Phospholipase A2

Overview
NamePhospholipase A2
Smed IDSMED30011343
Length (bp)608
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phospholipase A2 (SMED30011343) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phospholipase A2 (SMED30011343) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011343

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30011343SMESG000075160.1 dd_Smed_v4_13334_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30011343SMESG000075160.1 dd_Smed_v4_13334_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phospholipase A2 vs. Ensembl Human
Match: PLA2G2E (phospholipase A2 group IIE [Source:HGNC Symbol;Acc:HGNC:13414])

HSP 1 Score: 78.9518 bits (193), Expect = 2.874e-18
Identity = 45/126 (35.71%), Postives = 67/126 (53.17%), Query Frame = 1
Query:  103 LILVTIFLKASDGELAQFNLMVKYITGRNPGIFIGYGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKKYNANPLLTVYKWSLAGKEIWCKNNPVKLQTLCKCDKDIAYCLRDNLAHFNK--GHY 474
            L+ + + +    G L QF +M++ +TG++   +  YG YCG G  S  PVD+ D CC  HD CY   L+K    P L  Y +S++ + I+C       +  C+CDK  A C R NL  +N+   HY
Sbjct:    7 LVFLCLLVALVTGNLVQFGVMIEKMTGKSALQYNDYGCYCGIGG-SHWPVDQTDWCCHAHDCCYGR-LEKLGCEPKLEKYLFSVSERGIFCAGRTTCQRLTCECDKRAALCFRRNLGTYNRKYAHY 130          
BLAST of Phospholipase A2 vs. Ensembl Human
Match: PLA2G2A (phospholipase A2 group IIA [Source:HGNC Symbol;Acc:HGNC:9031])

HSP 1 Score: 72.7886 bits (177), Expect = 7.163e-16
Identity = 45/123 (36.59%), Postives = 60/123 (48.78%), Query Frame = 1
Query:  103 LILVTIF-LKASDGELAQFNLMVKYITGRNPGIFIG-YGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKKYNANPLLTVYKWSLAGKEIWCKNNPVKLQTLCKCDKDIAYCLRDNLAHFNK 465
            L ++ IF L  + G L  F+ M+K  TG+   +  G YG +CG G   G+P D  D CC  HD CY    K+      L+ YK+S +G  I C         LC+CDK  A C   N   +NK
Sbjct:    7 LAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGG-RGSPKDATDRCCVTHDCCYKRLEKRGCGTKFLS-YKFSNSGSRITCAKQDSCRSQLCECDKAAATCFARNKTTYNK 127          
BLAST of Phospholipase A2 vs. Ensembl Human
Match: PLA2G2A (phospholipase A2 group IIA [Source:HGNC Symbol;Acc:HGNC:9031])

HSP 1 Score: 72.7886 bits (177), Expect = 7.163e-16
Identity = 45/123 (36.59%), Postives = 60/123 (48.78%), Query Frame = 1
Query:  103 LILVTIF-LKASDGELAQFNLMVKYITGRNPGIFIG-YGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKKYNANPLLTVYKWSLAGKEIWCKNNPVKLQTLCKCDKDIAYCLRDNLAHFNK 465
            L ++ IF L  + G L  F+ M+K  TG+   +  G YG +CG G   G+P D  D CC  HD CY    K+      L+ YK+S +G  I C         LC+CDK  A C   N   +NK
Sbjct:    7 LAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGG-RGSPKDATDRCCVTHDCCYKRLEKRGCGTKFLS-YKFSNSGSRITCAKQDSCRSQLCECDKAAATCFARNKTTYNK 127          
BLAST of Phospholipase A2 vs. Ensembl Human
Match: PLA2G5 (phospholipase A2 group V [Source:HGNC Symbol;Acc:HGNC:9038])

HSP 1 Score: 66.6254 bits (161), Expect = 1.301e-13
Identity = 41/114 (35.96%), Postives = 55/114 (48.25%), Query Frame = 1
Query:  124 LKASDGELAQFNLMVKYITGRNPGIFIG-YGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKKYNANPLLTVYKWSLAGKEIWCKNNPVKLQTLCKCDKDIAYCLRDNLAHFN 462
            + A  G L     M++ +TG+N     G YG YCG G   G P D  D CC  HD CY   L++   N     YK+  A   + C+  P     LC CD+ + YCL+ NL  +N
Sbjct:   15 VPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGWGG-RGTPKDGTDWCCWAHDHCYGR-LEEKGCNIRTQSYKYRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYN 126          
BLAST of Phospholipase A2 vs. Ensembl Human
Match: PLA2G2D (phospholipase A2 group IID [Source:HGNC Symbol;Acc:HGNC:9033])

HSP 1 Score: 66.6254 bits (161), Expect = 1.395e-13
Identity = 43/128 (33.59%), Postives = 66/128 (51.56%), Query Frame = 1
Query:   88 ILYGSLILVTIFLKASDGELAQFNLMVKYITGRNPGI-FIGYGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKKYNANPLLTVYKWSLAGKEIWCKNNPVKL-QTLCKCDKDIAYCLRDNLAHFNK 465
            +L G +++  +      G +   N MVK +TG+ P + +  YG +CG G   G P D  D CC+ HD CYD  LK    +     Y+++ +   I C +      Q LC CDK++A+CL+ NL  + K
Sbjct:    5 LLCGLVVMAGVI--PIQGGILNLNKMVKQVTGKMPILSYWPYGCHCGLGG-RGQPKDATDWCCQTHDCCYD-HLKTQGCSIYKDYYRYNFSQGNIHCSDKGSWCEQQLCACDKEVAFCLKRNLDTYQK 128          
BLAST of Phospholipase A2 vs. Ensembl Celegans
Match: Y69A2AL.2 (Phospholipase A(2) [Source:UniProtKB/TrEMBL;Acc:Q3V5J7])

HSP 1 Score: 51.2174 bits (121), Expect = 2.893e-8
Identity = 34/110 (30.91%), Postives = 52/110 (47.27%), Query Frame = 1
Query:  121 FLKASDGELAQFNLMVKYITGRNPGIFIGYGNYCGEGSLSGNPVDKIDECCKRHDECYDVFL---KKYNAN-PLLTVYKWSLAGKEIWCKNNPVKLQTLCKCDKDIAYCL 438
             + +S   L Q + M     G+    +  YG  C  G     P+D ID CC+ H++CY+  L   K  N+N P   +YKW    ++  C N     Q++C+CD+    CL
Sbjct:   12 IVSSSCNILYQLDDMSYCRIGQPFDAYRYYGCSCS-GISPNKPIDGIDRCCQVHNDCYNELLLTKKCQNSNSPYFCLYKWECVYQQPACNNESKCTQSVCQCDEQFINCL 120          
BLAST of Phospholipase A2 vs. Ensembl Celegans
Match: C07E3.9 (Phospholipase A(2) [Source:UniProtKB/TrEMBL;Acc:Q17790])

HSP 1 Score: 46.2098 bits (108), Expect = 2.165e-6
Identity = 29/83 (34.94%), Postives = 39/83 (46.99%), Query Frame = 1
Query:  208 YGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKKYNANPL----LTVYKWSLAGKEIWCKNNPVKLQ-TLCKCDKDIAYCLR 441
            YG +CG G  S  PVD IDECC  HD+CYD  +       +    +  Y WS       C +  +  +  LC CDK +  C +
Sbjct:   47 YGCWCGIGG-SHEPVDGIDECCMHHDKCYDAAVDNKVCMDVEIEYVDDYSWSCMNSTAICSDKNMGCKAALCDCDKIVVECWK 128          
BLAST of Phospholipase A2 vs. Ensembl Zebrafish
Match: pla2g1b (phospholipase A2, group IB (pancreas) [Source:ZFIN;Acc:ZDB-GENE-070117-1])

