Dynein heavy chain 10, axonemal

Overview
NameDynein heavy chain 10, axonemal
Smed IDSMED30011335
Uniprot Best hitDynein heavy chain 10, axonemal OS=Homo sapiens OX=9606 GN=DNAH10 PE=1 SV=4 (E=0)
Length (bp)13971
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dynein heavy chain 10, axonemal (SMED30011335) t-SNE clustered cells

Violin plots show distribution of expression levels for Dynein heavy chain 10, axonemal (SMED30011335) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dynein heavy chain 10, axonemal (SMED30011335) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dynein heavy chain 10, axonemal (SMED30011335) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011335

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 25

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30011335SMESG000051829.1 SmedASXL_002128SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30011335SMESG000051829.1 SmedASXL_019448SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30011335SMESG000051829.1 SmedASXL_007640SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30011335SMESG000051829.1 SmedASXL_000471SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30011335SMESG000051829.1 SmedASXL_000424SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30011335SMESG000051829.1 SmedASXL_018506SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30011335SMESG000051829.1 dd_Smed_v4_12797_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30011335SMESG000051829.1 dd_Smed_v4_12797_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30011335SMESG000051829.1 dd_Smed_v4_12797_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30011335SMESG000051829.1 dd_Smed_v4_12797_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30011335SMESG000051829.1 dd_Smed_v4_12797_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30011335SMESG000051829.1 dd_Smed_v4_5169_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30011335SMESG000051829.1 dd_Smed_v4_5169_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30011335SMESG000051829.1 dd_Smed_v4_5169_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30011335SMESG000051829.1 dd_Smed_v4_5169_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30011335SMESG000051829.1 dd_Smed_v4_5169_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30011335SMESG000051829.1 dd_Smed_v6_5169_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30011335SMESG000051829.1 dd_Smed_v4_12797_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30011335SMESG000051829.1 dd_Smed_v4_12797_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30011335SMESG000051829.1 dd_Smed_v4_12797_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30011335SMESG000051829.1 dd_Smed_v4_12797_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011335SMESG000051829.1 dd_Smed_v4_5169_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30011335SMESG000051829.1 dd_Smed_v4_5169_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30011335SMESG000051829.1 dd_Smed_v4_5169_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30011335SMESG000051829.1 dd_Smed_v4_5169_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Human
Match: DNAH10 (dynein axonemal heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:2941])

HSP 1 Score: 5362.73 bits (13910), Expect = 0.000e+0
Identity = 2695/4476 (60.21%), Postives = 3400/4476 (75.96%), Query Frame = 1
Query:  538 LQMARTPLVNA--EDTLCFFLVRTTDDMVVLPSNINEANSELPSYFESGTLKGDMLLLLSQLIHSVYDYMLSYHQHRVTSDLGMSRASTPASQGRIPKKSQSDGDKIESIDEKVHETRAAVQARDEFLISLKKFTSIVDQTIIQIASEVKLEIPDLDLFENDKENLSDKEIMEMIESTVLKWDQQITGTLESLQKIVPHGPSPLAEIDFWRERNAXXXXXXXXXXXPKVKRILNLYSLAEG-------PVFDTQNNELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIAWNLSDRVARLIDVNTIFNLPLEHVLKDTAEAEKMLRVWNDTYFEVRASIEASGRDARWEFDRKRLFEKTNYMADICHDLNEIAMILQEFYNIFGPELKSVTNEAKRIXXXXXXXXXXXXPLKEMPFNPFNLMKHKYDWSNFMEDFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEVESIDQLFKTNMNNPPLYHFKSCVAGGISWERHLFYNIKRPILRFLTMDEMMQSDNGKRIRTKYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILALANSENFVSENVPEETIDKMDDDLRVDFGFEINEIITETRNLELLGYKVPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISDYIEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFKL---QSGNKFLKCKEFFEFMESERTSDFEHLGRKYSTIGPLITKLQGEIIGDRDVNPFEKFQPFYEFWEKRIFDRVYNMVLKNLQDYQNMLRDENFPTCLFEVDLMLAGTDVIGNPQTTEIYKLAIQDLRDAVEATRVFIRWKRNSCIETTGMKIDGQDELFYFTFYLDIGNSVEITYFCEQIANYYRNIIGKLRKYQDKWKKHKRVFIPNKQAQIDKWLTKDPTVMDFYERIRDTIDRKEELLNQPVIRKIGFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDLSLIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSN-HPIDQEEIEESDKLRQLFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTREGMNQDTIEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSENAKSDKDYAMTDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKRKKPYLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLTKPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTGKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGEPNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMGVGLVVEADLATTEHPSHWVLQGVCLILNTD 13926
            L M  TPL     +  + FFL R T + +   +++ EA   +P   E G +  ++L  L  +I  V+   LS++QHR ++ +G++        G +   S+ + D      E V E  +    RDEFL++++KF S + +T+ Q+  E+KLE+P + +     +  +D E ++++E  V+ W  QI+  +E+  K  P G  PLAEI+FWRERNA LSAL EQ KLP V+++L++   ++        PVF     EL KFH EA DN +FLS VER+FK+I +G  F  V D+IP MM ALRM+WIISRHYNKDERM+PLMERIAW +++RV R++++ T+F          T EA   LR+W   YF+ RA IEASGR+ RWEFDRKRLFE+T+YMA IC DL+++  IL+EFYNIFGPELK+VT + KRI++VL +V+ LV P++ + F+PF++   ++ W   M++F+ +V+ IE +A  FI+  F TLRSAE AFDMLL+F+HIRSR+A+N+ M  KFNDI++QY KE++ I+++F  N+ NPPLY     VAG I WER LF+ IK  ILRF  + E++ SD G+ ++ KYL VGRTM+ +E++++ +W    ++VL  L++K++L    +++ ++   P  T+++      ++F   + EII ET+ LE LG+ VPELARNVALQ++ + +   G+  M+  YH +I +L   E  +L D  +E+ R  R G +RLNWNSLGI DYI  C  A+  FES V  IHK   DI  +L  I+   LFK    +S  +    KEFFE +E ER SD +H+ R Y  IGPL+TK++G ++   +     K   +Y++WEK+I++ +  ++LKNLQ + +++   N P  LF  + +L   ++I +P T EI K+    +R+ VE T+ F+RW   SCIE    K + ++E+    FY DI  + +I      I      I+  L KY  KWK+++ ++  +K   ++K+  K P  + + E+++       E++  P+I+    I + L+ L + V+++ K W       L+ESAK  L ++  ++E    +L  IP  LE+LK +L+TI  I+  SL  E R  DVQERYR + + N  P D E+ E  DK+  ++ +L  +S NV + L  +K  FT++T+ EI ++   ++ FA +F  EGPGS+G DLD G+ +L  +  EL   E  RQEL  AE+LF+LPIT YPEL  VQKEM  L  IYELY+  K A+E W++TLW NL++++L EGIEGFL+  RK+PR V+ +     L  K+K FKD++PL  DLK+EALR+RHWKELM KT   F++  +TFTL ++FAMEL++  DV+ EIVT+A KE++IEK V+E+ +TW  +KF+V  Y KG +ERGYILG++DE++Q LDDN  NLQS+S SRF+GPFL +V  WEK LSLI EV+++WM+VQRKWMYLE IFIGGDIRSQLPEEAKKFD IDK FK+IM ET K P+IK+ C+ PNRLSDL N+S+GLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSD  CVQEHMIKM+DNI+SLRF  G S E   +AMIS+E E+MEFR  +  EGRVEDWMT +  EMRRTNR+ITKEA+F Y E + RV