRR     ID +P HRTR IYY
Sbjct:   11 MWPREAASWIVSQADHVTVLEAGIRSLADTLQPVFERGEYSLASWRRHPLNPKSADGRAVSWVFLADTLNFSFWSDAEADAKFCVTYAGERHTGYWSLCAAINRTLDEGFDLLDPKLWPGLTLDRLIHLLRGDRSE-MPLMQERLDCLQETGRILVDRYGGDFNNVLLAAAGSARRLLELVVTEFPCYRDVSVYKGCRVGLYKRAQILVADIWGALEGAGPADFNDIDCLTAFADYRIPQALEYFGVLQYGPSLREALNERRML-----PNG---------HPMEVEIRGATIHAVELLASEMRRRFSTSGNGHRLINSVLLDHYLWDYRRQFADKIDHLPFHRTRCIYY 345          
BLAST of Queuosine salvage protein vs. TrEMBL
Match: A0A293ME45 (Queuosine salvage protein (Fragment) OS=Ornithodoros erraticus OX=265619 PE=3 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 1.801e-103
Identity = 145/346 (41.91%), Postives = 222/346 (64.16%), Query Frame = 1
Query:   82 PKLSAQYITNKAEHVSINEDGVNKLCEDLLGMFSQGKYGLETWKTHELNPKSFDDKAISWIFFIDTINFSFWPDENHAKFTVIYNGKTYTGYWSICAAVNRAIEMGINVFDANYMANMTIEQFNSIFYSENHESLPLVNERVNVIREAGSVLLNKFQGNFINCVCQAENSAQKLIQIIVDNFSSYRDVSFYKGKSVCIYKRAQILIADIWCCFGGNDFGKFYDIDSLTAFADYRVPQVLNFFNAIQYSKDLKEHLDNSNNIICLSFPNNRSDKPIEHDHPWEVEIRGVTLQCIEIMVDKINKMI--DSNVAVVNSILVDNYLWDYRRTQEKSIDKVPMHRTRTIYY 1113
            P+ SA+ IT  A+ VSI+++G++K+ + +   F  G + + +WK H L+PK  D +A  WIF +D++NFSFW +++H  + V + G+ Y+GYWS+CAA+NRA++ GI + +  +  N+T ++   IF SE+  ++PL+ ER  +I+E G VL  KF G+F NC+ Q+  S QKL+ +++++F S+RD   + G  V  YKRAQIL+AD+W CF G   G F+DI +LTAFADYRVPQVL  F A+QYS+ L+E L                D  +++    E+EIRG TL   E++ +++++    D  +  +NSILVD +LWDYRR     +D +P H+ R IYY
Sbjct:    6 PRESAKLITESAKDVSISQEGISKVADLVHNGFRAGTFSIHSWKQHLLHPKVADSRAAEWIFLVDSLNFSFWSEQDHQWYEVAFLGQKYSGYWSLCAAINRALQEGIPLLNPEFCRNITRDEVEKIFRSESGTAIPLLEERHGIIKECGKVLCEKFGGSFTNCISQSSQSCQKLLSLVIEHFPSFRDEGIFDGTRVSFYKRAQILVADLWSCFEGECLGSFHDIATLTAFADYRVPQVLASFGALQYSQHLQELLAK--------------DLVMQNGQREEMEIRGATLHACELVREELSRRAEDDGALGSINSILVDYFLWDYRRQHATELDHIPFHKVRCIYY 337          
BLAST of Queuosine salvage protein vs. Ensembl Cavefish
Match: zgc:136564 (chromosome 6 C9orf64 homolog [Source:NCBI gene;Acc:103036926])

HSP 1 Score: 258.07 bits (658), Expect = 2.056e-83
Identity = 132/348 (37.93%), Postives = 196/348 (56.32%), Query Frame = 1
Query:   82 PKLSAQYITNKAEHVSINEDGVNKLCEDLLGMFSQGKYGLETWK-THELNPKSFDDKAISWIFFIDTINFSFWPDENHAKFTVIYNGKTYTGYWSICAAVNRAIEMGINVFDANYMANMTIEQFNSIFYSENHESLPLVNERVNVIREAGSVLLNKFQGNFINCVCQAENSAQKLIQIIVDNFSSYRDVSFYKGKSVCIYKRAQILIADIWCCFGGNDFGKFYDIDSLTAFADYRVPQVLNFFNAIQYSKDLKEHLDNSNNIICLSFPNNRSDKPIEHDHPWEVEIRGVTLQCIEIMVDKINKMI---DSNVAVVNSILVDNYLWDYRRTQEKSIDKVPMHRTRTIYY 1113