HSP 1 Score: 57.3806 bits (137), Expect = 2.860e-10
Identity = 43/141 (30.50%), Postives = 67/141 (47.52%), Query Frame = 1
Query:  100 SLILVTIFLKASDGELAQFNLMVK-YITGRNPGI-FIGYGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKKYNA-----NPLLTVYKWSL--AGKEIWC---KNNPVKLQTLCKCDKDIAYCLRDNLAHFNKGHYKRQN 486
            S+ L T+        L QF  M+   I    P + +  YG YCG+G  SG PVD++D CC+ HD+CY    +  +      NP   +Y ++     K + C   KN P ++  +C+CD+  A+C      +    HY  +N
Sbjct:   11 SISLPTLLATLDYRALWQFRAMILCTIPDSWPALDYADYGCYCGKGG-SGTPVDELDRCCQVHDQCYSDSWQHDDCWGILDNPYTEIYSFACDKPAKIVSCNADKNRPCEM-FICECDRIAAHCFAQAGYNPEYEHYPSKN 149          
BLAST of Phospholipase A2 vs. Ensembl Zebrafish
Match: zgc:92162 (zgc:92162 [Source:ZFIN;Acc:ZDB-GENE-040718-41])

HSP 1 Score: 54.6842 bits (130), Expect = 2.933e-9
Identity = 41/133 (30.83%), Postives = 63/133 (47.37%), Query Frame = 1
Query:   91 LYGSLILVTIFLKA--------SDGELAQFNLMVKYITGRNPGIFIGYGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKKYNANPLLTVYKWSLAGKEIWCKN-NPVKLQTLCKCDKDIAYCLRDNLAHFN 462
            LY + +L T+ + +        S   L +   ++K  TGR+   ++ YG YCG G   G P D+ D CC +HD CY    +          Y W+   ++  C + N    + LC+CD++ A CLR   A FN
Sbjct:    4 LYHTFLLFTVSMASLQPQRSLRSKRGLLELAGVIKCSTGRSALSYVMYGCYCGLGG-QGWPRDRADWCCHKHDCCYGD-AEFAGCQTKTDRYHWTCDDEQADCDSLNDRCAKILCRCDREAARCLRK--APFN 132          
BLAST of Phospholipase A2 vs. Ensembl Xenopus
Match: eml6 (echinoderm microtubule associated protein like 6 [Source:Xenbase;Acc:XB-GENE-6039541])

HSP 1 Score: 63.1586 bits (152), Expect = 2.681e-12
Identity = 44/139 (31.65%), Postives = 66/139 (47.48%), Query Frame = 1
Query:   82 DKILYGSLILVT-IFLKASDGELAQFNLMVKYITGRNPGIFIGYGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKKYNANPLLTVYKWSLAGKEIWCKNNPVKL--------QTLCKCDKDIAYCLRDNLAHFNKGH 471
            +++++  +I+   +++      L Q    ++  TGR+   +IGYG +CG G   G P D  D CC  HD CY+ F +KY     L  Y W+       CK+N VK         + +CKCD   A CL  +   FN  H
Sbjct:    1 ERLVWPQVIITAFLYVHVERRGLIQLAGTIQCGTGRSAVHYIGYGCHCGLGG-QGVPKDNTDWCCHSHDCCYE-FAEKYGCKTKLGQYSWT-------CKDNTVKCGDMKDWCQKIVCKCDSKFAECL--SKTRFNSKH 128          
BLAST of Phospholipase A2 vs. Ensembl Xenopus
Match: eml6 (echinoderm microtubule associated protein like 6 [Source:Xenbase;Acc:XB-GENE-6039541])

HSP 1 Score: 61.6178 bits (148), Expect = 1.292e-11
Identity = 50/144 (34.72%), Postives = 67/144 (46.53%), Query Frame = 1
Query:  103 LILVTIFLKAS--DGELAQFNLM-----------VKYITGRNPGIFIGYGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKKYNANPLLTVYKWSLAGKEIWCKNNPVKL--------QTLCKCDKDIAYCLRDNLAHFNKGH 471
            L+LV  FL A   +GEL + +++           ++  TGR+   +IGYG +CG G   G P D  D CC  HD CY+ F +KY     L  Y W+       CK+N VK         + +CKCD   A CL      FN  H
Sbjct:    6 LLLVVHFLCAVSLNGELNKRHILQRRGLIQLAGTIQCGTGRSAVHYIGYGCHCGLGG-QGVPKDNTDWCCHSHDCCYE-FAEKYGCKTKLGQYSWT-------CKDNTVKCGDMKDWCQKIVCKCDSKFAECLSK--TRFNSKH 138          
BLAST of Phospholipase A2 vs. Ensembl Xenopus
Match: eml6 (echinoderm microtubule associated protein like 6 [Source:Xenbase;Acc:XB-GENE-6039541])

HSP 1 Score: 60.8474 bits (146), Expect = 1.643e-11
Identity = 48/133 (36.09%), Postives = 61/133 (45.86%), Query Frame = 1
Query:   97 GSLILVTIFLKASDGELAQFNLMVKYITGRNPGIFIGYGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKKYNANPLLTVYKWSLAGKEIWCKNNPVKL--------QTLCKCDKDIAYCLRDNLAHFNKGH 471
            G LIL    +    G L Q    ++  TGR+   +IGYG +CG G   G P D  D CC  HD CY+ F +KY     L  Y W+       CK+N VK         + +CKCD   A CL  +   FN  H
Sbjct:    2 GLLILNKRHILQRRG-LIQLAGTIQCGTGRSAVHYIGYGCHCGLGG-QGVPKDNTDWCCHSHDCCYE-FAEKYGCKTKLGQYSWT-------CKDNTVKCGDMKDWCQKIVCKCDSKFAECL--SKTRFNSKH 122          
BLAST of Phospholipase A2 vs. Ensembl Xenopus
Match: ENSXETT00000024628.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:9:31942973:31943890:-1 gene:ENSXETG00000015087.1 transcript:ENSXETT00000024628.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.6918 bits (143), Expect = 3.807e-11
Identity = 29/79 (36.71%), Postives = 41/79 (51.90%), Query Frame = 1
Query:  145 LAQFNLMVKYITGRNPGIFIGYGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKKYNANPLLTVYKWSLAGKEIWCKN 381
            L Q    ++ +TGR+   ++GYG +CG G   G P+D  D CC  HD CY    KK+   P +  YKWS   +   C+ 
Sbjct:   13 LMQLAAAIRCVTGRSSLRYLGYGCHCGPGG-RGGPIDATDRCCHDHDCCYKK-AKKHRCQPKIGGYKWSCRDRTFQCRK 89          
BLAST of Phospholipase A2 vs. Ensembl Xenopus
Match: ENSXETT00000035968.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:4:7950736:7951885:1 gene:ENSXETG00000016760.1 transcript:ENSXETT00000035968.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.077 bits (144), Expect = 4.049e-11
Identity = 31/77 (40.26%), Postives = 42/77 (54.55%), Query Frame = 1
Query:  208 YGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKKYNANPLLTVYKWSLAGKEIWCKNNPVKLQTLCKCDKDIAYCL 438
            YG +CG G  SG+P D++D CC  HD CY      +N +     Y++  A   I CK++ V  Q  C+CDK  A CL
Sbjct:   30 YGCFCGIGG-SGHPQDEVDRCCFLHDCCYQFTNVTFNCDSTFQAYEYECARSRIKCKSSSVCDQMTCECDKKFAECL 105          
BLAST of Phospholipase A2 vs. Ensembl Mouse
Match: Pla2g2e (phospholipase A2, group IIE [Source:MGI Symbol;Acc:MGI:1349660])

HSP 1 Score: 76.2554 bits (186), Expect = 1.921e-17
Identity = 45/130 (34.62%), Postives = 67/130 (51.54%), Query Frame = 1
Query:  100 SLILVTIFLKASDGELAQFNLMVKYITGRNPGIFIGYGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKKYNANPLLTVYKWSLAGKEIWCKNNPVKLQTLCKCDKDIAYCLRDNLAHFNK--GHYKRQ 483
            +L  + + +  + G L QF +M++ +TG+    +  YG YCG G  S  PVD+ D CC  HD CY   L+K   +P L  Y +S+    I+C       +  C+CDK  A C R NL  +N+   HY  +
Sbjct:    6 ALACLCLLVPLAGGNLVQFGVMIERMTGKPALQYNDYGCYCGVGG-SHWPVDETDWCCHAHDCCYGR-LEKLGCDPKLEKYLFSITRDNIFCAGRTACQRHTCECDKRAALCFRHNLNTYNRKYAHYPNK 133          
BLAST of Phospholipase A2 vs. Ensembl Mouse
Match: Pla2g2e (phospholipase A2, group IIE [Source:MGI Symbol;Acc:MGI:1349660])