WM  YQGMV L  +Q+WWTWEVEDVF K +KG+K A+K+Y + +H QIDE+V  +  PLSKNDR K  TVLIIDVHARDIVDSF+R SI++A+EF+WESQLRFYW RE DE+ I+QCTG FGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDYR+VGKIF+GL QCGAWGCFDEFNRI+ SVLSVIS+Q++TI+N LI +L+ F FEGQEI LDSR+GIFITMNPGYAGRTELPESVKA FRPVVVIVPDLQQICEIMLFS+GFL AK LAKKMT LY+L++EQLSKQ HYDFGLRALKSVLVMAGEL+R   DL ED VLMRALRDMNLPKF+FED PLFLGLI DLFPGLDCPRVRYPDFND+VE+ L E+ Y VL  Q DK+VQ++ETM TRHTTMVVGPT GGKSVVI  LC +QTKL L TKL  +NPK  SVIELYGILDP TRDWTDG+LSNIFREINKPTDK ER+Y+LFDGDVDALWVENMNSVMDDN+LLTLANGERIRLQ HCALLFEVGDLQYASPATVSRCGMVYVDPKNL Y P+W+ W+N+  NK E   L  L++KY+P  +D ++EG+++G+  EKLKTI+P T+LN+VTQL  MLD  L  E  + D +E  F++++Y SLG  L+ED ++KFD++IK L ++   + E   A  GELP + PTL+D++FD+  ++ +W+PW+ LVP+Y+H PE+KF  ILV T+DT R TW+L + +KI++PV+ VGE+GTSKTA +Q FL+N   +  I L +NFSSRTTS+DIQRNLE+NVEKRTKD+YGPPMGKRLLVF+DDMNMP+VD+YGTQQPIA+LKL+LE+   YDRGK+LN K ++D+GF+AAMGK GGGRN+VDPRFISLFSVFN  FPS+ SL  IYSSIL GH   F + I      +T  T+ +Y  I+  LPPTPSKFHYIFNLRDLSR++ G+  T  +RF    Q  RVWR+E  RV  DRLI++ DK  VQ+ I   + E+ K D +  M DPILFGD++ AL   E R+YED+ +YEAAK LFQEI+EEY+E+ + M LVLFDDAL+HLTR+HR IRMD GHALLVGVGGSGKQSL++LAA+T SC++FEI LSRGYSE   RE+LK+LY KLGIENK+ +F+F D HV EEGFLELINNML+SGIVPALF ++E+E+I+SQ+  EA   GMGP+KES+WQYFVNK A+NLHIVL MSPVG+TLRT CRNFPG+VNNT IDWF PWP QAL+AVA  F+G  N +IP +    +VKH V+VH SV+ YS++F+QK RR NYVTPKNYLDFINTY KLL++K +   +QC RL GGL KL EA++QL ELN KLA QK+ + EK+ ACE LL+EI   T +A EKK++A+EK+  +E Q+K I  EK EAE  L E +P+LE A+L L  L+K+DV EIRSFAKPPK VQ V ECI + K YKE+NWK AKG+M+DP+FL+SL  +D D+IT  Q   ++  L  L  T +EM +VSKAG G+LKFV AV+GY DV REIKPKREKVARLE+ F   KRELE+++NE+  ++ EL+ L  +YE AI E+Q+LQEE +IM+RRL AADKLI+GL SEN RWL DL  L  ++V+LLGDCL+C+AFLSY GAF+WEFR EMV   W++D++ER+IP+S PFRLE +LT+DVEIS+W S+GLPPDELS+QNGILTTRASRFPLCIDPQQQALNWI +KEE NNL+ A+FNDPDFLKQLE++IKYG PFLF+DVDEYIDPVIDNVLEKNIK  QGR+F+ILGDKEVD+D NFRLYLNTKL+NP+Y P++FGK+MVINYTVTLKGLEDQLLSV+V +ER+ELEEQRE LIQETS+NK LLKDLEDSLLRELATSTGNMLDN +L++TLEETKSKA+EVSEKLKL  +T+ +ID+ RDGYR AA+RGAILFFVL+EM+ +NSMYQYSL A+L+VF+ SLKKSLPD  L KRL+N+M TLT ++Y +GCTG+FE+HKLLF+F +T+K+E  +G + Q+ELDFF+KGN S+E +KRKKP  WLSD  W+D+  L+EM    F  L +D+E ++  W++W + ++ E   +P  Y N +  FQKL +LRCFR+DR+YRA+T YV   MGE+YV PP+++FE I +QSTP SPIVFILSPGSDPA+D++KLAERSGFG  +LKF++MGQGQE  A  LL+ A+ARG WL+LQNCHLLVKWL++LEK LER+TKPHPDFRLWLTT+PT+ FPIGILQ+SLKVVTEPPNGLKLN+R+TY KI+   L+   H AF  LV+ LAFFHAVVQERRK+GKIGWN+ YDFNESDF+VC++IL TYL KA  Q D +IPWGSLKYLIGEVMYGGRAID FDRRIL  YMDEY GDF+FDTFQPFHF+ +K   Y IP  D  +  ++ IE+LPL NTPEVFGLH NAEIGYYT AA++MW+ L+++QPQTG+S S  SRD+ I + A  I++K+PK+FDLD++RK+ G  +SPT VVLLQELERFN LV RMTKSL  L RAL GEVGMS ELDDVA+SL+ G IP IW+RLAPDTLKSL NW+ +F  R++QY  WV   EP+VMWLSGLHIPESYLTALVQATCRKNGWPLD+STL+T VT+F  A EV ERA QGCFV GLYLEGA WD  + CL++ KPK L+  LP++K+IPIEAHRLK QNTF TPVY TS RRNAMGVGLV EADL TT H SHWVLQGVCL LN+D
Sbjct:  144 LHMLCTPLPEEFLDQNVVFFL-RNTKEAISEATDMKEAMEIMPETLEYGIINANVLHFLKNIICQVFLPALSFNQHRTSTTVGVT-------SGEVSNSSEHESDLPPMPGEAV-EYHSIQLIRDEFLMNVQKFASNIQRTMQQLEGEIKLEMPIISVEGEVSDLAADPETVDILEQCVINWLNQISTAVEAQLKKTPQGKGPLAEIEFWRERNATLSALHEQTKLPIVRKVLDVIKESDSMLVANLQPVF----TELFKFHTEASDNVRFLSTVERYFKNITHGSGFHVVLDTIPAMMSALRMVWIISRHYNKDERMIPLMERIAWEIAERVCRVVNLRTLFKENRASAQSKTLEARNTLRLWKKAYFDTRAKIEASGREDRWEFDRKRLFERTDYMATICQDLSDVLQILEEFYNIFGPELKAVTGDPKRIDDVLCRVDGLVTPMENLTFDPFSIKSSQF-WKYVMDEFKIEVLVIEKEAKHFIDESFKTLRSAEAAFDMLLKFKHIRSREAVNRQMMMKFNDILAQYCKEIDIINKIFVQNLENPPLYKNHPPVAGAIYWERSLFFRIKHTILRFQEVQEILDSDRGQEVKQKYLEVGRTMKEYEDRKYEQWMEVTEQVLPALMKKSLL----TKSSIATEEPS-TLER-GAVFAINFSPALREIINETKYLEQLGFTVPELARNVALQEDKFLRYTAGIQRMLDHYHMLIGTLNDAESVLLKDHSQELLRVFRSGYKRLNWNSLGIGDYITGCKQAIGKFESLVHQIHKNADDISSRLTLIEAINLFKYPAAKSEEELPGVKEFFEHIERERASDVDHMVRWYLAIGPLLTKVEGLVV-HTNTGKAPKLASYYKYWEKKIYEVLTKLILKNLQSFNSLILG-NVP--LFHTETILTAPEIILHPNTNEIDKMCFHCVRNCVEITKHFVRWMNGSCIECPPQKGE-EEEVVIINFYNDISLNPQIIEQAVMIPQNVHRILINLMKYLQKWKRYRPLWKLDKAIVMEKFAAKKPPCVAYDEKLQFYSKIAYEVMRHPLIKDEHCIRLQLRHLANTVQENAKSWVISLGKLLNESAKEELYNLHEEMEHLAKNLRKIPNTLEDLKFVLATIAEIRSKSLVMELRYRDVQERYRTMAMYNLFPPDAEK-ELVDKIESIWSNLFNDSVNVEHALGDIKRTFTELTRGEIMNYRVQIEEFAKRFYSEGPGSVGDDLDKGVELLGVYERELARHEKSRQELANAEKLFDLPITMYPELLKVQKEMSGLRMIYELYEGLKVAKEEWSQTLWINLNVQILQEGIEGFLRALRKLPRPVRGLSVTYYLEAKMKAFKDSIPLLLDLKNEALRDRHWKELMEKTSVFFEMT-ETFTLENMFAMELHKHTDVLNEIVTAAIKEVAIEKAVKEILDTWENMKFTVVKYCKGTQERGYILGSVDEIIQSLDDNTFNLQSISGSRFVGPFLQTVHKWEKTLSLIGEVIEIWMLVQRKWMYLESIFIGGDIRSQLPEEAKKFDNIDKVFKRIMGETLKDPVIKRCCEAPNRLSDLQNVSEGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDPLCVQEHMIKMYDNIASLRFNDGDSGEKLVSAMISAEGEVMEFRKILRAEGRVEDWMTAVLNEMRRTNRLITKEAIFRYCEDRSRVDWMLLYQGMVVLAASQVWWTWEVEDVFHKAQKGEKQAMKNYGRKMHRQIDELVTRITMPLSKNDRKKYNTVLIIDVHARDIVDSFIRGSILEAREFDWESQLRFYWDREPDELNIRQCTGTFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDYRAVGKIFSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALIHQLTTFQFEGQEISLDSRMGIFITMNPGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLEAKTLAKKMTVLYKLAREQLSKQYHYDFGLRALKSVLVMAGELKRGSSDLREDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRVRYPDFNDAVEQVLEENGYAVLPIQVDKVVQMFETMLTRHTTMVVGPTRGGKSVVINTLCQAQTKLGLTTKLYILNPKAVSVIELYGILDPTTRDWTDGVLSNIFREINKPTDKKERKYILFDGDVDALWVENMNSVMDDNRLLTLANGERIRLQAHCALLFEVGDLQYASPATVSRCGMVYVDPKNLKYRPYWKKWVNQIPNKVEQYNLNSLFEKYVPYLMDVIVEGIVDGRQAEKLKTIVPQTDLNMVTQLAKMLDALLEGEIEDLDLLECYFLEALYCSLGASLLEDGRMKFDEYIKRLASLSTVDTEGVWANPGELPGQLPTLYDFHFDN--KRNQWVPWSKLVPEYIHAPERKFINILVHTVDTTRTTWILEQMVKIKQPVIFVGESGTSKTATTQNFLKNLSEETNIVLMVNFSSRTTSMDIQRNLEANVEKRTKDTYGPPMGKRLLVFMDDMNMPRVDEYGTQQPIALLKLLLEKGYLYDRGKELNCKSIRDLGFIAAMGKAGGGRNEVDPRFISLFSVFNVPFPSEESLHLIYSSILKGHTSTFHESIVAVSGKLTFCTLALYKNIVQDLPPTPSKFHYIFNLRDLSRVFNGLVLTNPERFQTVAQMVRVWRNECLRVFHDRLISETDKQLVQQHIGSLVVEHFKDDVEVVMRDPILFGDFQMALHEGEPRIYEDIQDYEAAKALFQEILEEYNESNTKMNLVLFDDALEHLTRVHRIIRMDRGHALLVGVGGSGKQSLSRLAAFTASCEVFEILLSRGYSENSFREDLKSLYLKLGIENKAMIFLFTDAHVAEEGFLELINNMLTSGIVPALFSEEEKESILSQIGQEALKQGMGPAKESVWQYFVNKSANNLHIVLGMSPVGDTLRTWCRNFPGMVNNTGIDWFMPWPPQALHAVAKSFLG-YNPMIPAENIENVVKHVVLVHQSVDHYSQQFLQKLRRSNYVTPKNYLDFINTYSKLLDEKTQCNIAQCKRLDGGLDKLKEATIQLDELNQKLAEQKIVLAEKSAACEALLEEIAVNTAVAEEKKKLAEEKAMEIEEQNKVIAMEKAEAETTLAEVMPILEAAKLELQKLDKSDVTEIRSFAKPPKQVQTVCECILIMKGYKELNWKTAKGVMSDPNFLRSLMEIDFDSITQSQVKNIKGLLKTLNTTTEEMEAVSKAGLGMLKFVEAVMGYCDVFREIKPKREKVARLERNFYLTKRELERIQNELAAIQKELETLGAKYEAAILEKQKLQEEAEIMERRLIAADKLISGLGSENIRWLNDLDELMHRRVKLLGDCLLCAAFLSYEGAFTWEFRDEMVNRIWQNDILEREIPLSQPFRLESLLTDDVEISRWGSQGLPPDELSVQNGILTTRASRFPLCIDPQQQALNWIKRKEEKNNLRVASFNDPDFLKQLEMSIKYGTPFLFRDVDEYIDPVIDNVLEKNIKVSQGRQFIILGDKEVDYDSNFRLYLNTKLANPRYSPSVFGKAMVINYTVTLKGLEDQLLSVLVAYERRELEEQREHLIQETSENKNLLKDLEDSLLRELATSTGNMLDNVDLVHTLEETKSKATEVSEKLKLAEKTALDIDRLRDGYRPAARRGAILFFVLSEMALVNSMYQYSLIAFLEVFRLSLKKSLPDSILMKRLRNIMDTLTFSIYNHGCTGLFERHKLLFSFNMTIKIEQAEGRVPQEELDFFLKGNISLEKSKRKKPCAWLSDQGWEDIILLSEMFSDNFGQLPDDVENNQTVWQEWYDLDSLEQFPVPLGYDNNITPFQKLLILRCFRVDRVYRAVTDYVTVTMGEKYVQPPMISFEAIFEQSTPHSPIVFILSPGSDPATDLMKLAERSGFGGNRLKFLAMGQGQEKVALQLLETAVARGQWLMLQNCHLLVKWLKDLEKSLERITKPHPDFRLWLTTDPTKGFPIGILQKSLKVVTEPPNGLKLNMRATYFKISHEMLDQCPHPAFKPLVYVLAFFHAVVQERRKFGKIGWNVYYDFNESDFQVCMEILNTYLTKAFQQRDPRIPWGSLKYLIGEVMYGGRAIDSFDRRILTIYMDEYLGDFIFDTFQPFHFFRNKEVDYKIPVGDEKEKFVEAIEALPLANTPEVFGLHPNAEIGYYTQAARDMWAHLLELQPQTGESSSGISRDDYIGQVAKEIENKMPKVFDLDQVRKRLGTGLSPTSVVLLQELERFNKLVVRMTKSLAELQRALAGEVGMSNELDDVARSLFIGHIPNIWRRLAPDTLKSLGNWMVYFLRRFSQYMLWVTESEPSVMWLSGLHIPESYLTALVQATCRKNGWPLDRSTLFTQVTKFQDADEVNERAGQGCFVSGLYLEGADWDIEKGCLIKSKPKVLVVDLPILKIIPIEAHRLKLQNTFRTPVYTTSMRRNAMGVGLVFEADLFTTRHISHWVLQGVCLTLNSD 4589          