            P+ S Q++  ++  V ++EDGV KL E L G+  +  +    WK  ++L P    D AI+W+F  DT+NFSFWPD    +  VIY G TY GY S+CAA+ RA++ G+ + D  Y + ++ E+   +  S++   +P++ ER   + EAG VL+ +  G+F N +   +N A+K++Q IVDN  SYRD + Y+GK +  YKRAQIL+AD W        G   ++D LT FADYRVPQ L +  A++YS  L E L        LS    R           EVEIRG ++ C+E +   +  ++   +     +NS L+D YLW Y +   K +  +P+H TR IYY
Sbjct:    7 PRESGQFVAERSRDVFVDEDGVKKLAEMLYGLKDEEVFTASGWKKMNQLAPPPDTDAAINWVFVTDTMNFSFWPDREEEQCEVIYKGNTYRGYMSLCAAITRALDEGVPITDPAYFSQISEEELGRVLRSDSATPMPMLKERHQALTEAGRVLM-QHGGSFRNFISHGKNDAEKMMQYIVDNIPSYRDEATYEGKKISFYKRAQILVADFWGIMEARQEGNIPNLDFLTMFADYRVPQALVYLGALRYSDALMEALKKGE---LLSSGERR-----------EVEIRGCSIWCVERIKSCLWDLVQEKEGKTCNINSALIDFYLWPYAKQHHKEMAHIPIHHTRCIYY 339          
BLAST of Queuosine salvage protein vs. Ensembl Sea Lamprey
Match: zgc:136564 (chromosome 9 open reading frame 64 [Source:HGNC Symbol;Acc:HGNC:28144])

HSP 1 Score: 272.322 bits (695), Expect = 1.205e-89
Identity = 127/351 (36.18%), Postives = 216/351 (61.54%), Query Frame = 1
Query:   76 MLPKLSAQYITNKAEHVSINEDGVNKLCEDLLGMFSQGKYGLETWKT-HELNPKSFDDKAISWIFFIDTINFSFWPDENHAKFTVIYNGKTYTGYWSICAAVNRAIEMGINVFDANYMANMTIEQFNSIFYSENHESLPLVNERVNVIREAGSVLLNKFQGNFINCVCQAENSAQKLIQIIVDNFSSYRDVSFYKGKSVCIYKRAQILIADIWCCFGGNDFGKFYDIDSLTAFADYRVPQVLNFFNAIQYSKDLKEHLDNSNNIICLSFPNNRSDKPIEHDHPWEVEIRGVTLQCIEIMVDKINKMI-DSNVAV---VNSILVDNYLWDYRRTQEKSIDKVPMHRTRTIYY 1113
            + P+ + ++I   ++ VSI ++GV  +   L   + +  +G+E WK+ H+L+P+  ++ A++W+F +DT+NFSFW + +  K  V Y  + Y+GYW++CAA+NRA++ G ++  A+Y +N+T E+ + +  S++   +P++ ER  V+ E G +L+  F G+F+ C+ +  +SAQ L++++V+NF  YRD + +K K V +YKRAQIL+ADIW    G   G F DI +LT FADYRVPQ L +  A++YS  L + L +                  E     EVEIRG ++ C+E++ +++ +++ +  VA    +N++L+D YLWDY R     +  +P+H  R IYY
Sbjct:    5 LCPRDAGRFIAKNSKDVSIADEGVRSVASVLCEKYQEKTFGVECWKSMHKLHPQMTNEDAVNWVFVVDTLNFSFWAESDDTKCLVKYKEEMYSGYWTLCAAMNRALDEGFHMTSASYYSNITFEELSHVLRSDSGSPMPMLAERHRVLTETGRILVQSFGGSFLECLRRCGHSAQALLRLVVENFPCYRDEATFKSKRVALYKRAQILVADIWGLLEGKGDGFFNDIGTLTMFADYRVPQALVYLGALKYSSRLMQKLKDGVM--------------FESGEEQEVEIRGCSIWCVELIQEELARLLAERGVAKAQDINAVLLDYYLWDYARAHRDEMAHIPIHHIRCIYY 341          
BLAST of Queuosine salvage protein vs. Ensembl Nematostella
Match: EDO34709 (UPF0553 protein v1g230591 [Source:UniProtKB/Swiss-Prot;Acc:A7SNN9])

HSP 1 Score: 261.922 bits (668), Expect = 3.393e-85
Identity = 134/362 (37.02%), Postives = 207/362 (57.18%), Query Frame = 1
Query:   61 LNNIRMLPKLSAQYITNKAEHVSINEDGVNKLCEDLLGMFSQGKYGLETWKTHELNPKSFDDKAISWIFFIDTINFSFWPDENHAKFTVIYNGKTYTGYWSICAAVNRAIEMGINVFDANYMANMTIEQFNSIFYSENHESLPLVNERVNVIREAGSVLLNKFQGNFINCVCQAENSAQKLIQIIVDNFSSYRDVSFYKGKSVCIYKRAQILIADIWCCFGGNDFGKFYDIDSLTAFADYRVPQVLNFFNAIQYSKDLKEHLDNSNNIICLSFPNNRSDKPIEHDHPWEVEIRGVTLQCIEIMV----------DKINKMIDSNVA-VVNSILVDNYLWDYRRTQEKSIDKVPMHRTRTIYY 1113