HSP 1 Score: 76.2554 bits (186), Expect = 1.921e-17
Identity = 45/130 (34.62%), Postives = 67/130 (51.54%), Query Frame = 1
Query:  100 SLILVTIFLKASDGELAQFNLMVKYITGRNPGIFIGYGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKKYNANPLLTVYKWSLAGKEIWCKNNPVKLQTLCKCDKDIAYCLRDNLAHFNK--GHYKRQ 483
            +L  + + +  + G L QF +M++ +TG+    +  YG YCG G  S  PVD+ D CC  HD CY   L+K   +P L  Y +S+    I+C       +  C+CDK  A C R NL  +N+   HY  +
Sbjct:    6 ALACLCLLVPLAGGNLVQFGVMIERMTGKPALQYNDYGCYCGVGG-SHWPVDETDWCCHAHDCCYGR-LEKLGCDPKLEKYLFSITRDNIFCAGRTACQRHTCECDKRAALCFRHNLNTYNRKYAHYPNK 133          
BLAST of Phospholipase A2 vs. Ensembl Mouse
Match: Pla2g2d (phospholipase A2, group IID [Source:MGI Symbol;Acc:MGI:1341796])

HSP 1 Score: 70.0922 bits (170), Expect = 4.106e-15
Identity = 44/116 (37.93%), Postives = 62/116 (53.45%), Query Frame = 1
Query:  124 LKASDGELAQFNLMVKYITGRNPGI-FIGYGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKKYNANPLLTVYKWSLAGKEIWCKNNPVKLQ-TLCKCDKDIAYCLRDNLAHFNK 465
            + A+ G L   N MV ++TG+     +  YG +CG G   G P D  D CC++HD CY   LK      L   YK+S++   I C +N    +  LC CDK++A CL+ NL  +NK
Sbjct:   14 ITATQGGLLNLNKMVTHMTGKKAFFSYWPYGCHCGLGG-KGQPKDATDWCCQKHDCCY-AHLKIDGCKSLTDNYKYSISQGTIQCSDNGSWCERQLCACDKEVALCLKQNLDSYNK 127          
BLAST of Phospholipase A2 vs. Ensembl Mouse
Match: Pla2g2c (phospholipase A2, group IIC [Source:MGI Symbol;Acc:MGI:106638])

HSP 1 Score: 69.707 bits (169), Expect = 6.986e-15
Identity = 38/126 (30.16%), Postives = 60/126 (47.62%), Query Frame = 1
Query:  103 LILVTIFLKASDGELAQFNLMVKYITGRNPGIFIGYGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKKYNANPLLTVYKWSLAGKEIWC----KNNPVKLQTLCKCDKDIAYCLRDNLAHFNKG 468
            L+ +  +  ++     QF  MVK++TGR+                 G PVD  D CC  HD CY   LK+Y   P+L  Y++++    + C     ++ +  Q  C+CDK   YC ++NLA + K 
Sbjct:    8 LVFIFYWTTSTLSSFWQFQRMVKHVTGRSAFFSYYGYGCYCGLGGKGLPVDATDRCCWAHDCCYHK-LKEYGCQPILNAYQFTIVNGTVTCGCTVASSCLCGQKACECDKQSVYCFKENLATYEKA 132          
BLAST of Phospholipase A2 vs. Ensembl Mouse
Match: Pla2g2c (phospholipase A2, group IIC [Source:MGI Symbol;Acc:MGI:106638])