HSP 2 Score: 56.6102 bits (135), Expect = 1.647e-6
Identity = 20/57 (35.09%), Postives = 40/57 (70.18%), Query Frame = 1
Query:   46 MDDIRIVWIKNQLYNCLDITDDSIFEDFIDREDGENERALATYLNETQDEQHQAIIF 216
            MDD+R++W+++++Y    ITD  +FED ++R+DG+ E  +  +LN+  +E+  + +F
Sbjct:    1 MDDLRVLWMRDRVYAAFGITDPQLFEDLLNRDDGQGEDLILHFLNQASEEEGPSALF 57          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Human
Match: DNAH10 (dynein axonemal heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:2941])

HSP 1 Score: 5271.44 bits (13673), Expect = 0.000e+0
Identity = 2662/4476 (59.47%), Postives = 3353/4476 (74.91%), Query Frame = 1
Query:  538 LQMARTPLVNA--EDTLCFFLVRTTDDMVVLPSNINEANSELPSYFESGTLKGDMLLLLSQLIHSVYDYMLSYHQHRVTSDLGMSRASTPASQGRIPKKSQSDGDKIESIDEKVHETRAAVQARDEFLISLKKFTSIVDQTIIQIASEVKLEIPDLDLFENDKENLSDKEIMEMIESTVLKWDQQITGTLESLQKIVPHGPSPLAEIDFWRERNAXXXXXXXXXXXPKVKRILNLYSLAEG-------PVFDTQNNELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIAWNLSDRVARLIDVNTIFNLPLEHVLKDTAEAEKMLRVWNDTYFEVRASIEASGRDARWEFDRKRLFEKTNYMADICHDLNEIAMILQEFYNIFGPELKSVTNEAKRIXXXXXXXXXXXXPLKEMPFNPFNLMKHKYDWSNFMEDFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEVESIDQLFKTNMNNPPLYHFKSCVAGGISWERHLFYNIKRPILRFLTMDEMMQSDNGKRIRTKYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILALANSENFVSENVPEETIDKMDDDLRVDFGFEINEIITETRNLELLGYKVPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISDYIEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFKL---QSGNKFLKCKEFFEFMESERTSDFEHLGRKYSTIGPLITKLQGEIIGDRDVNPFEKFQPFYEFWEKRIFDRVYNMVLKNLQDYQNMLRDENFPTCLFEVDLMLAGTDVIGNPQTTEIYKLAIQDLRDAVEATRVFIRWKRNSCIETTGMKIDGQDELFYFTFYLDIGNSVEITYFCEQIANYYRNIIGKLRKYQDKWKKHKRVFIPNKQAQIDKWLTKDPTVMDFYERIRDTIDRKEELLNQPVIRKIGFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDLSLIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSN-HPIDQEEIEESDKLRQLFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTREGMNQDTIEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSENAKSDKDYAMTDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKRKKPYLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLTKPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTGKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGEPNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMGVGLVVEADLATTEHPSHWVLQGVCLILNTD 13926
            L M  TPL     +  + FFL R T + +   +++ EA   +P   E G +  ++L  L  +I  V+   LS++QHR ++ +G++        G +   S+ + D      E V E  +    RDEFL++++KF S + +T+ Q+  E+KLE+P + +     +  +D E ++++E  V+ W  QI+  +E+  K  P G  PLAEI+FWRERNA LSAL EQ KLP V+++L++   ++        PVF     EL KFH EA DN +FLS VER+FK+I +G  F  V D+IP MM ALRM+WIISRHYNKDERM+PLMERIAW +++RV R++++ T+F          T EA   LR+W   YF+ RA IEASGR+ RWEFDRKRLFE+T+YMA IC DL+++  IL+EFYNIFGPELK+VT + KRI++VL +V+ LV P++ + F+PF++   ++ W   M++F+ +V+      ID IN  F                                                     N+ NPPLY     VAG I WER LF+ IK  ILRF  + E++ SD G+ ++ KYL VGRTM+ +E++++ +W    ++VL  L++K++L    +++ ++   P  T+++      ++F   + EII ET+ LE LG+ VPELARNVALQ++ + +   G+  M+  YH +I +L   E  +L D  +E+ R  R G +RLNWNSLGI DYI  C  A+  FES V  IHK   DI  +L  I+   LFK    +S  +    KEFFE +E ER SD +H+ R Y  IGPL+TK++G ++   +     K   +Y++WEK+I++ +  ++LKNLQ + +++   N P  LF  + +L   ++I +P T EI K+    +R+ VE T+ F+RW   SCIE    K + ++E+    FY DI  + +I      I      I+  L KY  KWK+++ ++  +K   ++K+  K P  + + E+++       E++  P+I+    I + L+ L + V+++ K W       L+ESAK  L ++  ++E    +L  IP  LE+LK +L+TI  I+  SL  E R  DVQERYR + + N  P D E+ E  DK+  ++ +L  +S NV + L  +K  FT++T+ EI ++   ++ FA +F  EGPGS+G DLD G+ +L  +  EL   E  RQEL  AE+LF+LPIT YPEL  VQKEM  L  IYELY+  K A+E W++TLW NL++++L EGIEGFL+  RK+PR V+ +     L  K+K FKD++PL  DLK+EALR+RHWKELM KT   F++  +TFTL ++FAMEL++  DV+ EIVT+A KE++IEK V+E+ +TW  +KF+V  Y KG +ERGYILG++DE++Q LDDN  NLQS+S SRF+GPFL +V  WEK LSLI EV+++WM+VQRKWMYLE IFIGGDIRSQLPEEAKKFD IDK FK+IM ET K P+IK+ C+ PNRLSDL N+S+GLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSD  CVQEHMIKM+DNI+SLRF  G S E   +AMIS+E E+MEFR  +  EGRVEDWMT +  EMRRTNR+ITKEA+F Y E + RV WM  YQGMV L  +Q+WWTWEVEDVF K +KG+K A+K+Y + +H QIDE+V  +  PLSKNDR K  TVLIIDVHARDIVDSF+R SI++A+EF+WESQLRFYW RE DE+ I+QCTG FGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDYR+VGKIF+GL QCGAWGCFDEFNRI+ SVLSVIS+Q++TI+N LI +L+ F FEGQEI LDSR+GIFITMNPGYAGRTELPESVKA FRPVVVIVPDLQQICEIMLFS+GFL AK LAKKMT LY+L++EQLSKQ HYDFGLRALKSVLVMAGEL+R   DL ED VLMRALRDMNLPKF+FED PLFLGLI DLFPGLDCPRVRYPDFND+VE+ L E+ Y VL  Q DK+VQ++ETM TRHTTMVVGPT GGKSVVI  LC +QTKL L TKL  +NPK  SVIELYGILDP TRDWTDG+LSNIFREINKPTDK ER+Y+LFDGDVDALWVENMNSVMDDN+LLTLANGERIRLQ HCALLFEVGDLQYASPATVSRCGMVYVDPKNL Y P+W+ W+N+  NK E   L  L++KY+P  +D ++EG+++G+  EKLKTI+P T+LN+VTQL  MLD  L  E  + D +E  F++++Y SLG  L+ED ++KFD++IK L ++   + E   A  GELP + PTL+D++FD+  ++ +W+PW+ LVP+Y+H PE+KF  ILV T+DT R TW+L + +KI++PV+ VGE+GTSKTA +Q FL+N   +  I L +NFSSRTTS+DIQRNLE+NVEKRTKD+YGPPMGKRLLVF+DDMNMP+VD+YGTQQPIA+LKL+LE+   YDRGK+LN K ++D+GF+AAMGK GGGRN+VDPRFISLFSVFN  FPS+ SL  IYSSIL GH   F + I      +T  T+ +Y  I+  LPPTPSKFHYIFNLRDLSR++ G+  T  +RF    Q  RVWR+E  RV  DRLI++ DK  VQ+ I   + E+ K D +  M DPILFGD++ AL   E R+YED+ +YEAAK LFQEI+EEY+E+ + M LVLFDDAL+HLTR+HR IRMD GHALLVGVGGSGKQSL++LAA+T SC++FEI LSRGYSE   RE+LK+LY KLGIENK+ +F+F D HV EEGFLELINNML+SGIVPALF ++E+E+I+SQ+  EA   GMGP+KES+WQYFVNK A+NLHIVL MSPVG+TLRT CRNFPG+VNNT IDWF PWP QAL+AVA  F+G  N +IP +    +VKH V+VH SV+ YS++F+QK RR NYVTPKNYLDFINTY KLL++K +   +QC RL GGL KL EA++QL ELN KLA QK+ + EK+ ACE LL+EI   T +A EKK++A+EK+  +E Q+K I  EK EAE  L E +P+LE A+L L  L+K+DV EIRSFAKPPK VQ V ECI + K YKE+NWK AKG+M+DP+FL+SL  +D D+IT  Q   ++  L  L  T +EM +VSKAG G+LKFV AV+GY DV REIKPKREKVARLE+ F   KRELE+++NE+  ++ EL+ L  +YE AI E+Q+LQEE +IM+RRL AADKLI+GL SEN RWL DL  L  ++V+LLGDCL+C+AFLSY GAF+WEFR EMV   W++D++ER+IP+S PFRLE +LT+DVEIS+W S+GLPPDELS+QNGILTTRASRFPLCIDPQQQALNWI +KEE NNL+ A+FNDPDFLKQLE++IKYG PFLF+DVDEYIDPVIDNVLEKNIK  QGR+F+ILGDKEVD+D NFRLYLNTKL+NP+Y P++FGK+MVINYTVTLKGLEDQLLSV+V +ER+ELEEQRE LIQETS+NK LLKDLEDSLLRELATSTGNMLDN +L++TLEETKSKA+EVSEKLKL  +T+ +ID+ RDGYR AA+RGAILFFVL+EM+ +NSMYQYSL A+L+VF+ SLKKSLPD  L KRL+N+M TLT ++Y +GCTG+FE+HKLLF+F +T+K+E  +G + Q+ELDFF+KGN S+E +KRKKP  WLSD  W+D+  L+EM    F  L +D+E ++  W++W + ++ E   +P  Y N +  FQKL +LRCFR+DR+YRA+T YV   MGE+YV PP+++FE I +QSTP SPIVFILSPGSDPA+D++KLAERSGFG  +LKF++MGQGQE  A  LL+ A+ARG WL+LQNCHLLVKWL++LEK LER+TKPHPDFRLWLTT+PT+ FPIGILQ+SLKVVTEPPNGLKLN+R+TY KI+   L+   H AF  LV+ LAFFHAVVQERRK+GKIGWN+ YDFNESDF+VC++IL TYL KA  Q D +IPWGSLKYLIGEVMYGGRAID FDRRIL  YMDEY GDF+FDTFQPFHF+ +K   Y IP  D  +  ++ IE+LPL NTPEVFGLH NAEIGYYT AA++MW+ L+++QPQTG+S S  SRD+ I + A  I++K+PK+FDLD++RK+ G  +SPT VVLLQELERFN LV RMTKSL  L RAL GEVGMS ELDDVA+SL+ G IP IW+RLAPDTLKSL NW+ +F  R++QY  WV   EP+VMWLSGLHIPESYLTALVQATCRKNGWPLD+STL+T VT+F  A EV ERA QGCFV GLYLEGA WD  + CL++ KPK L+  LP++K+IPIEAHRLK QNTF TPVY TS RRNAMGVGLV EADL TT H SHWVLQGVCL LN+D