            ++N  MLP+ S  +I + ++ VS+ E+G+++  E +        Y  +TWK HEL+PK      + WIF +DT+NFSFW D+    +T+ + GK + GYW++CA +NRAIE GI++   +Y  N+TI+    IF SE    +PL+ ER   +RE G++L   FQ +F + +  A  SA+ L+ ++++NF  +RD   +  + V  YKRAQILIAD W CF G  FG+F DID LT FADY+VPQ L     +Q+S+ LK+ L               + + I H    E+EIRG ++  +E +            + + M    +A  +NS+++D YLWD+ +  E     +P H+TRTI+Y
Sbjct:    1 MSNQVMLPRESGSFIASHSKDVSLCEEGISRASEIVFKSLKSNAYSYKTWKDHELHPKEMSKATVDWIFVLDTLNFSFWVDDGLEPWTIRHKGKDFQGYWALCAGINRAIEEGIHLTSPSYYRNITIDDLKHIFRSETSTEMPLLEERAKNLRETGNILAQTFQNSFAHMILLANKSAKLLLSMVINNFDCFRDDGDFCNQKVSFYKRAQILIADTWACFEGKGFGEFPDIDFLTMFADYKVPQGLYDLGVLQFSEALKQKL--------------VTGQLIPHGDQLEMEIRGNSIWAVEKIYLAVKLKAKKSPEFSNMDSLELAQYLNSVIIDFYLWDFSKNVEARAS-IPCHKTRTIFY 347          
BLAST of Queuosine salvage protein vs. Ensembl Medaka
Match: zgc:136564 (chromosome 9 C9orf64 homolog [Source:NCBI gene;Acc:101169613])

HSP 1 Score: 246.899 bits (629), Expect = 4.838e-79
Identity = 121/350 (34.57%), Postives = 199/350 (56.86%), Query Frame = 1
Query:   76 MLPKLSAQYITNKAEHVSINEDGVNKLCEDLLGMFSQGKYGLETWK-THELNPKSFDDKAISWIFFIDTINFSFWPDENHAKFTVIYNGKTYTGYWSICAAVNRAIEMGINVFDANYMANMTIEQFNSIFYSENHESLPLVNERVNVIREAGSVLLNKFQGNFINCVCQAENSAQKLIQIIVDNFSSYRDVSFYKGKSVCIYKRAQILIADIWCCFGGNDFGKFYDIDSLTAFADYRVPQVLNFFNAIQYSKDLKEHLDNSNNIICLSFPNNRSDKPIEHDHPWEVEIRGVTLQCIEIMVDKINKMI---DSNVAVVNSILVDNYLWDYRRTQEKSIDKVPMHRTRTIYY 1113
            +LP+ S Q++  ++  V +   GV K+ E L  + +        WK  + L P    D+  +W+F +DT+NFSFWP++   +  V Y   TYTGY ++CA++ RA+E GI + D  Y + M++++   +  S+N   +P++ ER   + E G VLL +  G+F + + QA N AQK++++IV+   SYRD + Y+GK +  YKRAQIL+AD W            +++ LT FADYRVPQ L +   ++YS  L + L N   ++C     +R           EVEIRG ++ C+E++ D++++++   D     +NS ++D YLW + +   K +  +P+H TR IYY
Sbjct:    5 LLPRESGQFVAGRSRDVFVEGSGVQKVAEMLYHLRNSDDLSANGWKKANPLAPAPTSDQVANWVFVVDTMNFSFWPEKETQQCEVTYKSVTYTGYMTLCASITRAMEEGIPITDPMYFSQMSLKELAHVLRSDNETDMPMLQERHEALTEGGCVLL-EHGGSFQSFINQAGNDAQKMVELIVEKIPSYRDEATYEGKRIAFYKRAQILVADYWAVMEAKGQTGIINMNWLTMFADYRVPQALVYLGVLRYSDSLMQTLKN-GELLC---SGDRR----------EVEIRGCSIWCVELIKDRLSQLVQERDGQTCSINSAIIDFYLWPFAKQHHKEMAHIPIHHTRCIYY 339          
BLAST of Queuosine salvage protein vs. Planmine SMEST
Match: SMESG000078335.1 (SMESG000078335.1)

HSP 1 Score: 611.683 bits (1576), Expect = 0.000e+0
Identity = 298/313 (95.21%), Postives = 299/313 (95.53%), Query Frame = 1