HSP 1 Score: 69.707 bits (169), Expect = 6.986e-15
Identity = 38/126 (30.16%), Postives = 60/126 (47.62%), Query Frame = 1
Query:  103 LILVTIFLKASDGELAQFNLMVKYITGRNPGIFIGYGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKKYNANPLLTVYKWSLAGKEIWC----KNNPVKLQTLCKCDKDIAYCLRDNLAHFNKG 468
            L+ +  +  ++     QF  MVK++TGR+                 G PVD  D CC  HD CY   LK+Y   P+L  Y++++    + C     ++ +  Q  C+CDK   YC ++NLA + K 
Sbjct:    8 LVFIFYWTTSTLSSFWQFQRMVKHVTGRSAFFSYYGYGCYCGLGGKGLPVDATDRCCWAHDCCYHK-LKEYGCQPILNAYQFTIVNGTVTCGCTVASSCLCGQKACECDKQSVYCFKENLATYEKA 132          
BLAST of Phospholipase A2 vs. UniProt/SwissProt
Match: sp|Q2YHJ6|PA2AA_TRIPE (Acidic phospholipase A2 Tpu-E6a OS=Trimeresurus puniceus OX=197218 PE=1 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 2.861e-18
Identity = 47/127 (37.01%), Postives = 70/127 (55.12%), Query Frame = 1
Query:  100 SLILVTIFLKASDGELAQFNLMVKYITGRNPGI--FIGYGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKKYNANPLLTVYKWSLAGKEIWCKNNPVKLQTLCKCDKDIAYCLRDNLAHFNKGHY 474
            +L ++ + L    G L QF LM+K ++GR+ GI  +  YG YCG+G   G P D  D CC  HD CY    K    +P +  YK+S    +I C  N   L+ +C+CD+  A C RDNL+ ++  ++
Sbjct:    3 TLWIMAVLLLGVKGNLLQFELMIKKMSGRS-GIRWYSDYGCYCGKGG-HGQPQDATDRCCFVHDCCYG---KVSGCDPKMAFYKYSSDNNDIVCGGNNPCLKEICECDRAAAICFRDNLSTYDNKYW 124          
BLAST of Phospholipase A2 vs. UniProt/SwissProt
Match: sp|P0DPT9|PA23_SCODE (Phospholipase A2 SSD1043 OS=Scolopendra dehaani OX=2609776 PE=1 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 3.806e-18
Identity = 53/142 (37.32%), Postives = 65/142 (45.77%), Query Frame = 1
Query:   67 KMLKYDKILYGSLILVTIFLKASDGELAQFNLMVKYITGRNPGIFIGYGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKK----YNANPLLTVYKWSLAGKEIWC-KNNPVKLQTLCKCDKDIAYCLRDNLAHFNKGHYK 477
            K + +  I   S   VT  L      LA F  M      R+P  + GYGNYCG G   G PVD ID CC+ HD CY    +     Y  N  L  Y W + G EI C   +    + LCKCDKDI  C  +N   +N  + K
Sbjct:    4 KFMFFSIIAVWSCAAVTEALFIQHRSLANFFFMTLTAAKRSPQEYDGYGNYCGWGG-EGTPVDSIDRCCQVHDNCYGTVNENECGHYIRNVKLIDYDWHMEGTEIVCDPKDDACGRALCKCDKDIIDCFNENDKDYNPEYNK 144          
BLAST of Phospholipase A2 vs. UniProt/SwissProt
Match: sp|Q90Y77|PA2BY_PROFL (Basic phospholipase A2 PL-Y OS=Protobothrops flavoviridis OX=88087 PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 9.198e-18
Identity = 45/123 (36.59%), Postives = 65/123 (52.85%), Query Frame = 1
Query:  100 SLILVTIFLKASDGELAQFNLMVKYITGRNPGI-FIGYGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKKYNANPLLTVYKWSLAGKEIWCKNNPVKLQTLCKCDKDIAYCLRDNLAHFNK 465
            +L ++ + L   +G L QF  M+K +TG+ P + +  YG YCG+G   G P D  D CC  HD CY+   K    +P    Y +SL   +I C  +    + +C+CDK  A C RDNL  + K
Sbjct:    3 TLWIMAVLLVGVEGHLLQFRKMIKKMTGKEPIVSYAFYGCYCGKGG-RGKPKDATDRCCFVHDCCYE---KVTGCDPKWDYYTYSLENGDIVCGGDNPCTKVVCECDKAAAICFRDNLKTYKK 121          
BLAST of Phospholipase A2 vs. UniProt/SwissProt
Match: sp|Q9NZK7|PA2GE_HUMAN (Group IIE secretory phospholipase A2 OS=Homo sapiens OX=9606 GN=PLA2G2E PE=1 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 1.380e-17
Identity = 45/126 (35.71%), Postives = 67/126 (53.17%), Query Frame = 1
Query:  103 LILVTIFLKASDGELAQFNLMVKYITGRNPGIFIGYGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKKYNANPLLTVYKWSLAGKEIWCKNNPVKLQTLCKCDKDIAYCLRDNLAHFNK--GHY 474
            L+ + + +    G L QF +M++ +TG++   +  YG YCG G  S  PVD+ D CC  HD CY   L+K    P L  Y +S++ + I+C       +  C+CDK  A C R NL  +N+   HY
Sbjct:    7 LVFLCLLVALVTGNLVQFGVMIEKMTGKSALQYNDYGCYCGIGG-SHWPVDQTDWCCHAHDCCYGR-LEKLGCEPKLEKYLFSVSERGIFCAGRTTCQRLTCECDKRAALCFRRNLGTYNRKYAHY 130          
BLAST of Phospholipase A2 vs. UniProt/SwissProt
Match: sp|Q800C2|PA2AG_CROVV (Acidic phospholipase A2 Cvv-E6g OS=Crotalus viridis viridis OX=8742 PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 1.436e-17
Identity = 46/128 (35.94%), Postives = 68/128 (53.12%), Query Frame = 1
Query:  100 SLILVTIFLKASDGELAQFNLMVKYITGRNPGIFIG-YGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKKYNANPLLTVYKWSLAGKEIWCKNNPVKLQTLCKCDKDIAYCLRDNLAHFNKGHYKR 480
            +L +V + L   +G L QF +M+  +  R+   + G YG YCG G   G P D  D CC  HD CY    K  + NP    Y +S+   EI C+++    + +C+CD+  A C RDN+  +N  +YKR
Sbjct:    3 TLWIVAVLLLGVEGSLVQFEMMIIKVAKRSGLFWYGAYGCYCGWGG-QGRPQDATDRCCFVHDCCYG---KATDCNPKTVSYTYSVKNGEIICEDDDPCKKQVCECDRVAAVCFRDNIPSYNN-NYKR 125          
BLAST of Phospholipase A2 vs. TrEMBL
Match: A0A140YIG3 (Basic phospholipase A2 OS=Echis carinatus OX=40353 PE=2 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 3.022e-17
Identity = 44/130 (33.85%), Postives = 68/130 (52.31%), Query Frame = 1
Query:  100 SLILVTIFLKASDGELAQFNLMVKYITGRNPGIFIGYGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKKYNANPLLTVYKWSLAGKEIWCKNNPVKLQTLCKCDKDIAYCLRDNLAHFNKGHYKRQNF 489
            +L +V ++L   +G + +   M+  +T + P  ++ YG +CG G   G P D  D CC  H  CYD      + +P    YK+     EI C+N+    + +C+CDK +A CLRDNL  +NK +    NF
Sbjct:    3 TLWIVAVWLMCVEGSVIELGKMIIQLTNKTPASYVSYGCFCGGGD-KGKPKDATDRCCFVHSCCYDTLP---DCSPKTDQYKYKWENGEIICENSTSCKKRICECDKAVAICLRDNLNTYNKKYRIYPNF 128          
BLAST of Phospholipase A2 vs. TrEMBL
Match: A0A210Q6V2 (Phospholipase A(2) OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT20469 PE=3 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.431e-16
Identity = 45/120 (37.50%), Postives = 60/120 (50.00%), Query Frame = 1
Query:  142 ELAQFNLMVKYITGRNPGIFIGYGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKKYNANP-------LLTVYKWSLAGKEIWCKNNPVKLQTLCKCDKDIAYCLRDNLAHFNKGHYKR 480
             L Q N M++ +TG++   F GYGN+CG G  SG PVD+ID CCK HD CYD    K   +          T+Y W+L    + C +       LC CD+    C   NLA ++ G   R
Sbjct:   30 SLPQLNKMIRTVTGKSGLDFNGYGNWCGVGG-SGEPVDEIDRCCKAHDLCYDNIATKACKSAKGEILTTYTTIYNWTLTNGHLQCNDVFPCQHALCMCDRQATTCFALNLASYDNGKRSR 148          
BLAST of Phospholipase A2 vs. TrEMBL
Match: A0A4U1FS19 (Phospholipase A(2) OS=Monodon monoceros OX=40151 GN=EI555_014666 PE=3 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 1.930e-16
Identity = 44/116 (37.93%), Postives = 62/116 (53.45%), Query Frame = 1
Query:  139 GELAQFNLMVKYITGRNPGIFIGYGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKKYNANPLLTVYKWSLAGKEIWCKNNPVKLQTLCKCDKDIAYCLRDNLAHFNKGHYKRQN 486
            G L QF +M + + G+    +I YG YCG G   G PVD+ D CC  HD CY   L+K    P+L +Y +S +   I+C       Q  C+CDK  A C RDNL  +++ + +  N
Sbjct:   20 GNLVQFGVMTERMKGQPALQYIDYGCYCGFGGSHG-PVDQTDWCCHAHDCCYGS-LEKLGCEPILEMYLFSASRHSIFCAGRTTCQQQTCECDKRAALCFRDNLGTYDRKYARYPN 133          
BLAST of Phospholipase A2 vs. TrEMBL
Match: A0A0L8IAV0 (Phospholipase A(2) OS=Octopus bimaculoides OX=37653 GN=OCBIM_22024452mg PE=3 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 2.073e-16
Identity = 44/115 (38.26%), Postives = 66/115 (57.39%), Query Frame = 1
Query:  142 ELAQFNLMVKYITGRNPGIFIGYGNYCGEGSLSGNPVDKIDECCKRHDECYD-VFLKKYNA----NPLLTVYKWSLAGKEIWCKNNPVKLQTLCKCDKDIAYCLRDNLAHFNKGH 471
             L +F  MV+++TG+N  +F  YG +CG G  SG PVD ID CC++HD CYD V   + N+       +T Y W   G  I C ++    Q  C+CD+D A C ++++  ++K H
Sbjct:   29 SLPRFGKMVEFLTGKNSLMFNEYGRWCGFGG-SGTPVDAIDRCCQKHDYCYDRVNEDQCNSWFINKGYITKYNWHFDGVNIICDDSRQCEQATCECDRDAAMCFQEHIDKYDKKH 142          
BLAST of Phospholipase A2 vs. TrEMBL
Match: L5JRZ3 (Phospholipase A(2) OS=Pteropus alecto OX=9402 GN=PAL_GLEAN10015219 PE=3 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 2.252e-16
Identity = 53/137 (38.69%), Postives = 71/137 (51.82%), Query Frame = 1
Query:   52 RICKIKMLKYDKILYGSLILVTIFLKASDGELAQFNLMVKYITGRNPGIFIGYGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKKYNANPLLTVYKWSLAGKEIWCKNNPVKLQTLCKCDKDIAYCLRDNLAHFN 462
            R C  K L  DK  Y S     + +  + G L QF +M++ +TG+    +  YG YCG G  S  PVD+ D CC  HD CY+  L+K    P L  Y +S++  +I+C       Q  CKCDK  A C R NLA +N
Sbjct:   78 RGCGTKFLS-DKYEYESRNTQILSVALAWGNLVQFGVMIEKMTGKPALQYNDYGCYCGIGG-SHWPVDQTDWCCHAHDCCYEC-LEKLGCEPKLERYLFSVSRSDIFCAGKTACQQQTCKCDKTAALCFRQNLATYN 211          
BLAST of Phospholipase A2 vs. Ensembl Cavefish
Match: ENSAMXT00000031293.1 (phospholipase A2-like [Source:NCBI gene;Acc:103028136])

HSP 1 Score: 60.4622 bits (145), Expect = 1.607e-11
Identity = 42/126 (33.33%), Postives = 64/126 (50.79%), Query Frame = 1
Query:   91 LYGSLILVTIFLKASDGE-----LAQFNLMVKYI-TGRNPGIFIGYGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKKYNA---NPLLTVYKWSLAGKEIWCKNNPVKLQ-TLCKCDKDIAYCL 438
            +Y S  L+   + A  G      L QF  M++    G NP I+  YG +CG G  SG+P D++D CC+ HD+CY    K       +P + VY  S + K+  C  +  K +  +C+CD+  A+C 
Sbjct:    1 MYLSWFLLFATVSAVRGAVVPYALWQFGNMIQCAQPGVNPLIYNNYGCFCGLGG-SGSPKDQLDRCCQVHDQCYTNAKKLPECTFLDPYVKVYSHSCSNKKASCSGSNAKCEAAVCECDRVAAHCF 125          
BLAST of Phospholipase A2 vs. Ensembl Cavefish
Match: ENSAMXT00000030049.1 (phospholipase A2-like [Source:NCBI gene;Acc:103028136])