Sbjct:   83 LHMLCTPLPEEFLDQNVVFFL-RNTKEAISEATDMKEAMEIMPETLEYGIINANVLHFLKNIICQVFLPALSFNQHRTSTTVGVT-------SGEVSNSSEHESDLPPMPGEAV-EYHSIQLIRDEFLMNVQKFASNIQRTMQQLEGEIKLEMPIISVEGEVSDLAADPETVDILEQCVINWLNQISTAVEAQLKKTPQGKGPLAEIEFWRERNATLSALHEQTKLPIVRKVLDVIKESDSMLVANLQPVF----TELFKFHTEASDNVRFLSTVERYFKNITHGSGFHVVLDTIPAMMSALRMVWIISRHYNKDERMIPLMERIAWEIAERVCRVVNLRTLFKENRASAQSKTLEARNTLRLWKKAYFDTRAKIEASGREDRWEFDRKRLFERTDYMATICQDLSDVLQILEEFYNIFGPELKAVTGDPKRIDDVLCRVDGLVTPMENLTFDPFSIKSSQF-WKYVMDEFKIEVL------IDIINKIFV---------------------------------------------------QNLENPPLYKNHPPVAGAIYWERSLFFRIKHTILRFQEVQEILDSDRGQEVKQKYLEVGRTMKEYEDRKYEQWMEVTEQVLPALMKKSLL----TKSSIATEEP-STLER-GAVFAINFSPALREIINETKYLEQLGFTVPELARNVALQEDKFLRYTAGIQRMLDHYHMLIGTLNDAESVLLKDHSQELLRVFRSGYKRLNWNSLGIGDYITGCKQAIGKFESLVHQIHKNADDISSRLTLIEAINLFKYPAAKSEEELPGVKEFFEHIERERASDVDHMVRWYLAIGPLLTKVEGLVV-HTNTGKAPKLASYYKYWEKKIYEVLTKLILKNLQSFNSLILG-NVP--LFHTETILTAPEIILHPNTNEIDKMCFHCVRNCVEITKHFVRWMNGSCIECPPQKGE-EEEVVIINFYNDISLNPQIIEQAVMIPQNVHRILINLMKYLQKWKRYRPLWKLDKAIVMEKFAAKKPPCVAYDEKLQFYSKIAYEVMRHPLIKDEHCIRLQLRHLANTVQENAKSWVISLGKLLNESAKEELYNLHEEMEHLAKNLRKIPNTLEDLKFVLATIAEIRSKSLVMELRYRDVQERYRTMAMYNLFPPDAEK-ELVDKIESIWSNLFNDSVNVEHALGDIKRTFTELTRGEIMNYRVQIEEFAKRFYSEGPGSVGDDLDKGVELLGVYERELARHEKSRQELANAEKLFDLPITMYPELLKVQKEMSGLRMIYELYEGLKVAKEEWSQTLWINLNVQILQEGIEGFLRALRKLPRPVRGLSVTYYLEAKMKAFKDSIPLLLDLKNEALRDRHWKELMEKTSVFFEMT-ETFTLENMFAMELHKHTDVLNEIVTAAIKEVAIEKAVKEILDTWENMKFTVVKYCKGTQERGYILGSVDEIIQSLDDNTFNLQSISGSRFVGPFLQTVHKWEKTLSLIGEVIEIWMLVQRKWMYLESIFIGGDIRSQLPEEAKKFDNIDKVFKRIMGETLKDPVIKRCCEAPNRLSDLQNVSEGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDPLCVQEHMIKMYDNIASLRFNDGDSGEKLVSAMISAEGEVMEFRKILRAEGRVEDWMTAVLNEMRRTNRLITKEAIFRYCEDRSRVDWMLLYQGMVVLAASQVWWTWEVEDVFHKAQKGEKQAMKNYGRKMHRQIDELVTRITMPLSKNDRKKYNTVLIIDVHARDIVDSFIRGSILEAREFDWESQLRFYWDREPDELNIRQCTGTFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDYRAVGKIFSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALIHQLTTFQFEGQEISLDSRMGIFITMNPGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLEAKTLAKKMTVLYKLAREQLSKQYHYDFGLRALKSVLVMAGELKRGSSDLREDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRVRYPDFNDAVEQVLEENGYAVLPIQVDKVVQMFETMLTRHTTMVVGPTRGGKSVVINTLCQAQTKLGLTTKLYILNPKAVSVIELYGILDPTTRDWTDGVLSNIFREINKPTDKKERKYILFDGDVDALWVENMNSVMDDNRLLTLANGERIRLQAHCALLFEVGDLQYASPATVSRCGMVYVDPKNLKYRPYWKKWVNQIPNKVEQYNLNSLFEKYVPYLMDVIVEGIVDGRQAEKLKTIVPQTDLNMVTQLAKMLDALLEGEIEDLDLLECYFLEALYCSLGASLLEDGRMKFDEYIKRLASLSTVDTEGVWANPGELPGQLPTLYDFHFDN--KRNQWVPWSKLVPEYIHAPERKFINILVHTVDTTRTTWILEQMVKIKQPVIFVGESGTSKTATTQNFLKNLSEETNIVLMVNFSSRTTSMDIQRNLEANVEKRTKDTYGPPMGKRLLVFMDDMNMPRVDEYGTQQPIALLKLLLEKGYLYDRGKELNCKSIRDLGFIAAMGKAGGGRNEVDPRFISLFSVFNVPFPSEESLHLIYSSILKGHTSTFHESIVAVSGKLTFCTLALYKNIVQDLPPTPSKFHYIFNLRDLSRVFNGLVLTNPERFQTVAQMVRVWRNECLRVFHDRLISETDKQLVQQHIGSLVVEHFKDDVEVVMRDPILFGDFQMALHEGEPRIYEDIQDYEAAKALFQEILEEYNESNTKMNLVLFDDALEHLTRVHRIIRMDRGHALLVGVGGSGKQSLSRLAAFTASCEVFEILLSRGYSENSFREDLKSLYLKLGIENKAMIFLFTDAHVAEEGFLELINNMLTSGIVPALFSEEEKESILSQIGQEALKQGMGPAKESVWQYFVNKSANNLHIVLGMSPVGDTLRTWCRNFPGMVNNTGIDWFMPWPPQALHAVAKSFLG-YNPMIPAENIENVVKHVVLVHQSVDHYSQQFLQKLRRSNYVTPKNYLDFINTYSKLLDEKTQCNIAQCKRLDGGLDKLKEATIQLDELNQKLAEQKIVLAEKSAACEALLEEIAVNTAVAEEKKKLAEEKAMEIEEQNKVIAMEKAEAETTLAEVMPILEAAKLELQKLDKSDVTEIRSFAKPPKQVQTVCECILIMKGYKELNWKTAKGVMSDPNFLRSLMEIDFDSITQSQVKNIKGLLKTLNTTTEEMEAVSKAGLGMLKFVEAVMGYCDVFREIKPKREKVARLERNFYLTKRELERIQNELAAIQKELETLGAKYEAAILEKQKLQEEAEIMERRLIAADKLISGLGSENIRWLNDLDELMHRRVKLLGDCLLCAAFLSYEGAFTWEFRDEMVNRIWQNDILEREIPLSQPFRLESLLTDDVEISRWGSQGLPPDELSVQNGILTTRASRFPLCIDPQQQALNWIKRKEEKNNLRVASFNDPDFLKQLEMSIKYGTPFLFRDVDEYIDPVIDNVLEKNIKVSQGRQFIILGDKEVDYDSNFRLYLNTKLANPRYSPSVFGKAMVINYTVTLKGLEDQLLSVLVAYERRELEEQREHLIQETSENKNLLKDLEDSLLRELATSTGNMLDNVDLVHTLEETKSKATEVSEKLKLAEKTALDIDRLRDGYRPAARRGAILFFVLSEMALVNSMYQYSLIAFLEVFRLSLKKSLPDSILMKRLRNIMDTLTFSIYNHGCTGLFERHKLLFSFNMTIKIEQAEGRVPQEELDFFLKGNISLEKSKRKKPCAWLSDQGWEDIILLSEMFSDNFGQLPDDVENNQTVWQEWYDLDSLEQFPVPLGYDNNITPFQKLLILRCFRVDRVYRAVTDYVTVTMGEKYVQPPMISFEAIFEQSTPHSPIVFILSPGSDPATDLMKLAERSGFGGNRLKFLAMGQGQEKVALQLLETAVARGQWLMLQNCHLLVKWLKDLEKSLERITKPHPDFRLWLTTDPTKGFPIGILQKSLKVVTEPPNGLKLNMRATYFKISHEMLDQCPHPAFKPLVYVLAFFHAVVQERRKFGKIGWNVYYDFNESDFQVCMEILNTYLTKAFQQRDPRIPWGSLKYLIGEVMYGGRAIDSFDRRILTIYMDEYLGDFIFDTFQPFHFFRNKEVDYKIPVGDEKEKFVEAIEALPLANTPEVFGLHPNAEIGYYTQAARDMWAHLLELQPQTGESSSGISRDDYIGQVAKEIENKMPKVFDLDQVRKRLGTGLSPTSVVLLQELERFNKLVVRMTKSLAELQRALAGEVGMSNELDDVARSLFIGHIPNIWRRLAPDTLKSLGNWMVYFLRRFSQYMLWVTESEPSVMWLSGLHIPESYLTALVQATCRKNGWPLDRSTLFTQVTKFQDADEVNERAGQGCFVSGLYLEGADWDIEKGCLIKSKPKVLVVDLPILKIIPIEAHRLKLQNTFRTPVYTTSMRRNAMGVGLVFEADLFTTRHISHWVLQGVCLTLNSD 4471          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Human
Match: DNAH10 (dynein axonemal heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:2941])

HSP 1 Score: 5264.51 bits (13655), Expect = 0.000e+0
Identity = 2662/4476 (59.47%), Postives = 3353/4476 (74.91%), Query Frame = 1
Query:  538 LQMARTPLVNA--EDTLCFFLVRTTDDMVVLPSNINEANSELPSYFESGTLKGDMLLLLSQLIHSVYDYMLSYHQHRVTSDLGMSRASTPASQGRIPKKSQSDGDKIESIDEKVHETRAAVQARDEFLISLKKFTSIVDQTIIQIASEVKLEIPDLDLFENDKENLSDKEIMEMIESTVLKWDQQITGTLESLQKIVPHGPSPLAEIDFWRERNAXXXXXXXXXXXPKVKRILNLYSLAEG-------PVFDTQNNELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIAWNLSDRVARLIDVNTIFNLPLEHVLKDTAEAEKMLRVWNDTYFEVRASIEASGRDARWEFDRKRLFEKTNYMADICHDLNEIAMILQEFYNIFGPELKSVTNEAKRIXXXXXXXXXXXXPLKEMPFNPFNLMKHKYDWSNFMEDFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEVESIDQLFKTNMNNPPLYHFKSCVAGGISWERHLFYNIKRPILRFLTMDEMMQSDNGKRIRTKYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILALANSENFVSENVPEETIDKMDDDLRVDFGFEINEIITETRNLELLGYKVPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISDYIEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFKL---QSGNKFLKCKEFFEFMESERTSDFEHLGRKYSTIGPLITKLQGEIIGDRDVNPFEKFQPFYEFWEKRIFDRVYNMVLKNLQDYQNMLRDENFPTCLFEVDLMLAGTDVIGNPQTTEIYKLAIQDLRDAVEATRVFIRWKRNSCIETTGMKIDGQDELFYFTFYLDIGNSVEITYFCEQIANYYRNIIGKLRKYQDKWKKHKRVFIPNKQAQIDKWLTKDPTVMDFYERIRDTIDRKEELLNQPVIRKIGFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDLSLIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSN-HPIDQEEIEESDKLRQLFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTREGMNQDTIEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSENAKSDKDYAMTDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKRKKPYLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLTKPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTGKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGEPNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMGVGLVVEADLATTEHPSHWVLQGVCLILNTD 13926