Query:  175 MFSQGKYGLETWKTHELNPKSFDDKAISWIFFIDTINFSFWPDENHAKFTVIYNGKTYTGYWSICAAVNRAIEMGINVFDANYMANMTIEQFNSIFYSENHESLPLVNERVNVIREAGSVLLNKFQGNFINCVCQAENSAQKLIQIIVDNFSSYRDVSFYKGKSVCIYKRAQILIADIWCCFGGNDFGKFYDIDSLTAFADYRVPQVLNFFNAIQYSKDLKEHLDNSNNIICLSFPNNRSDKPIEHDHPWEVEIRGVTLQCIEIMVDKINKMIDSNVAVVNSILVDNYLWDYRRTQEKSIDKVPMHRTRTIYY 1113
            MFSQGKYGLETWKTHELNPKSFDDKAISWIFFIDTINFSFWPDENHAKFTVIYNGKTYTGYWSICAAVNRAIEMGINVFDANYMANMTIEQFNSIFYSENHESLPLVNERVNVIREAGSVLLNKFQGNFINCVCQAENSAQKLIQIIVDNFSSYRDVSFYKGKSVCIYKRAQILIADIWCCFGGNDFGKFYDIDSLTAFADYRVPQVLNFFNAIQYSKDLKEHLDN              +KPIEHDHPWEVEIRGVTLQCIEIMVDKINKMIDSNVAVVNSILVDNYLWDYRRTQEKSIDKVPMHRTRTIYY
Sbjct:    1 MFSQGKYGLETWKTHELNPKSFDDKAISWIFFIDTINFSFWPDENHAKFTVIYNGKTYTGYWSICAAVNRAIEMGINVFDANYMANMTIEQFNSIFYSENHESLPLVNERVNVIREAGSVLLNKFQGNFINCVCQAENSAQKLIQIIVDNFSSYRDVSFYKGKSVCIYKRAQILIADIWCCFGGNDFGKFYDIDSLTAFADYRVPQVLNFFNAIQYSKDLKEHLDN--------------NKPIEHDHPWEVEIRGVTLQCIEIMVDKINKMIDSNVAVVNSILVDNYLWDYRRTQEKSIDKVPMHRTRTIYY 299          
BLAST of Queuosine salvage protein vs. Planmine SMEST
Match: SMESG000078335.1 (SMESG000078335.1)

HSP 1 Score: 508.449 bits (1308), Expect = 0.000e+0
Identity = 248/263 (94.30%), Postives = 249/263 (94.68%), Query Frame = 1
Query:  175 MFSQGKYGLETWKTHELNPKSFDDKAISWIFFIDTINFSFWPDENHAKFTVIYNGKTYTGYWSICAAVNRAIEMGINVFDANYMANMTIEQFNSIFYSENHESLPLVNERVNVIREAGSVLLNKFQGNFINCVCQAENSAQKLIQIIVDNFSSYRDVSFYKGKSVCIYKRAQILIADIWCCFGGNDFGKFYDIDSLTAFADYRVPQVLNFFNAIQYSKDLKEHLDNSNNIICLSFPNNRSDKPIEHDHPWEVEIRGVTLQCIE 963
            MFSQGKYGLETWKTHELNPKSFDDKAISWIFFIDTINFSFWPDENHAKFTVIYNGKTYTGYWSICAAVNRAIEMGINVFDANYMANMTIEQFNSIFYSENHESLPLVNERVNVIREAGSVLLNKFQGNFINCVCQAENSAQKLIQIIVDNFSSYRDVSFYKGKSVCIYKRAQILIADIWCCFGGNDFGKFYDIDSLTAFADYRVPQVLNFFNAIQYSKDLKEHLDN              +KPIEHDHPWEVEIRGVTLQCIE
Sbjct:    1 MFSQGKYGLETWKTHELNPKSFDDKAISWIFFIDTINFSFWPDENHAKFTVIYNGKTYTGYWSICAAVNRAIEMGINVFDANYMANMTIEQFNSIFYSENHESLPLVNERVNVIREAGSVLLNKFQGNFINCVCQAENSAQKLIQIIVDNFSSYRDVSFYKGKSVCIYKRAQILIADIWCCFGGNDFGKFYDIDSLTAFADYRVPQVLNFFNAIQYSKDLKEHLDN--------------NKPIEHDHPWEVEIRGVTLQCIE 249          
The following BLAST results are available for this feature:
BLAST of Queuosine salvage protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
C9orf648.366e-10343.55chromosome 9 open reading frame 64 [Source:HGNC Sy... [more]
C9orf642.672e-5744.39chromosome 9 open reading frame 64 [Source:HGNC Sy... [more]
C9orf641.256e-1651.72chromosome 9 open reading frame 64 [Source:HGNC Sy... [more]
back to top
BLAST of Queuosine salvage protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
C11D2.42.207e-9341.88Queuosine salvage protein [Source:UniProtKB/TrEMB... [more]
back to top