HSP 1 Score: 60.077 bits (144), Expect = 1.804e-11
Identity = 37/103 (35.92%), Postives = 56/103 (54.37%), Query Frame = 1
Query:  145 LAQFNLMVKYI-TGRNPGIFIGYGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKKYNA---NPLLTVYKWSLAGKEIWCKNNPVKLQ-TLCKCDKDIAYCL 438
            L QF  M++    G NP I+  YG +CG G  SG+P D++D CC+ HD+CY    K       +P + VY  S + K+  C  +  K +  +C+CD+  A+C 
Sbjct:   13 LWQFGNMIQCAQPGVNPLIYNNYGCFCGLGG-SGSPKDQLDRCCQVHDQCYTNAKKLPECTFLDPYVKVYSHSCSNKKASCSGSNAKCEAAVCECDRVAAHCF 114          
BLAST of Phospholipase A2 vs. Ensembl Cavefish
Match: zgc:92162 (phospholipase A2-like [Source:NCBI gene;Acc:103040974])

HSP 1 Score: 59.6918 bits (143), Expect = 3.517e-11
Identity = 45/143 (31.47%), Postives = 69/143 (48.25%), Query Frame = 1
Query:   91 LYGSLILVTIFLKA--------SDGELAQFNLMVKYITGRNPGIFIGYGNYCGEGSLSGNPVDKIDECCKRHDECY-DVFLKKYNANPLLTVYKWSLAGKEIWCKNNPVKLQ-TLCKCDKDIAYCLRDNLAHFNKGHYKRQNF 489
            LY + +L ++ L +        S   L +   ++K  TGR+   ++ YG YCG G   G P D+ D CC +HD CY D   +          Y+W+   KE  C +   K +  LC+CD++ A CLR   A FN+ +    +F
Sbjct:    4 LYTTFLLFSVSLASLVPQRSVRSKRGLLELAGVIKCSTGRSALAYMMYGCYCGLGG-QGWPRDRADWCCHKHDCCYGDAEFE--GCQTKTAKYQWTCENKEADCDSLEDKCEKILCRCDREAAKCLRK--APFNRQYALWPDF 141          
BLAST of Phospholipase A2 vs. Ensembl Cavefish
Match: ENSAMXT00000000319.2 (phospholipase A2 [Source:NCBI gene;Acc:103024514])

HSP 1 Score: 57.3806 bits (137), Expect = 2.752e-10
Identity = 41/120 (34.17%), Postives = 66/120 (55.00%), Query Frame = 1
Query:  145 LAQF-NLMVKYITGRNPGI-FIGYGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKKYNA------NPLLTVYKWSL--AGKEIWCKNNPVKLQT-LCKCDKDIAYCLRDNLAHFNKGH 471
            L QF ++++  I    P + +  YG YCG+G  SG PVD +D CC+ HD CY   + ++NA      NP   +Y +S     K+I CK+N  + +  +C+CD+  A C    ++ +N+ H
Sbjct:   37 LWQFRDMIICTIPDSWPALDYSDYGCYCGKGG-SGTPVDDLDRCCEVHDRCYSDAM-QHNACWPILDNPYTEIYAYSCDKENKKITCKSNNNECEMFICECDRKAAECFA--VSDYNEEH 152          
BLAST of Phospholipase A2 vs. Ensembl Cavefish
Match: ENSAMXT00000012624.2 (phospholipase A2-like [Source:NCBI gene;Acc:103028503])

HSP 1 Score: 46.2098 bits (108), Expect = 2.628e-6
Identity = 32/98 (32.65%), Postives = 46/98 (46.94%), Query Frame = 1
Query:  151 QFNLMVKYITGRNPGIFIGYGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKKYNANPLLTVYKWSLAGKEIWCKNNPVKLQ-TLCKCDKDIAYCLR 441
            + + ++K  TGR    +  YG YCG G   G P D  D CC RHD CY    +    +     Y+WS +     C +     + T+C CD + A CL+
Sbjct:   31 ELSGVIKCSTGRYALAYSLYGCYCGLGG-QGWPRDNADWCCHRHDCCY-ATAQDSGCHTKPAQYRWSCSTDLPDCGSLTDSCEKTVCLCDAEAARCLK 126          
BLAST of Phospholipase A2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008209.1 (pep scaffold:Pmarinus_7.0:GL476891:251313:253691:-1 gene:ENSPMAG00000007418.1 transcript:ENSPMAT00000008209.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.2478 bits (173), Expect = 3.142e-16
Identity = 42/110 (38.18%), Postives = 58/110 (52.73%), Query Frame = 1
Query:  154 FNLMVKYITGRNPGIFIGYGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKKYNANPLLTVYKWSLAGKEIWCKNNPVKLQTL-CKCDKDIAYCLR-----DNLAHFNK 465
            F  M+  +TGRNP  + GYG +C  GS  G+PVD +D CC+ H+ CYD       A+ L + Y++S  GK I C+      +TL C CDK    C       DN  +F +
Sbjct:   33 FAWMIYRVTGRNPLDYSGYGCHCIMGS-EGHPVDAVDRCCQVHNRCYDAAFSMGCASDLDS-YEFSTRGKAITCRKQGSPCETLACSCDKAAVECFAIHDFDDNFQNFKR 140          
BLAST of Phospholipase A2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008463.1 (pep scaffold:Pmarinus_7.0:GL483377:12502:14271:-1 gene:ENSPMAG00000007657.1 transcript:ENSPMAT00000008463.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.4698 bits (158), Expect = 3.645e-14
Identity = 45/134 (33.58%), Postives = 67/134 (50.00%), Query Frame = 1
Query:  100 SLILVTIFLKASDGELAQFNLMVKYITGRNPGIFIGYGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKKYNANPLLTVYKWSLAGKEIWCKNN--PVKLQTLCKCDKDIAYCLRDNLAHFNKGHYKRQNFQR 495
            +  + T+   A    LA F LM+  + G NP  + GYG  C   +  G PVD +D CC+ H +CY+  + K + +P    Y +S+ GK I C     P  + T C+CDK    C     +HFN+   + +NF R
Sbjct:    6 TFAIYTLIAGAFSSSLA-FALMIWKVVGINPAEYSGYGCNC-LSTGHGKPVDDVDRCCQAHTKCYEQ-VYKMSCSPHWDPYYFSIRGKAIRCTRGGPPCDVHT-CRCDKAAVECF--ARSHFNR---RYRNFNR 130          
BLAST of Phospholipase A2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008454.1 (pep scaffold:Pmarinus_7.0:GL483377:2289:3737:-1 gene:ENSPMAG00000007656.1 transcript:ENSPMAT00000008454.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.077 bits (144), Expect = 2.940e-12
Identity = 40/119 (33.61%), Postives = 60/119 (50.42%), Query Frame = 1
Query:  145 LAQFNLMVKYITGRNPGIFIGYGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKKYNANPLLTVYKWSLAGKEIWCKNN--PVKLQTLCKCDKDIAYCLRDNLAHFNKGHYKRQNFQR 495
            +  F  M+  + G NP  + GYG  C   +  G PVD +D CC+ H +CY+  + K + +P    Y +S+ GK I C     P  + T C+CDK    C     +HFN+   + +NF R
Sbjct:    2 IWNFAWMIWKVVGINPAEYSGYGCNC-LSTGHGKPVDDVDRCCQAHTKCYEQ-VNKMSCSPDWDPYYFSIRGKAIRCTRGGPPCDVHT-CRCDKAAVECF--ARSHFNR---RYRNFNR 112          
BLAST of Phospholipase A2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008226.1 (pep scaffold:Pmarinus_7.0:GL476891:263168:265744:1 gene:ENSPMAG00000007428.1 transcript:ENSPMAT00000008226.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.9214 bits (141), Expect = 1.518e-11
Identity = 36/120 (30.00%), Postives = 56/120 (46.67%), Query Frame = 1
Query:  112 VTIFLKASDGE----------LAQFNLMVKYITGRNPGIFIGYGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKKYNANPLLTVYKWSLAGKEIWC-KNNPVKLQTLCKCDKDIAYCL 438
            V++ L A++G           + QF  M++    R P  + GYG +CG G   G PVD  D CC+ HD CY+  +     NP   +Y ++     I C   N    + +C+CD+  + C 
Sbjct:   14 VSVLLSATEGTDSNRLRHRRNVVQFGNMIECRMNRQPLDYYGYGCHCGFGG-KGAPVDPTDRCCRSHDCCYNRAITA-GCNPYSDIYHYACKHGRITCDAKNDWCERKICECDRRASACF 131          
BLAST of Phospholipase A2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008199.1 (pep scaffold:Pmarinus_7.0:GL476891:241341:242643:-1 gene:ENSPMAG00000007414.1 transcript:ENSPMAT00000008199.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.4546 bits (132), Expect = 1.815e-10
Identity = 40/125 (32.00%), Postives = 59/125 (47.20%), Query Frame = 1
Query:  127 KASDGELAQFNLMVKYITGRNPGIFIGYGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKKYNANPLLTVYKWSLAGKEIWCKNN--PVKLQTLCKCDKDIAYCLRDNLAHFNKGHYKRQNFQR 495
            K     +  F  M+  +   NP  + GYG  C   +  G PVD +D CC+ H +CY+  + K + +P    Y +S+ GK I C     P  + T C CDK    C     +HFN+   + +NF R
Sbjct:   19 KREKRAIWNFAWMIWKVVRINPAEYSGYGCNC-LSTGHGKPVDDVDRCCQAHTKCYEQ-VYKMSCSPHWDPYYFSIRGKAIRCTRGGPPCDVHT-CLCDKAAVECF--ARSHFNR---RYRNFNR 135          
BLAST of Phospholipase A2 vs. Ensembl Nematostella
Match: EDO43504 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYD8])