            L M  TPL     +  + FFL R T + +   +++ EA   +P   E G +  ++L  L  +I  V+   LS++QHR ++ +G++        G +   S+ + D      E V E  +    RDEFL++++KF S + +T+ Q+  E+KLE+P + +     +  +D E ++++E  V+ W  QI+  +E+  K  P G  PLAEI+FWRERNA LSAL EQ KLP V+++L++   ++        PVF     EL KFH EA DN +FLS VER+FK+I +G  F  V D+IP MM ALRM+WIISRHYNKDERM+PLMERIAW +++RV R++++ T+F          T EA   LR+W   YF+ RA IEASGR+ RWEFDRKRLFE+T+YMA IC DL+++  IL+EFYNIFGPELK+VT + KRI++VL +V+ LV P++ + F+PF++   ++ W   M++F+ +V+      ID IN  F                                                     N+ NPPLY     VAG I WER LF+ IK  ILRF  + E++ SD G+ ++ KYL VGRTM+ +E++++ +W    ++VL  L++K++L    +++ ++   P  T+++      ++F   + EII ET+ LE LG+ VPELARNVALQ++ + +   G+  M+  YH +I +L   E  +L D  +E+ R  R G +RLNWNSLGI DYI  C  A+  FES V  IHK   DI  +L  I+   LFK    +S  +    KEFFE +E ER SD +H+ R Y  IGPL+TK++G ++   +     K   +Y++WEK+I++ +  ++LKNLQ + +++   N P  LF  + +L   ++I +P T EI K+    +R+ VE T+ F+RW   SCIE    K + ++E+    FY DI  + +I      I      I+  L KY  KWK+++ ++  +K   ++K+  K P  + + E+++       E++  P+I+    I + L+ L + V+++ K W       L+ESAK  L ++  ++E    +L  IP  LE+LK +L+TI  I+  SL  E R  DVQERYR + + N  P D E+ E  DK+  ++ +L  +S NV + L  +K  FT++T+ EI ++   ++ FA +F  EGPGS+G DLD G+ +L  +  EL   E  RQEL  AE+LF+LPIT YPEL  VQKEM  L  IYELY+  K A+E W++TLW NL++++L EGIEGFL+  RK+PR V+ +     L  K+K FKD++PL  DLK+EALR+RHWKELM KT   F++  +TFTL ++FAMEL++  DV+ EIVT+A KE++IEK V+E+ +TW  +KF+V  Y KG +ERGYILG++DE++Q LDDN  NLQS+S SRF+GPFL +V  WEK LSLI EV+++WM+VQRKWMYLE IFIGGDIRSQLPEEAKKFD IDK FK+IM ET K P+IK+ C+ PNRLSDL N+S+GLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSD  CVQEHMIKM+DNI+SLRF  G S E   +AMIS+E E+MEFR  +  EGRVEDWMT +  EMRRTNR+ITKEA+F Y E + RV WM  YQGMV L  +Q+WWTWEVEDVF K +KG+K A+K+Y + +H QIDE+V  +  PLSKNDR K  TVLIIDVHARDIVDSF+R SI++A+EF+WESQLRFYW RE DE+ I+QCTG FGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDYR+VGKIF+GL QCGAWGCFDEFNRI+ SVLSVIS+Q++TI+N LI +L+ F FEGQEI LDSR+GIFITMNPGYAGRTELPESVKA FRPVVVIVPDLQQICEIMLFS+GFL AK LAKKMT LY+L++EQLSKQ HYDFGLRALKSVLVMAGEL+R   DL ED VLMRALRDMNLPKF+FED PLFLGLI DLFPGLDCPRVRYPDFND+VE+ L E+ Y VL  Q DK+VQ++ETM TRHTTMVVGPT GGKSVVI  LC +QTKL L TKL  +NPK  SVIELYGILDP TRDWTDG+LSNIFREINKPTDK ER+Y+LFDGDVDALWVENMNSVMDDN+LLTLANGERIRLQ HCALLFEVGDLQYASPATVSRCGMVYVDPKNL Y P+W+ W+N+  NK E   L  L++KY+P  +D ++EG+++G+  EKLKTI+P T+LN+VTQL  MLD  L  E  + D +E  F++++Y SLG  L+ED ++KFD++IK L ++   + E   A  GELP + PTL+D++FD+  ++ +W+PW+ LVP+Y+H PE+KF  ILV T+DT R TW+L + +KI++PV+ VGE+GTSKTA +Q FL+N   +  I L +NFSSRTTS+DIQRNLE+NVEKRTKD+YGPPMGKRLLVF+DDMNMP+VD+YGTQQPIA+LKL+LE+   YDRGK+LN K ++D+GF+AAMGK GGGRN+VDPRFISLFSVFN  FPS+ SL  IYSSIL GH   F + I      +T  T+ +Y  I+  LPPTPSKFHYIFNLRDLSR++ G+  T  +RF    Q  RVWR+E  RV  DRLI++ DK  VQ+ I   + E+ K D +  M DPILFGD++ AL   E R+YED+ +YEAAK LFQEI+EEY+E+ + M LVLFDDAL+HLTR+HR IRMD GHALLVGVGGSGKQSL++LAA+T SC++FEI LSRGYSE   RE+LK+LY KLGIENK+ +F+F D HV EEGFLELINNML+SGIVPALF ++E+E+I+SQ+  EA   GMGP+KES+WQYFVNK A+NLHIVL MSPVG+TLRT CRNFPG+VNNT IDWF PWP QAL+AVA  F+G  N +IP +    +VKH V+VH SV+ YS++F+QK RR NYVTPKNYLDFINTY KLL++K +   +QC RL GGL KL EA++QL ELN KLA QK+ + EK+ ACE LL+EI   T +A EKK++A+EK+  +E Q+K I  EK EAE  L E +P+LE A+L L  L+K+DV EIRSFAKPPK VQ V ECI + K YKE+NWK AKG+M+DP+FL+SL  +D D+IT  Q   ++  L  L  T +EM +VSKAG G+LKFV AV+GY DV REIKPKREKVARLE+ F   KRELE+++NE+  ++ EL+ L  +YE AI E+Q+LQEE +IM+RRL AADKLI+GL SEN RWL DL  L  ++V+LLGDCL+C+AFLSY GAF+WEFR EMV   W++D++ER+IP+S PFRLE +LT+DVEIS+W S+GLPPDELS+QNGILTTRASRFPLCIDPQQQALNWI +KEE NNL+ A+FNDPDFLKQLE++IKYG PFLF+DVDEYIDPVIDNVLEKNIK  QGR+F+ILGDKEVD+D NFRLYLNTKL+NP+Y P++FGK+MVINYTVTLKGLEDQLLSV+V +ER+ELEEQRE LIQETS+NK LLKDLEDSLLRELATSTGNMLDN +L++TLEETKSKA+EVSEKLKL  +T+ +ID+ RDGYR AA+RGAILFFVL+EM+ +NSMYQYSL A+L+VF+ SLKKSLPD  L KRL+N+M TLT ++Y +GCTG+FE+HKLLF+F +T+K+E  +G + Q+ELDFF+KGN S+E +KRKKP  WLSD  W+D+  L+EM    F  L +D+E ++  W++W + ++ E   +P  Y N +  FQKL +LRCFR+DR+YRA+T YV   MGE+YV PP+++FE I +QSTP SPIVFILSPGSDPA+D++KLAERSGFG  +LKF++MGQGQE  A  LL+ A+ARG WL+LQNCHLLVKWL++LEK LER+TKPHPDFRLWLTT+PT+ FPIGILQ+SLKVVTEPPNGLKLN+R+TY KI+   L+   H AF  LV+ LAFFHAVVQERRK+GKIGWN+ YDFNESDF+VC++IL TYL KA  Q D +IPWGSLKYLIGEVMYGGRAID FDRRIL  YMDEY GDF+FDTFQPFHF+ +K   Y IP  D  +  ++ IE+LPL NTPEVFGLH NAEIGYYT AA++MW+ L+++QPQTG+S S  SRD+ I + A  I++K+PK+FDLD++RK+ G  +SPT VVLLQELERFN LV RMTKSL  L RAL GEVGMS ELDDVA+SL+ G IP IW+RLAPDTLKSL NW+ +F  R++QY  WV   EP+VMWLSGLHIPESYLTALVQATCRKNGWPLD+STL+T VT+F  A EV ERA QGCFV GLYLEGA WD  + CL++ KPK L+  LP++K+IPIEAHRLK QNTF TPVY TS RRNAMGVGLV EADL TT H SHWVLQGVCL LN+D
Sbjct:  144 LHMLCTPLPEEFLDQNVVFFL-RNTKEAISEATDMKEAMEIMPETLEYGIINANVLHFLKNIICQVFLPALSFNQHRTSTTVGVT-------SGEVSNSSEHESDLPPMPGEAV-EYHSIQLIRDEFLMNVQKFASNIQRTMQQLEGEIKLEMPIISVEGEVSDLAADPETVDILEQCVINWLNQISTAVEAQLKKTPQGKGPLAEIEFWRERNATLSALHEQTKLPIVRKVLDVIKESDSMLVANLQPVF----TELFKFHTEASDNVRFLSTVERYFKNITHGSGFHVVLDTIPAMMSALRMVWIISRHYNKDERMIPLMERIAWEIAERVCRVVNLRTLFKENRASAQSKTLEARNTLRLWKKAYFDTRAKIEASGREDRWEFDRKRLFERTDYMATICQDLSDVLQILEEFYNIFGPELKAVTGDPKRIDDVLCRVDGLVTPMENLTFDPFSIKSSQF-WKYVMDEFKIEVL------IDIINKIFV---------------------------------------------------QNLENPPLYKNHPPVAGAIYWERSLFFRIKHTILRFQEVQEILDSDRGQEVKQKYLEVGRTMKEYEDRKYEQWMEVTEQVLPALMKKSLL----TKSSIATEEP-STLER-GAVFAINFSPALREIINETKYLEQLGFTVPELARNVALQEDKFLRYTAGIQRMLDHYHMLIGTLNDAESVLLKDHSQELLRVFRSGYKRLNWNSLGIGDYITGCKQAIGKFESLVHQIHKNADDISSRLTLIEAINLFKYPAAKSEEELPGVKEFFEHIERERASDVDHMVRWYLAIGPLLTKVEGLVV-HTNTGKAPKLASYYKYWEKKIYEVLTKLILKNLQSFNSLILG-NVP--LFHTETILTAPEIILHPNTNEIDKMCFHCVRNCVEITKHFVRWMNGSCIECPPQKGE-EEEVVIINFYNDISLNPQIIEQAVMIPQNVHRILINLMKYLQKWKRYRPLWKLDKAIVMEKFAAKKPPCVAYDEKLQFYSKIAYEVMRHPLIKDEHCIRLQLRHLANTVQENAKSWVISLGKLLNESAKEELYNLHEEMEHLAKNLRKIPNTLEDLKFVLATIAEIRSKSLVMELRYRDVQERYRTMAMYNLFPPDAEK-ELVDKIESIWSNLFNDSVNVEHALGDIKRTFTELTRGEIMNYRVQIEEFAKRFYSEGPGSVGDDLDKGVELLGVYERELARHEKSRQELANAEKLFDLPITMYPELLKVQKEMSGLRMIYELYEGLKVAKEEWSQTLWINLNVQILQEGIEGFLRALRKLPRPVRGLSVTYYLEAKMKAFKDSIPLLLDLKNEALRDRHWKELMEKTSVFFEMT-ETFTLENMFAMELHKHTDVLNEIVTAAIKEVAIEKAVKEILDTWENMKFTVVKYCKGTQERGYILGSVDEIIQSLDDNTFNLQSISGSRFVGPFLQTVHKWEKTLSLIGEVIEIWMLVQRKWMYLESIFIGGDIRSQLPEEAKKFDNIDKVFKRIMGETLKDPVIKRCCEAPNRLSDLQNVSEGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDPLCVQEHMIKMYDNIASLRFNDGDSGEKLVSAMISAEGEVMEFRKILRAEGRVEDWMTAVLNEMRRTNRLITKEAIFRYCEDRSRVDWMLLYQGMVVLAASQVWWTWEVEDVFHKAQKGEKQAMKNYGRKMHRQIDELVTRITMPLSKNDRKKYNTVLIIDVHARDIVDSFIRGSILEAREFDWESQLRFYWDREPDELNIRQCTGTFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDYRAVGKIFSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALIHQLTTFQFEGQEISLDSRMGIFITMNPGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLEAKTLAKKMTVLYKLAREQLSKQYHYDFGLRALKSVLVMAGELKRGSSDLREDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRVRYPDFNDAVEQVLEENGYAVLPIQVDKVVQMFETMLTRHTTMVVGPTRGGKSVVINTLCQAQTKLGLTTKLYILNPKAVSVIELYGILDPTTRDWTDGVLSNIFREINKPTDKKERKYILFDGDVDALWVENMNSVMDDNRLLTLANGERIRLQAHCALLFEVGDLQYASPATVSRCGMVYVDPKNLKYRPYWKKWVNQIPNKVEQYNLNSLFEKYVPYLMDVIVEGIVDGRQAEKLKTIVPQTDLNMVTQLAKMLDALLEGEIEDLDLLECYFLEALYCSLGASLLEDGRMKFDEYIKRLASLSTVDTEGVWANPGELPGQLPTLYDFHFDN--KRNQWVPWSKLVPEYIHAPERKFINILVHTVDTTRTTWILEQMVKIKQPVIFVGESGTSKTATTQNFLKNLSEETNIVLMVNFSSRTTSMDIQRNLEANVEKRTKDTYGPPMGKRLLVFMDDMNMPRVDEYGTQQPIALLKLLLEKGYLYDRGKELNCKSIRDLGFIAAMGKAGGGRNEVDPRFISLFSVFNVPFPSEESLHLIYSSILKGHTSTFHESIVAVSGKLTFCTLALYKNIVQDLPPTPSKFHYIFNLRDLSRVFNGLVLTNPERFQTVAQMVRVWRNECLRVFHDRLISETDKQLVQQHIGSLVVEHFKDDVEVVMRDPILFGDFQMALHEGEPRIYEDIQDYEAAKALFQEILEEYNESNTKMNLVLFDDALEHLTRVHRIIRMDRGHALLVGVGGSGKQSLSRLAAFTASCEVFEILLSRGYSENSFREDLKSLYLKLGIENKAMIFLFTDAHVAEEGFLELINNMLTSGIVPALFSEEEKESILSQIGQEALKQGMGPAKESVWQYFVNKSANNLHIVLGMSPVGDTLRTWCRNFPGMVNNTGIDWFMPWPPQALHAVAKSFLG-YNPMIPAENIENVVKHVVLVHQSVDHYSQQFLQKLRRSNYVTPKNYLDFINTYSKLLDEKTQCNIAQCKRLDGGLDKLKEATIQLDELNQKLAEQKIVLAEKSAACEALLEEIAVNTAVAEEKKKLAEEKAMEIEEQNKVIAMEKAEAETTLAEVMPILEAAKLELQKLDKSDVTEIRSFAKPPKQVQTVCECILIMKGYKELNWKTAKGVMSDPNFLRSLMEIDFDSITQSQVKNIKGLLKTLNTTTEEMEAVSKAGLGMLKFVEAVMGYCDVFREIKPKREKVARLERNFYLTKRELERIQNELAAIQKELETLGAKYEAAILEKQKLQEEAEIMERRLIAADKLISGLGSENIRWLNDLDELMHRRVKLLGDCLLCAAFLSYEGAFTWEFRDEMVNRIWQNDILEREIPLSQPFRLESLLTDDVEISRWGSQGLPPDELSVQNGILTTRASRFPLCIDPQQQALNWIKRKEEKNNLRVASFNDPDFLKQLEMSIKYGTPFLFRDVDEYIDPVIDNVLEKNIKVSQGRQFIILGDKEVDYDSNFRLYLNTKLANPRYSPSVFGKAMVINYTVTLKGLEDQLLSVLVAYERRELEEQREHLIQETSENKNLLKDLEDSLLRELATSTGNMLDNVDLVHTLEETKSKATEVSEKLKLAEKTALDIDRLRDGYRPAARRGAILFFVLSEMALVNSMYQYSLIAFLEVFRLSLKKSLPDSILMKRLRNIMDTLTFSIYNHGCTGLFERHKLLFSFNMTIKIEQAEGRVPQEELDFFLKGNISLEKSKRKKPCAWLSDQGWEDIILLSEMFSDNFGQLPDDVENNQTVWQEWYDLDSLEQFPVPLGYDNNITPFQKLLILRCFRVDRVYRAVTDYVTVTMGEKYVQPPMISFEAIFEQSTPHSPIVFILSPGSDPATDLMKLAERSGFGGNRLKFLAMGQGQEKVALQLLETAVARGQWLMLQNCHLLVKWLKDLEKSLERITKPHPDFRLWLTTDPTKGFPIGILQKSLKVVTEPPNGLKLNMRATYFKISHEMLDQCPHPAFKPLVYVLAFFHAVVQERRKFGKIGWNVYYDFNESDFQVCMEILNTYLTKAFQQRDPRIPWGSLKYLIGEVMYGGRAIDSFDRRILTIYMDEYLGDFIFDTFQPFHFFRNKEVDYKIPVGDEKEKFVEAIEALPLANTPEVFGLHPNAEIGYYTQAARDMWAHLLELQPQTGESSSGISRDDYIGQVAKEIENKMPKVFDLDQVRKRLGTGLSPTSVVLLQELERFNKLVVRMTKSLAELQRALAGEVGMSNELDDVARSLFIGHIPNIWRRLAPDTLKSLGNWMVYFLRRFSQYMLWVTESEPSVMWLSGLHIPESYLTALVQATCRKNGWPLDRSTLFTQVTKFQDADEVNERAGQGCFVSGLYLEGADWDIEKGCLIKSKPKVLVVDLPILKIIPIEAHRLKLQNTFRTPVYTTSMRRNAMGVGLVFEADLFTTRHISHWVLQGVCLTLNSD 4532          

HSP 2 Score: 56.6102 bits (135), Expect = 1.591e-6
Identity = 20/57 (35.09%), Postives = 40/57 (70.18%), Query Frame = 1
Query:   46 MDDIRIVWIKNQLYNCLDITDDSIFEDFIDREDGENERALATYLNETQDEQHQAIIF 216
            MDD+R++W+++++Y    ITD  +FED ++R+DG+ E  +  +LN+  +E+  + +F
Sbjct:    1 MDDLRVLWMRDRVYAAFGITDPQLFEDLLNRDDGQGEDLILHFLNQASEEEGPSALF 57          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Human
Match: DNAH10 (dynein axonemal heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:2941])

HSP 1 Score: 4447.11 bits (11533), Expect = 0.000e+0
Identity = 2173/3199 (67.93%), Postives = 2618/3199 (81.84%), Query Frame = 1
Query: 4330 ARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTREGMNQDTIEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSENAKSDKDYAMTDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKRKKPYLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLTKPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTGKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGEPNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMGVGLVVEADLATTEHPSHWVLQGVCLILNTD 13926
            A+E W++TLW NL++++L EGIEGFL+  RK+PR V+ +     L  K+K FKD++PL  DLK+EALR+RHWKELM KT   F++  +TFTL ++FAMEL++  DV+ EIVT+A KE++IEK V+E+ +TW  +KF+V  Y KG +ERGYILG++DE++Q LDDN  NLQS+S SRF+GPFL +V  WEK LSLI EV+++WM+VQRKWMYLE IFIGGDIRSQLPEEAKKFD IDK FK+IM ET K P+IK+ C+ PNRLSDL N+S+GLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSD  CVQEHMIKM+DNI+SLRF  G S E   +AMIS+E E+MEFR  +  EGRVEDWMT +  EMRRTNR+ITKEA+F Y E + RV WM  YQGMV L  +Q+WWTWEVEDVF K +KG+K A+K+Y + +H QIDE+V  +  PLSKNDR K  TVLIIDVHARDIVDSF+R SI++A+EF+WESQLRFYW RE DE+ I+QCTG FGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDYR+VGKIF+GL QCGAWGCFDEFNRI+ SVLSVIS+Q++TI+N LI +L+ F FEGQEI LDSR+GIFITMNPGYAGRTELPESVKA FRPVVVIVPDLQQICEIMLFS+GFL AK LAKKMT LY+L++EQLSKQ HYDFGLRALKSVLVMAGEL+R   DL ED VLMRALRDMNLPKF+FED PLFLGLI DLFPGLDCPRVRYPDFND+VE+ L E+ Y VL  Q DK+VQ++ETM TRHTTMVVGPT GGKSVVI  LC +QTKL L TKL  +NPK  SVIELYGILDP TRDWTDG+LSNIFREINKPTDK ER+Y+LFDGDVDALWVENMNSVMDDN+LLTLANGERIRLQ HCALLFEVGDLQYASPATVSRCGMVYVDPKNL Y P+W+ W+N+  NK E   L  L++KY+P  +D ++EG+++G+  EKLKTI+P T+LN+VTQL  MLD  L  E  + D +E  F++++Y SLG  L+ED ++KFD++IK L ++   + E   A  GELP + PTL+D++FD+  ++ +W+PW+ LVP+Y+H PE+KF  ILV T+DT R TW+L + +KI++PV+ VGE+GTSKTA +Q FL+N   +  I L +NFSSRTTS+DIQRNLE+NVEKRTKD+YGPPMGKRLLVF+DDMNMP+VD+YGTQQPIA+LKL+LE+   YDRGK+LN K ++D+GF+AAMGK GGGRN+VDPRFISLFSVFN  FPS+ SL  IYSSIL GH   F + I      +T  T+ +Y  I+  LPPTPSKFHYIFNLRDLSR++ G+  T  +RF    Q  RVWR+E  RV  DRLI++ DK  VQ+ I   + E+ K D +  M DPILFGD++ AL   E R+YED+ +YEAAK LFQEI+EEY+E+ + M LVLFDDAL+HLTR+HR IRMD GHALLVGVGGSGKQSL++LAA+T SC++FEI LSRGYSE   RE+LK+LY KLGIENK+ +F+F D HV EEGFLELINNML+SGIVPALF ++E+E+I+SQ+  EA   GMGP+KES+WQYFVNK A+NLHIVL MSPVG+TLRT CRNFPG+VNNT IDWF PWP QAL+AVA  F+G  N +IP +    +VKH V+VH SV+ YS++F+QK RR NYVTPKNYLDFINTY KLL++K +   +QC RL GGL KL EA++QL ELN KLA QK+ + EK+ ACE LL+EI   T +A EKK++A+EK+  +E Q+K I  EK EAE  L E +P+LE A+L L  L+K+DV EIRSFAKPPK VQ V ECI + K YKE+NWK AKG+M+DP+FL+SL  +D D+IT  Q   ++  L  L  T +EM +VSKAG G+LKFV AV+GY DV REIKPKREKVARLE+ F   KRELE+++NE+  ++ EL+ L  +YE AI E+Q+LQEE +IM+RRL AADKLI+GL SEN RWL DL  L  ++V+LLGDCL+C+AFLSY GAF+WEFR EMV   W++D++ER+IP+S PFRLE +LT+DVEIS+W S+GLPPDELS+QNGILTTRASRFPLCIDPQQQALNWI +KEE NNL+ A+FNDPDFLKQLE++IKYG PFLF+DVDEYIDPVIDNVLEKNIK  QGR+F+ILGDKEVD+D NFRLYLNTKL+NP+Y P++FGK+MVINYTVTLKGLEDQLLSV+V +ER+ELEEQRE LIQETS+NK LLKDLEDSLLRELATSTGNMLDN +L++TLEETKSKA+EVSEKLKL  +T+ +ID+ RDGYR AA+RGAILFFVL+EM+ +NSMYQYSL A+L+VF+ SLKKSLPD  L KRL+N+M TLT ++Y +GCTG+FE+HKLLF+F +T+K+E  +G + Q+ELDFF+KGN S+E +KRKKP  WLSD  W+D+  L+EM    F  L +D+E ++  W++W + ++ E   +P  Y N +  FQKL +LRCFR+DR+YRA+T YV   MGE+YV PP+++FE I +QSTP SPIVFILSPGSDPA+D++KLAERSGFG  +LKF++MGQGQE  A  LL+ A+ARG WL+LQNCHLLVKWL++LEK LER+TKPHPDFRLWLTT+PT+ FPIGILQ+SLKVVTEPPNGLKLN+R+TY KI+   L+   H AF  LV+ LAFFHAVVQERRK+GKIGWN+ YDFNESDF+VC++IL TYL KA  Q D +IPWGSLKYLIGEVMYGGRAID FDRRIL  YMDEY GDF+FDTFQPFHF+ +K   Y IP  D  +  ++ IE+LPL NTPEVFGLH NAEIGYYT AA++MW+ L+++QPQTG+S S  SRD+ I + A  I++K+PK+FDLD++RK+ G  +SPT VVLLQELERFN LV RMTKSL  L RAL GEVGMS ELDDVA+SL+ G IP IW+RLAPDTLKSL NW+ +F  R++QY  WV   EP+VMWLSGLHIPESYLTALVQATCRKNGWPLD+STL+T VT+F  A EV ERA QGCFV GLYLEGA WD  + CL++ KPK L+  LP++K+IPIEAHRLK QNTF TPVY TS RRNAMGVGLV EADL TT H SHWVLQGVCL LN+D