BLAST of Queuosine salvage protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG97522.758e-8536.29gene:FBgn0034614 transcript:FBtr0071616[more]
back to top
BLAST of Queuosine salvage protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
C8H9orf649.373e-7735.34zgc:136564 [Source:ZFIN;Acc:ZDB-GENE-070410-3][more]
C8H9orf642.846e-3932.12zgc:136564 [Source:ZFIN;Acc:ZDB-GENE-070410-3][more]
back to top
BLAST of Queuosine salvage protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
vkorc1l17.672e-9739.32vitamin K epoxide reductase complex subunit 1 like... [more]
vkorc1l12.890e-5838.43vitamin K epoxide reductase complex subunit 1 like... [more]
back to top
BLAST of Queuosine salvage protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
2210016F16Rik6.701e-9741.38RIKEN cDNA 2210016F16 gene [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Queuosine salvage protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5T6V5|QSPP_HUMAN4.018e-10243.55Queuosine salvage protein OS=Homo sapiens OX=9606 ... [more]
sp|Q1JP73|QSPP_BOVIN2.906e-10042.17Queuosine salvage protein OS=Bos taurus OX=9913 PE... [more]
sp|A7SNN9|QSPP_NEMVE8.278e-8437.02Queuosine salvage protein OS=Nematostella vectensi... [more]
sp|Q9HDZ9|QSPP_SCHPO8.072e-7433.98Queuosine salvage protein OS=Schizosaccharomyces p... [more]
sp|Q54II8|QSPP_DICDI4.447e-5032.31Queuosine salvage protein OS=Dictyostelium discoid... [more]
back to top
BLAST of Queuosine salvage protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2G8LIM22.124e-10644.41Queuosine salvage protein OS=Stichopus japonicus O... [more]
A0A267G8R34.436e-10442.00Queuosine salvage protein (Fragment) OS=Macrostomu... [more]
V3ZRN55.273e-10443.97Queuosine salvage protein OS=Lottia gigantea OX=22... [more]
A0A1I8GJ187.003e-10442.00Queuosine salvage protein OS=Macrostomum lignano O... [more]
A0A293ME451.801e-10341.91Queuosine salvage protein (Fragment) OS=Ornithodor... [more]
back to top
BLAST of Queuosine salvage protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
zgc:1365642.056e-8337.93chromosome 6 C9orf64 homolog [Source:NCBI gene;Acc... [more]
back to top
BLAST of Queuosine salvage protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
zgc:1365641.205e-8936.18chromosome 9 open reading frame 64 [Source:HGNC Sy... [more]
back to top
BLAST of Queuosine salvage protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Queuosine salvage protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO347093.393e-8537.02UPF0553 protein v1g230591 [Source:UniProtKB/Swiss... [more]