HSP 1 Score: 69.707 bits (169), Expect = 8.575e-16
Identity = 41/110 (37.27%), Postives = 54/110 (49.09%), Query Frame = 1
Query:  151 QFNLMVKYITGRNPGIFIGYGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKKYNANPLLTVYKWSLAGKEIWCK------NNPVKLQTLCKCDKDIAYCLRDNLAHFN 462
            QF  MVK  TGR    + GYGN+CG G   G PVD +D CC  HD C+D  +   +  P    Y +S++ +   C       NN    Q++C CDK  A C   N  + N
Sbjct:    1 QFGRMVKCATGRRAWDYNGYGNWCGRGGR-GTPVDGVDRCCMVHDHCWDRLV---HCRPYSNKYSYSVSDRHPSCSITCNAGNNDSCEQSICNCDKAAAECFARNTYNPN 106          
BLAST of Phospholipase A2 vs. Ensembl Nematostella
Match: EDO40720 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6H4])

HSP 1 Score: 65.855 bits (159), Expect = 3.489e-14
Identity = 47/128 (36.72%), Postives = 64/128 (50.00%), Query Frame = 1
Query:  133 SDGELAQFNLMVKYITGRNPGIFIGYGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKK----YNANPLLTVYKWSLAGKEIWCK-NNPVKLQTLCKCDKDIAYCLR-----DNLAHFNKGHYKRQN 486
            S   L QF LM+K  TGR+   + GYG +CG+G  SG  VD  D CC  HD CYD  ++     +  N   TVY     G  I+ K NNP + + +C+CD     C +     +    +NK  Y R+N
Sbjct:    2 SKRSLVQFGLMIKCTTGRSAFDYNGYGCWCGKGG-SGRAVDATDRCCLIHDRCYDAVIRDRVCPWGINVYTTVY--FRKGCNIFGKTNNPCQYR-ICQCDSAAVRCFKRSYYNNRYKDYNKNKYCRKN 125          
BLAST of Phospholipase A2 vs. Ensembl Nematostella
Match: EDO40990 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5K1])

HSP 1 Score: 59.3066 bits (142), Expect = 1.444e-11
Identity = 41/131 (31.30%), Postives = 58/131 (44.27%), Query Frame = 1
Query:  103 LILVTIFLKASDGELAQFNLMVKYITGRNPGIFIGYGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKKYNAN-PLLTVYKWSLAGKE---IWCKNNPVKLQTL----CKCDKDIAYCLRDNLAHFNKGH 471
            L  V+ FL  +   + +F  M+   TGR    +  YG +CG G   GNPVD +D CC  HD CY+  + +   N   + +  +   GK+    W     V +       CKCD     C R N   FNK +
Sbjct:    3 LSFVSFFLPVAKRSVWRFASMIAKATGRGAWQYTHYGCWCGLGG-KGNPVDAVDRCCVCHDVCYNKLIDRGICNKSRIYLVNYYFTGKKTSGFWRWKKTVNVSRCGYEKCKCDAAAVVCFRRN--RFNKKY 130          
BLAST of Phospholipase A2 vs. Ensembl Nematostella
Match: EDO28179 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T773])

HSP 1 Score: 55.4546 bits (132), Expect = 9.447e-11
Identity = 27/71 (38.03%), Postives = 42/71 (59.15%), Query Frame = 1
Query:  151 QFNLMVKYITGRNPGIFIGYGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKKYNANPLLTVYKWSLAGK 363
             F  M+K  TGR+   +  YGN+CG G  SG PVD +D CC+ HD C+    +  + +P   +Y++ ++GK
Sbjct:    1 MFGRMIKCATGRSAWDYNRYGNWCGRGG-SGTPVDGVDRCCRAHDLCWG---EVNHCDPFWNLYRYRISGK 67          
BLAST of Phospholipase A2 vs. Ensembl Nematostella
Match: EDO43503 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYD7])

HSP 1 Score: 52.7582 bits (125), Expect = 1.706e-9
Identity = 37/111 (33.33%), Postives = 57/111 (51.35%), Query Frame = 1
Query:  151 QFNLMVKYITGRNPGIFIGYGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKKYNANPLLTVYKWSLAGKEIWC-------KNNPVKLQTLCKCDKDIAYCLRDNLAHFN 462
            QF  M+K  TGR+   +  YGN+CG G     PVD +D CC+ HD C+    +  + +P   +Y++ ++G    C       KN+  + Q++C CDK  A C   N  + N
Sbjct:    1 QFRKMIKCATGRSAWDYNRYGNWCGRGGGG-TPVDGVDRCCRAHDLCWG---EVKHCHPFSNLYRYRISGIYPSCSITCNAGKNDSCE-QSICNCDKAAAECFARNTYNPN 106          
BLAST of Phospholipase A2 vs. Ensembl Medaka
Match: zgc:92162 (phospholipase A2 [Source:NCBI gene;Acc:101170929])

HSP 1 Score: 56.6102 bits (135), Expect = 4.838e-10
Identity = 37/101 (36.63%), Postives = 51/101 (50.50%), Query Frame = 1
Query:  145 LAQFNLMVKYITGRNPGIFIGYGNYCGEGSLSGNPVDKIDECCKRHDECY-DVFLKKYNANPLLTVYKWSLAGKEIWCKNNPVKLQ-TLCKCDKDIAYCLR 441
            L +    +K  TGR+   ++ YG YCG G   G P D+ D CC RHD CY D  L     +     Y W+   ++  C +   K +  LCKCD++ A CLR
Sbjct:   31 LLELAGAIKCSTGRSALAYMMYGCYCGLGG-QGWPRDRADWCCHRHDCCYGDAEL--LGCHTKTAQYHWTCEDRKAECDDLKDKCEKMLCKCDREAAKCLR 128          
BLAST of Phospholipase A2 vs. Ensembl Medaka
Match: ENSORLT00000032129.1 (phospholipase A2 group IB [Source:NCBI gene;Acc:101155667])