Sbjct:    2 AKEEWSQTLWINLNVQILQEGIEGFLRALRKLPRPVRGLSVTYYLEAKMKAFKDSIPLLLDLKNEALRDRHWKELMEKTSVFFEMT-ETFTLENMFAMELHKHTDVLNEIVTAAIKEVAIEKAVKEILDTWENMKFTVVKYCKGTQERGYILGSVDEIIQSLDDNTFNLQSISGSRFVGPFLQTVHKWEKTLSLIGEVIEIWMLVQRKWMYLESIFIGGDIRSQLPEEAKKFDNIDKVFKRIMGETLKDPVIKRCCEAPNRLSDLQNVSEGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDPLCVQEHMIKMYDNIASLRFNDGDSGEKLVSAMISAEGEVMEFRKILRAEGRVEDWMTAVLNEMRRTNRLITKEAIFRYCEDRSRVDWMLLYQGMVVLAASQVWWTWEVEDVFHKAQKGEKQAMKNYGRKMHRQIDELVTRITMPLSKNDRKKYNTVLIIDVHARDIVDSFIRGSILEAREFDWESQLRFYWDREPDELNIRQCTGTFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDYRAVGKIFSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALIHQLTTFQFEGQEISLDSRMGIFITMNPGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLEAKTLAKKMTVLYKLAREQLSKQYHYDFGLRALKSVLVMAGELKRGSSDLREDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRVRYPDFNDAVEQVLEENGYAVLPIQVDKVVQMFETMLTRHTTMVVGPTRGGKSVVINTLCQAQTKLGLTTKLYILNPKAVSVIELYGILDPTTRDWTDGVLSNIFREINKPTDKKERKYILFDGDVDALWVENMNSVMDDNRLLTLANGERIRLQAHCALLFEVGDLQYASPATVSRCGMVYVDPKNLKYRPYWKKWVNQIPNKVEQYNLNSLFEKYVPYLMDVIVEGIVDGRQAEKLKTIVPQTDLNMVTQLAKMLDALLEGEIEDLDLLECYFLEALYCSLGASLLEDGRMKFDEYIKRLASLSTVDTEGVWANPGELPGQLPTLYDFHFDN--KRNQWVPWSKLVPEYIHAPERKFINILVHTVDTTRTTWILEQMVKIKQPVIFVGESGTSKTATTQNFLKNLSEETNIVLMVNFSSRTTSMDIQRNLEANVEKRTKDTYGPPMGKRLLVFMDDMNMPRVDEYGTQQPIALLKLLLEKGYLYDRGKELNCKSIRDLGFIAAMGKAGGGRNEVDPRFISLFSVFNVPFPSEESLHLIYSSILKGHTSTFHESIVAVSGKLTFCTLALYKNIVQDLPPTPSKFHYIFNLRDLSRVFNGLVLTNPERFQTVAQMVRVWRNECLRVFHDRLISETDKQLVQQHIGSLVVEHFKDDVEVVMRDPILFGDFQMALHEGEPRIYEDIQDYEAAKALFQEILEEYNESNTKMNLVLFDDALEHLTRVHRIIRMDRGHALLVGVGGSGKQSLSRLAAFTASCEVFEILLSRGYSENSFREDLKSLYLKLGIENKAMIFLFTDAHVAEEGFLELINNMLTSGIVPALFSEEEKESILSQIGQEALKQGMGPAKESVWQYFVNKSANNLHIVLGMSPVGDTLRTWCRNFPGMVNNTGIDWFMPWPPQALHAVAKSFLG-YNPMIPAENIENVVKHVVLVHQSVDHYSQQFLQKLRRSNYVTPKNYLDFINTYSKLLDEKTQCNIAQCKRLDGGLDKLKEATIQLDELNQKLAEQKIVLAEKSAACEALLEEIAVNTAVAEEKKKLAEEKAMEIEEQNKVIAMEKAEAETTLAEVMPILEAAKLELQKLDKSDVTEIRSFAKPPKQVQTVCECILIMKGYKELNWKTAKGVMSDPNFLRSLMEIDFDSITQSQVKNIKGLLKTLNTTTEEMEAVSKAGLGMLKFVEAVMGYCDVFREIKPKREKVARLERNFYLTKRELERIQNELAAIQKELETLGAKYEAAILEKQKLQEEAEIMERRLIAADKLISGLGSENIRWLNDLDELMHRRVKLLGDCLLCAAFLSYEGAFTWEFRDEMVNRIWQNDILEREIPLSQPFRLESLLTDDVEISRWGSQGLPPDELSVQNGILTTRASRFPLCIDPQQQALNWIKRKEEKNNLRVASFNDPDFLKQLEMSIKYGTPFLFRDVDEYIDPVIDNVLEKNIKVSQGRQFIILGDKEVDYDSNFRLYLNTKLANPRYSPSVFGKAMVINYTVTLKGLEDQLLSVLVAYERRELEEQREHLIQETSENKNLLKDLEDSLLRELATSTGNMLDNVDLVHTLEETKSKATEVSEKLKLAEKTALDIDRLRDGYRPAARRGAILFFVLSEMALVNSMYQYSLIAFLEVFRLSLKKSLPDSILMKRLRNIMDTLTFSIYNHGCTGLFERHKLLFSFNMTIKIEQAEGRVPQEELDFFLKGNISLEKSKRKKPCAWLSDQGWEDIILLSEMFSDNFGQLPDDVENNQTVWQEWYDLDSLEQFPVPLGYDNNITPFQKLLILRCFRVDRVYRAVTDYVTVTMGEKYVQPPMISFEAIFEQSTPHSPIVFILSPGSDPATDLMKLAERSGFGGNRLKFLAMGQGQEKVALQLLETAVARGQWLMLQNCHLLVKWLKDLEKSLERITKPHPDFRLWLTTDPTKGFPIGILQKSLKVVTEPPNGLKLNMRATYFKISHEMLDQCPHPAFKPLVYVLAFFHAVVQERRKFGKIGWNVYYDFNESDFQVCMEILNTYLTKAFQQRDPRIPWGSLKYLIGEVMYGGRAIDSFDRRILTIYMDEYLGDFIFDTFQPFHFFRNKEVDYKIPVGDEKEKFVEAIEALPLANTPEVFGLHPNAEIGYYTQAARDMWAHLLELQPQTGESSSGISRDDYIGQVAKEIENKMPKVFDLDQVRKRLGTGLSPTSVVLLQELERFNKLVVRMTKSLAELQRALAGEVGMSNELDDVARSLFIGHIPNIWRRLAPDTLKSLGNWMVYFLRRFSQYMLWVTESEPSVMWLSGLHIPESYLTALVQATCRKNGWPLDRSTLFTQVTKFQDADEVNERAGQGCFVSGLYLEGADWDIEKGCLIKSKPKVLVVDLPILKIIPIEAHRLKLQNTFRTPVYTTSMRRNAMGVGLVFEADLFTTRHISHWVLQGVCLTLNSD 3196          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Human
Match: DNAH2 (dynein axonemal heavy chain 2 [Source:HGNC Symbol;Acc:HGNC:2948])

HSP 1 Score: 2285.37 bits (5921), Expect = 0.000e+0
Identity = 1403/4071 (34.46%), Postives = 2228/4071 (54.73%), Query Frame = 1
Query: 1900 WSNFMEDFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEVESIDQLFKTNMNNPPLYHFKSCVAGGISWERHLFYNIKRPILRFLTMDEMMQSDNGKRIRTKYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILALANSENFVSENVPEETIDKMDDDLRVDFGFEINEIITETRNLELLGYKVPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISDY-IEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFKLQSGNKFLKCKEFFEFMESERTSDFEHLGRKYSTIGPLITKLQGEIIGDRDVNPFEKFQPFYEFWEKRIFDRVYNMVLK-NLQDYQNMLRDEN--FPTCLFEVDLMLAGTDVIGNPQTTEIYKLAIQDLRDAVEATRVFIRWKRNSCIETTGMKIDGQDELFYFTFYLDIGNSV-----EITYFCEQIANYYRNIIGKLRKYQDKWKKHKRVFIPNKQAQIDKWLTKDPTVMDFYERIRDTIDRKEELLNQPVIRKIGFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDLSLIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSNHPIDQEEIEESDKLRQ---LFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKN-----LDIKVLDEGIEGFLKEWRKMPREVK-----AMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSS-DCECVQEHMIKMFDNISSLRFTK--GTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVFFYRES-KVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIK-KGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLH-------TKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTRE-GMNQ-------DTIEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQ-YVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSE--NAKSDKDYAMTDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEY--SEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVA-SVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEA--SVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEV-AKRKKP-YLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLT--KPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTA-FPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQ-TGKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGEPNVM-WLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQR-----RNAMGVGLVVEADLATTEHPSHWVLQGVCLILNTD 13926
            W      FR  +  +E    + I + F  +R       +L  F  + SR+AI +   +K  D+   +  E+  +++  + N   P L  + +  +G   W   L   I R +        + +   GK     Y  + + +     K F EW   +DK     L   +L ++           +E    +D    V+F   +  +  E    E L ++ P    NVA + E    + E LL +   Y+ +I  L   E  +  + I+ + + I PGL++L+W   G S + I +C +     +  V      T+ I  + +E+    L ++ SG +  +  EF E     R +  + L   +  +  ++T    E+  + D    ++    Y     R+ +    + +K +L +    +  +    P  LF+V L++   D+ G+    E +   +Q L   V           N    T  +     D L     + +   +V     +I     QI++   N    L+ Y   W  ++ ++  NK + I ++   +P V  F   I    +    +  +  +  I F+ ++   L   +  H   W++ +   L E A   L  +   ++ +   +S  P  LEEL   L  +  ++      E++I  + E++ +L     P++   +E  D L     +F     +SK +   L   K KF         DF K      + F+ +G  +        L  + +    L  +      L A   +F +   P  +L N++KE+  L QI+E+    +   ENW E  WK      L  + ++    G  +   K+ +E K      + T R+   K+++FK  +PL SDL++ ALRERHW ++  +  + FD   ++FTL  +  + +++  + I EI  SA+KEL+IE  ++ + +TW   +  + PY   G  R   L   +EV Q L+DN + L +M ASRF+  F   V +WE+ LSLI EV+++ + VQR+WMYLE IF+G DIR QLP E+  FD ++  +K IM    K     ++   