back to top
BLAST of Queuosine salvage protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
zgc:1365644.838e-7934.57chromosome 9 C9orf64 homolog [Source:NCBI gene;Acc... [more]
back to top
BLAST of Queuosine salvage protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000078335.10.000e+095.21SMESG000078335.1[more]
SMESG000078335.10.000e+094.30SMESG000078335.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011372 ID=SMED30011372|Name=Queuosine salvage protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1118bp
CTTTTACAAAAAATTCATCCATTTTATAGATATCAATTTTTGTTTGATGA
ATAGAAATTTTTAAATAATATTCGAATGCTACCTAAATTATCAGCTCAGT
ACATAACGAATAAAGCAGAACATGTGTCCATAAACGAAGATGGTGTTAAT
AAGTTATGTGAAGATTTATTAGGAATGTTTTCACAGGGGAAATATGGTTT
GGAAACATGGAAAACACATGAATTAAATCCAAAATCATTTGATGACAAAG
CGATATCGTGGATATTCTTTATTGATACTATTAACTTTTCATTCTGGCCT
GACGAAAATCATGCAAAATTCACTGTGATTTATAACGGAAAAACATACAC
TGGCTATTGGTCTATATGTGCCGCAGTTAATCGAGCTATTGAGATGGGAA
TTAATGTCTTCGATGCGAATTATATGGCAAACATGACAATTGAACAGTTC
AATTCTATATTTTATTCAGAAAACCACGAGTCTCTTCCATTGGTTAATGA
AAGAGTAAATGTAATCCGAGAAGCCGGTTCTGTATTATTAAATAAATTTC
AAGGCAATTTTATTAATTGCGTTTGTCAAGCTGAAAATTCAGCACAAAAA
CTTATACAAATAATTGTTGATAATTTCTCATCGTATAGAGATGTATCTTT
TTATAAAGGGAAATCAGTCTGCATTTATAAACGTGCTCAAATTCTAATTG
CCGATATTTGGTGTTGTTTTGGTGGAAATGATTTTGGAAAATTTTACGAC
ATTGATAGCCTGACTGCATTTGCAGATTATCGGGTTCCTCAAGTTTTAAA
TTTTTTCAACGCCATTCAATATTCCAAAGATTTAAAAGAGCATTTAGATA
ATAGTAATAATATTATTTGTCTTAGTTTTCCAAATAATCGTTCAGATAAG
CCAATTGAGCATGATCACCCCTGGGAAGTTGAAATTAGGGGTGTTACTTT
GCAATGTATCGAAATTATGGTTGATAAAATCAACAAGATGATCGATTCAA
ATGTTGCTGTTGTGAATTCTATTTTAGTTGATAACTATTTATGGGATTAT
CGTAGAACTCAAGAGAAATCTATTGATAAAGTTCCAATGCATCGCACACG
AACAATTTATTATTAAAC
back to top

protein sequence of SMED30011372-orf-1

>SMED30011372-orf-1 ID=SMED30011372-orf-1|Name=SMED30011372-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=347bp
MLPKLSAQYITNKAEHVSINEDGVNKLCEDLLGMFSQGKYGLETWKTHEL
NPKSFDDKAISWIFFIDTINFSFWPDENHAKFTVIYNGKTYTGYWSICAA
VNRAIEMGINVFDANYMANMTIEQFNSIFYSENHESLPLVNERVNVIREA
GSVLLNKFQGNFINCVCQAENSAQKLIQIIVDNFSSYRDVSFYKGKSVCI
YKRAQILIADIWCCFGGNDFGKFYDIDSLTAFADYRVPQVLNFFNAIQYS
KDLKEHLDNSNNIICLSFPNNRSDKPIEHDHPWEVEIRGVTLQCIEIMVD
KINKMIDSNVAVVNSILVDNYLWDYRRTQEKSIDKVPMHRTRTIYY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0101030tRNA-guanine transglycosylation
GO:0006400tRNA modification
GO:0008150biological_process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002075pigment cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR019438Q_salvage
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component