HSP 1 Score: 56.225 bits (134), Expect = 5.591e-10
Identity = 38/126 (30.16%), Postives = 62/126 (49.21%), Query Frame = 1
Query:  145 LAQFNLMVKYITGRN-PGI-FIGYGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKKYNA-----NPLLTVYKWSL--AGKEIWCKNNPVKLQT-LCKCDKDIAYCLRDNLAHFNKGHYKRQNFQ 492
            L QF  M+  +   + P + +  YG YCG G  SGNPVD++D CC+ HD+CY   ++         NP   +Y ++   A K++ C ++  + +  +C+CD+  A C   +  H    H      Q
Sbjct:   25 LHQFRAMILCMKPDSWPALDYADYGCYCGLGG-SGNPVDELDRCCQVHDQCYSDAMQHPECWPILDNPYTEIYDYTCDEANKKLTCTSSNDECEMFICECDRKAAECFGISTWHPEHEHLPSDRCQ 149          
BLAST of Phospholipase A2 vs. Planmine SMEST
Match: SMESG000075160.1 (SMESG000075160.1)

HSP 1 Score: 337.035 bits (863), Expect = 6.745e-120
Identity = 164/166 (98.80%), Postives = 164/166 (98.80%), Query Frame = 1
Query:   70 MLKYDKILYGSLILVTIFLKASDGELAQFNLMVKYITGRNPGIFIGYGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKKYNANPLLTVYKWSLAGKEIWCKNNPVKLQTLCKCDKDIAYCLRDNLAHFNKGHYKRQNFQRAVISFLNTLKKKSYSQKQKMFINY 567
            MLKYDKILYGSLILVTIFLKASDGELAQFNLMVKYITG NPGIFIGYGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKKYNANPLLTVYKWSLAGKEIWCKNNPVKLQTLCKCDKDIAYCLRDNLAHFNKGHYKRQNFQRAVISFLNTL KKSYSQKQKMFINY
Sbjct:    1 MLKYDKILYGSLILVTIFLKASDGELAQFNLMVKYITGLNPGIFIGYGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKKYNANPLLTVYKWSLAGKEIWCKNNPVKLQTLCKCDKDIAYCLRDNLAHFNKGHYKRQNFQRAVISFLNTLIKKSYSQKQKMFINY 166          
BLAST of Phospholipase A2 vs. Planmine SMEST
Match: SMESG000079712.1 (SMESG000079712.1)

HSP 1 Score: 153.295 bits (386), Expect = 2.344e-47
Identity = 70/157 (44.59%), Postives = 97/157 (61.78%), Query Frame = 1
Query:  103 LILVTIFL--KASDGELAQFNLMVKYITGRNPGIFIGYGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKKYNANPLLTVYKWSLAGKEIWCKNNPVKLQTLCKCDKDIAYCLRDNLAHFNKGHYKRQNFQRAVISFLNTLKKKSYSQKQKMFINY 567
            L  +T FL    S G L +FN M+K++  RNP + +GYG YCG+G+L G P+D+ID CCK HD+CY+ +   +  NPLLT Y WS     + C  N    Q LCKCD+ I YC+RDN   FN  HY+RQ  +RA +  LN + K++  Q   +F+N+
Sbjct:    5 LKFLTFFLCFTLSLGSLIEFNNMLKWVLKRNPSLLVGYGRYCGKGNLPGKPIDEIDSCCKVHDDCYETWENSHKNNPLLTSYSWSYNEGVVSCDQNTKPRQKLCKCDQGITYCVRDNFKAFNPEHYRRQGIERAALGTLNLIWKRNTEQDTSLFVNF 161          
BLAST of Phospholipase A2 vs. Planmine SMEST
Match: SMESG000079712.1 (SMESG000079712.1)

HSP 1 Score: 144.05 bits (362), Expect = 4.082e-44
Identity = 61/135 (45.19%), Postives = 86/135 (63.70%), Query Frame = 1
Query:  163 MVKYITGRNPGIFIGYGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKKYNANPLLTVYKWSLAGKEIWCKNNPVKLQTLCKCDKDIAYCLRDNLAHFNKGHYKRQNFQRAVISFLNTLKKKSYSQKQKMFINY 567
            M+K++  RNP + +GYG YCG+G+L G P+D+ID CCK HD+CY+ +   +  NPLLT Y WS     + C  N    Q LCKCD+ I YC+RDN   FN  HY+RQ  +RA +  LN + K++  Q   +F+N+
Sbjct:    1 MLKWVLKRNPSLLVGYGRYCGKGNLPGKPIDEIDSCCKVHDDCYETWENSHKNNPLLTSYSWSYNEGVVSCDQNTKPRQKLCKCDQGITYCVRDNFKAFNPEHYRRQGIERAALGTLNLIWKRNTEQDTSLFVNF 135          
BLAST of Phospholipase A2 vs. Planmine SMEST
Match: SMESG000025902.1 (SMESG000025902.1)

HSP 1 Score: 97.0561 bits (240), Expect = 1.831e-25
Identity = 52/144 (36.11%), Postives = 75/144 (52.08%), Query Frame = 1
Query:  100 SLILVTIFLKASDGELAQFNLMVKYITGRNPGIFIGYGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKKY-NANPLLTVYKWSLA----GKEIWCKNNPVKLQTLCKCDKDIAYCLRDNLAHFNKGHYKRQNFQRAVISFLN 516
            S+ +++I     +G L + N M++     NPG  +GYGNYCG G+    P+D ID CCK HD C+ ++ +KY +    LT YKW+L      K I C     K + LC+CDK+   C++     FN  HY      R  I+  N
Sbjct:    6 SIFIISICHDGCNGSLLELNNMLRKYLHINPGKLVGYGNYCGPGNNGKAPIDAIDMCCKIHDNCFGLWSEKYEDTKTYLTKYKWTLTMHGIKKFIVCGRQTRKKKDLCQCDKEFVICVKSKWHRFNHDHYSDTKNPRKFITSFN 149          
BLAST of Phospholipase A2 vs. Planmine SMEST
Match: SMESG000025979.1 (SMESG000025979.1)

HSP 1 Score: 96.2857 bits (238), Expect = 3.830e-25
Identity = 51/144 (35.42%), Postives = 75/144 (52.08%), Query Frame = 1
Query:  100 SLILVTIFLKASDGELAQFNLMVKYITGRNPGIFIGYGNYCGEGSLSGNPVDKIDECCKRHDECYDVFLKKY-NANPLLTVYKWSLA----GKEIWCKNNPVKLQTLCKCDKDIAYCLRDNLAHFNKGHYKRQNFQRAVISFLN 516
            S+ ++++     +G L + N M++     NPG  +GYGNYCG G+    P+D ID CCK HD C+ ++ +KY +    LT YKW+L      K I C +   K + LC CDK+   C++     FN  HY      R  I+  N
Sbjct:    6 SIFIISVCHDGCNGSLLELNNMLRKYLHINPGKLVGYGNYCGPGNNGKAPIDAIDMCCKIHDNCFGLWSEKYEDTKTYLTKYKWTLTMHGIKKFIVCGSQTRKKKDLCHCDKEFVICVKSKWHRFNHDHYSDTKNPRKFITSFN 149          
The following BLAST results are available for this feature:
BLAST of Phospholipase A2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLA2G2E2.874e-1835.71phospholipase A2 group IIE [Source:HGNC Symbol;Acc... [more]
PLA2G2A7.163e-1636.59phospholipase A2 group IIA [Source:HGNC Symbol;Acc... [more]
PLA2G2A7.163e-1636.59phospholipase A2 group IIA [Source:HGNC Symbol;Acc... [more]
PLA2G51.301e-1335.96phospholipase A2 group V [Source:HGNC Symbol;Acc:H... [more]
PLA2G2D1.395e-1333.59phospholipase A2 group IID [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Phospholipase A2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Y69A2AL.22.893e-830.91Phospholipase A(2) [Source:UniProtKB/TrEMBL;Acc:Q... [more]
C07E3.92.165e-634.94Phospholipase A(2) [Source:UniProtKB/TrEMBL;Acc:Q... [more]
back to top
BLAST of Phospholipase A2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phospholipase A2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pla2g1b2.860e-1030.50phospholipase A2, group IB (pancreas) [Source:ZFIN... [more]
zgc:921622.933e-930.83zgc:92162 [Source:ZFIN;Acc:ZDB-GENE-040718-41][more]
back to top
BLAST of Phospholipase A2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eml62.681e-1231.65echinoderm microtubule associated protein like 6 [... [more]
eml61.292e-1134.72echinoderm microtubule associated protein like 6 [... [more]
eml61.643e-1136.09echinoderm microtubule associated protein like 6 [... [more]
ENSXETT00000024628.13.807e-1136.71pep primary_assembly:Xenopus_tropicalis_v9.1:9:319... [more]
ENSXETT00000035968.14.049e-1140.26pep primary_assembly:Xenopus_tropicalis_v9.1:4:795... [more]
back to top
BLAST of Phospholipase A2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pla2g2e1.921e-1734.62phospholipase A2, group IIE [Source:MGI Symbol;Acc... [more]
Pla2g2e1.921e-1734.62phospholipase A2, group IIE [Source:MGI Symbol;Acc... [more]
Pla2g2d4.106e-1537.93phospholipase A2, group IID [Source:MGI Symbol;Acc... [more]
Pla2g2c6.986e-1530.16phospholipase A2, group IIC [Source:MGI Symbol;Acc... [more]
Pla2g2c6.986e-1530.16phospholipase A2, group IIC [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Phospholipase A2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2YHJ6|PA2AA_TRIPE2.861e-1837.01Acidic phospholipase A2 Tpu-E6a OS=Trimeresurus pu... [more]
sp|P0DPT9|PA23_SCODE3.806e-1837.32Phospholipase A2 SSD1043 OS=Scolopendra dehaani OX... [more]
sp|Q90Y77|PA2BY_PROFL9.198e-1836.59Basic phospholipase A2 PL-Y OS=Protobothrops flavo... [more]
sp|Q9NZK7|PA2GE_HUMAN1.380e-1735.71Group IIE secretory phospholipase A2 OS=Homo sapie... [more]
sp|Q800C2|PA2AG_CROVV1.436e-1735.94Acidic phospholipase A2 Cvv-E6g OS=Crotalus viridi... [more]
back to top
BLAST of Phospholipase A2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A140YIG33.022e-1733.85Basic phospholipase A2 OS=Echis carinatus OX=40353... [more]
A0A210Q6V21.431e-1637.50Phospholipase A(2) OS=Mizuhopecten yessoensis OX=6... [more]
A0A4U1FS191.930e-1637.93Phospholipase A(2) OS=Monodon monoceros OX=40151 G... [more]
A0A0L8IAV02.073e-1638.26Phospholipase A(2) OS=Octopus bimaculoides OX=3765... [more]
L5JRZ32.252e-1638.69Phospholipase A(2) OS=Pteropus alecto OX=9402 GN=P... [more]
back to top
BLAST of Phospholipase A2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000031293.11.607e-1133.33phospholipase A2-like [Source:NCBI gene;Acc:103028... [more]
ENSAMXT00000030049.11.804e-1135.92phospholipase A2-like [Source:NCBI gene;Acc:103028... [more]
zgc:921623.517e-1131.47phospholipase A2-like [Source:NCBI gene;Acc:103040... [more]
ENSAMXT00000000319.22.752e-1034.17phospholipase A2 [Source:NCBI gene;Acc:103024514][more]
ENSAMXT00000012624.22.628e-632.65phospholipase A2-like [Source:NCBI gene;Acc:103028... [more]
back to top
BLAST of Phospholipase A2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008209.13.142e-1638.18pep scaffold:Pmarinus_7.0:GL476891:251313:253691:-... [more]
ENSPMAT00000008463.13.645e-1433.58pep scaffold:Pmarinus_7.0:GL483377:12502:14271:-1 ... [more]
ENSPMAT00000008454.12.940e-1233.61pep scaffold:Pmarinus_7.0:GL483377:2289:3737:-1 ge... [more]
ENSPMAT00000008226.11.518e-1130.00pep scaffold:Pmarinus_7.0:GL476891:263168:265744:1... [more]
ENSPMAT00000008199.11.815e-1032.00pep scaffold:Pmarinus_7.0:GL476891:241341:242643:-... [more]
back to top
BLAST of Phospholipase A2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phospholipase A2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO435048.575e-1637.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO407203.489e-1436.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409901.444e-1131.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO281799.447e-1138.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO435031.706e-933.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phospholipase A2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
zgc:921624.838e-1036.63phospholipase A2 [Source:NCBI gene;Acc:101170929][more]
ENSORLT00000032129.15.591e-1030.16phospholipase A2 group IB [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Phospholipase A2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000075160.16.745e-12098.80SMESG000075160.1[more]
SMESG000079712.12.344e-4744.59SMESG000079712.1[more]
SMESG000079712.14.082e-4445.19SMESG000079712.1[more]
SMESG000025902.11.831e-2536.11SMESG000025902.1[more]
SMESG000025979.13.830e-2535.42SMESG000025979.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011343 ID=SMED30011343|Name=Phospholipase A2|organism=Schmidtea mediterranea sexual|type=transcript|length=608bp
ATCTGTTTTTATAAACTGTTGACAAAATAAAACAATTATTATTTTTGGAA
TAGAATCTGCAAAATAAAGATGCTGAAGTACGACAAAATTCTATACGGAA
GCCTTATTTTGGTTACAATTTTCCTGAAGGCATCTGACGGAGAATTAGCC
CAATTCAACCTAATGGTCAAATACATCACTGGGCGTAATCCGGGAATCTT
TATTGGCTATGGGAATTATTGTGGAGAGGGAAGTCTAAGTGGAAATCCAG
TGGACAAAATTGATGAATGTTGCAAGCGTCATGATGAATGCTATGACGTT
TTCTTGAAGAAATATAATGCAAATCCTTTACTAACGGTTTATAAGTGGAG
TTTAGCTGGGAAAGAAATTTGGTGTAAAAATAATCCAGTGAAACTTCAGA
CTCTCTGCAAATGTGATAAAGATATAGCCTATTGCTTAAGAGACAATTTA
GCTCATTTCAACAAGGGACATTATAAAAGGCAAAACTTTCAAAGAGCGGT
CATCTCCTTTTTAAATACTCTCAAAAAAAAATCTTATTCACAAAAACAAA
AGATGTTCATAAACTATTAACAGTAATATTTGTATTTCAATAAAATATTT
TGTATCTT
back to top

protein sequence of SMED30011343-orf-1

>SMED30011343-orf-1 ID=SMED30011343-orf-1|Name=SMED30011343-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=167bp
MLKYDKILYGSLILVTIFLKASDGELAQFNLMVKYITGRNPGIFIGYGNY
CGEGSLSGNPVDKIDECCKRHDECYDVFLKKYNANPLLTVYKWSLAGKEI
WCKNNPVKLQTLCKCDKDIAYCLRDNLAHFNKGHYKRQNFQRAVISFLNT
LKKKSYSQKQKMFINY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR036444PLipase_A2_dom_sf
IPR001211PLipase_A2
IPR016090PLipase_A2_dom
IPR033113PLipase_A2_His_AS
IPR033112PLipase_A2_Asp_AS
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
GO:0004623phospholipase A2 activity
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0016042lipid catabolic process
GO:0006629lipid metabolic process
GO:0006644phospholipid metabolic process
GO:0050482arachidonic acid secretion
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 156..166
NoneNo IPR availablePANTHERPTHR11716:SF84PHOSPHOLIPASE A2coord: 17..141
IPR001211Phospholipase A2PRINTSPR00389PHPHLIPASEA2coord: 26..36
score: 35.19
coord: 60..78
score: 51.04
coord: 108..124
score: 34.87
coord: 90..104
score: 25.18
IPR001211Phospholipase A2PANTHERPTHR11716PHOSPHOLIPASE A2 FAMILY MEMBERcoord: 17..141
IPR016090Phospholipase A2 domainSMARTSM00085PA-fincoord: 25..141
e-value: 1.3E-23
score: 94.5
IPR016090Phospholipase A2 domainPFAMPF00068Phospholip_A2_1coord: 26..134
e-value: 4.4E-26
score: 91.5
IPR016090Phospholipase A2 domainCDDcd00125PLA2ccoord: 26..140
e-value: 9.01184E-29
score: 100.787
IPR036444Phospholipase A2 domain superfamilyGENE3DG3DSA:1.20.90.10coord: 25..147
e-value: 1.6E-29
score: 104.5
IPR036444Phospholipase A2 domain superfamilySUPERFAMILYSSF48619Phospholipase A2, PLA2coord: 26..141
IPR033112Phospholipase A2, aspartic acid active sitePROSITEPS00119PA2_ASPcoord: 112..122
IPR033113Phospholipase A2, histidine active sitePROSITEPS00118PA2_HIScoord: 67..74