P  L  L  ++  LE  QKSL+ YL++KR+ FPRF+F+S+D+LL ILG S + E VQ H+ K FDNI  LR  K  G S +  A  M S + E ++F   V +EG VE W+  +E  MR T R + +      R+    R +W+ ++ G V +  +QI WT +V       K +  K  LK   K   + +++    +R  L+K  R K+  ++ I++HARD+++   +  +MD   F+W SQLRFYW ++ D+  I+Q   QF Y YEY+G +GRLVITPLTDR Y+TLT AL ++ GG+P GPAGTGKTET KDL KALG+  +V NC EG+DY+S+G++++GL Q GAWGCFDEFNRI + VLSV++ Q+  I + L   L+ FHF+G EI L    GIFITMNPGYAGRTELPE++K+ FRP+ ++VPD   I EI+LF +GF + K+LAKK+ TLY L+ +QLS+Q+HYDFGLRAL S+L  AG+ RR  PDL++++VL+ ++RDMN+ K    DAPLF  ++QDLFP ++ P + Y    ++VE+ + +           K+ QLYET  +RH+TM+VG TG GK+   +IL AS + L           +  P+NPK  S+ ELYG  D +T +WTDG+LS++ R      +K + +++LFDG VD LW+ENMNSVMDDNK+LTL NGERI +    +LLFEV DL  ASPATVSRCGMVY D  +LG+ P+ Q WL K+  K E + L  +++K I           M     +  K ++PL   + +T LC +     T E G+N          +E  F+ S+ WS+   + E+ + + D +++ +               G  P++  T+++Y+ D   + + W  + + +P+ + + P   F +I+VPT+DTVR  +L++  +  Q P+LLVG  GT KT+++Q+ L++    ++  L +N S++TTS ++Q  +ES VEKRTK  Y P  GK ++ F+DD+NMP  D +G+Q P+ +++L ++    YDR K    K ++++  +AAMG PGGGR  + PR  S F++ N TFP+KS +  I+ ++++   Q F +E+K    ++T+ T+ +YN ++ +  PTP+K HY+FNLRD+S+++QGM +   D         R+W HE  RV  DRL++  D       I ++L    +           P +FGD+     + E ++YED+ +    K + +  + EY  S +V PM+LVLF +A++H+TRI R I    G+ LLVG+GGSG+QSL +LA+       F+I +++ Y +++ R+++K LY + G+E K+T F+F D  + +E FLE INN+LSSG VP L+  DE E I S + ++A    +  S +S++ Y + +  +NLHIVLC+SP+G+  R   R +P +VN TTI+WF  WP++AL  VA    IG +     +  R ++ + FV +H SV +YS++ + + RR NYVTP  YL+ ++ Y KLL +K +   +Q ++L+ GL K+ E    VQ+  L  + A +KVA  +K   CE  L  I  + + A E+++     S+ + V+  + +     A+  L EALP LE+A  AL+ L K D+ EI+S+ +PP  V++V + + + +   E  W  AK  + + +F++SL   D DNI+ K    +     +     D +  VS A   L  +V A+  Y  + R ++PKR ++        + +  L + + ++ ++  +L+ L ++Y+  + +++ L+++++ M+ +L  A  L++GL+ E  RW   +Q L++    L+GDCL+ +AFLSY+G F   +R E+V   W   + E ++P S  F +++ L N  ++  WN +GLP D  S +NGI+ TR +R+ L IDPQ QAL WI   E    LK       D+L+ LE AI +G P L ++V EY+DP ++ +L K++    GR  + +GDKEV+++ NFR Y+ TKLSNP Y P    K+ ++N+ V  +GLE QLL ++V+ ER ELEEQ++ L+   +  KR LK+LED +LR L  +TG++LD+ +L+NTL  +K  A+EV+E+L+    T    D  R+ YR  A+R +ILFFVL +M  I+ MYQ+SL AY+ +F  S+ KS     L+ R+  +    T  VY Y C  +FE+HKLLF+F +  K+    G L  DE +FF++G   ++   +   P   WL+D  W ++T+L ++    F  L+   E+    W  W  +  PE A LP ++ N     Q++ ++R  R DR+   +T ++I  +G  ++ PP+LN + + + STP SP+VFILSPG DP S +++LAE  G    +   +S+GQGQ   A  LL   + +GHW+ L NCHL + W+  L+K +E+L    PHP FRLWL++ P   FPI ILQ S+K+ TEPP GLK N+   Y+ ++    +  +  A +  L+F+L FFH+V+ ER+K+ ++GWNI Y FN+SDF V   +L  YL +  +      PW +LKYLI  + YGG   DD+DRR+L TY+++YF D    T  PFH   S   TY IP+  +     +YI  LP  + PE FG H NA++    + A+ ++  L+ +QPQ T      Q+R+E + E A+ +K K+P++ D +  +K   LD SP  VVLLQE++R+N L+  +  SL  L + + G + MS  L+++   +++  +P +W +  P + K LA W      R  Q+  W     P V+ WLSG   P  +LTA++Q++ R+N   +D S  +  +      + +      G +V GLYLEGAGWDR   CLV  +P QL+  +P I   P E+ +   +  +  P Y    R     R +  +G+ + +   T   P HW+ +G  L+++ D
Sbjct:  453 WHEDYNKFRAGIKDLEVMTQNLITSAFELVRDVPHGVLLLDTFHRLASREAIKRTYDKKAVDLYMLFNSELALVNR--ERNKKWPDLEPYVAQYSGKARWVHILRRRIDRVMTCLAGAHFLPRIGTGKESVHTYQQMVQAIDELVRKTFQEWTSSLDKDCIRRLDTPLLRIS-----------QEKAGMLD----VNFDKSLLILFAEIDYWERLLFETPHYVVNVAERAEDLRILRENLLLVARDYNRIIAMLSPDEQALFKERIRLLDKKIHPGLKKLHWALKGASAFFITECRIHASKVQMIVNEFKASTLTIGWRAQEMSEKLLVRI-SGKRVYRDLEFEEDQREHRAAVQQKLMNLHQDVVTIMTN-SYEVFKN-DGPEIQQQWMLYMIRLDRMMEDALRLNVKWSLLELSKAINGDGKTSPNPLFQV-LVILKNDLQGSVAQVE-FSPTLQTLAGVVNDIG-------NHLFSTISVFCHLPDILTKRKLHREPIQTVVEQDEDIKKIQTQISSGMTNNASLLQNYLKTWDMYREIWEINKDSFIHRYQRLNPPVSSFVADIARYTEVANNVQKEETVTNIQFVLLDCSHLKFSLVQHCNEWQNKFATLLREMAAGRLLELHTYLKENAEKISRPPQTLEELGVSLQLVDALKHDLANVETQIPPIHEQFAILEKYEVPVEDSVLEMLDSLNGEWVVFQQTLLDSKQM---LKKHKEKFKTGLIHSADDFKKKAHTLLEDFEFKGHFTSNVGYMSALDQITQVRAMLMAMREEENSLRANLGIFKIEQPPSKDLQNLEKELDALQQIWEI---ARDWEENWNE--WKTGRFLILQTETMETTAHGLFRRLTKLAKEYKDRNWEIIETTRS---KIEQFKRTMPLISDLRNPALRERHWDQVRDEIQREFDQESESFTLEQIVELGMDQHVEKIGEISASATKELAIEVALQNIAKTWDVTQLDIVPYKDKGHHR---LRGTEEVFQALEDNQVALSTMKASRFVKAFEKDVDHWERCLSLILEVIEMILTVQRQWMYLENIFLGEDIRKQLPNESTLFDQVNSNWKAIMDRMNKDNNALRSTHHPGLLDTLIEMNTILEDIQKSLDMYLETKRHIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKLLRIQKVGGPSSKWEAVGMFSGDGEYIDFLHSVFLEGPVESWLGDVEQTMRVTLRDLLRNCHLALRKFLNKRDKWVKEWAGQVVITASQIQWTADVTKCLLTAKERADKKILKVMKKNQVSILNKYSEAIRGNLTKIMRLKIVALVTIEIHARDVLEKLYKSGLMDVNSFDWLSQLRFYWEKDLDDCVIRQTNTQFQYNYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGIYVIVVNCSEGLDYKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAHQILCILSALAAGLTHFHFDGFEINLVWSCGIFITMNPGYAGRTELPENLKSMFRPIAMVVPDSTLIAEIILFGEGFGNCKILAKKVYTLYSLAVQQLSRQDHYDFGLRALTSLLRYAGKKRRLQPDLTDEEVLLLSMRDMNIAKLTSVDAPLFNAIVQDLFPNIELPVIDYGKLRETVEQEIRDMGLQSTPFTLTKVFQLYETKNSRHSTMIVGCTGSGKTASWRILQASLSSLCRAGDPNFNIVREFPLNPKALSLGELYGEYDLSTNEWTDGILSSVMRTACA-DEKPDEKWILFDGPVDTLWIENMNSVMDDNKVLTLINGERIAMPEQVSLLFEVEDLAMASPATVSRCGMVYTDYADLGWKPYVQSWLEKRP-KAEVEPLQRMFEKLI---------NKMLAFKKDNCKELVPLPEYSGITSLCKLYSALATPENGVNPADGENYVTMVEMTFVFSMIWSVCASVDEEGRKRIDSYLREI--------------EGSFPNK-DTVYEYFVDP--KIRSWTSFEDKLPKSWRYPPNAPFYKIMVPTVDTVRYNYLVSSLVANQNPILLVGPVGTGKTSIAQSVLQSLPSSQWSVLVVNMSAQTTSNNVQSIIESRVEKRTKGVYVPFGGKSMITFMDDLNMPAKDMFGSQPPLELIRLWIDYGFWYDRTKQ-TIKYIREMFLMAAMGPPGGGRTVISPRLRSRFNIINMTFPTKSQIIRIFGTMINQKLQDFEEEVKPIGNVVTEATLDMYNTVVQRFLPTPTKMHYLFNLRDISKVFQGMLRANKDFHDTKSSITRLWIHECFRVFSDRLVDAADTEAFMGIISDKLGSFFDLTFHHLCPSKRPPIFGDF-----LKEPKVYEDLTDLTVLKTVMETALNEYNLSPSVVPMQLVLFREAIEHITRIVRVIGQPRGNMLLVGIGGSGRQSLARLASSICDYTTFQIEVTKHYRKQEFRDDIKRLYRQAGVELKTTSFIFVDTQIADESFLEDINNILSSGEVPNLYKPDEFEEIQSHIIDQARVEQVPESSDSLFAYLIERVQNNLHIVLCLSPMGDPFRNWIRQYPALVNCTTINWFSEWPQEALLEVAEKCLIGVDLGTQENIHR-KVAQIFVTMHWSVAQYSQKMLLELRRHNYVTPTKYLELLSGYKKLLGEKRQELLAQANKLRTGLFKIDETREKVQVMSLELEDAKKKVAEFQKQ--CEEYLVIIVQQKREADEQQKAVTANSEKIAVEEIKCQALADNAQKDLEEALPALEEAMRALESLNKKDIGEIKSYGRPPAQVEIVMQAVMILRG-NEPTWAEAKRQLGEQNFIKSLINFDKDNISDKVLKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAALAQLREKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEETVQGLEEDLGYLVGDCLLAAAFLSYMGPFLTNYRDEIVNQIWIGKIWELQVPCSPSFAIDNFLCNPTKVRDWNIQGLPSDAFSTENGIIVTRGNRWALMIDPQAQALKWIKNMEGGQGLKIIDLQMSDYLRILEHAIHFGYPVLLQNVQEYLDPTLNPMLNKSVARIGGRLLMRIGDKEVEYNTNFRFYITTKLSNPHYSPETSAKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIAAGKRKLKELEDEILRLLNEATGSLLDDVQLVNTLHTSKITATEVTEQLETSETTEINTDLAREAYRPCAQRASILFFVLNDMGCIDPMYQFSLDAYISLFILSIDKSHRSNKLEDRIDYLNDYHTYAVYRYTCRTLFERHKLLFSFHMCAKILETSGKLNMDEYNFFLRGGVVLDREGQMDNPCSSWLADAYWDNITELDKL--TNFHGLMNSFEQYPRDWHLWYTNAAPEKAMLPGEWENACNEMQRMLIVRSLRQDRVAFCVTSFIITNLGSRFIEPPVLNMKSVLEDSTPRSPLVFILSPGVDPTSALLQLAEHMGMA-QRFHALSLGQGQAPIAARLLREGVTQGHWVFLANCHLSLSWMPNLDKLVEQLQVEDPHPSFRLWLSSIPHPDFPISILQVSIKMTTEPPKGLKANMTRLYQLMSEPQFSRCSKPAKYKKLLFSLCFFHSVLLERKKFLQLGWNIIYGFNDSDFEVSENLLSLYLDEYEE-----TPWDALKYLIAGINYGGHVTDDWDRRLLTTYINDYFCDQSLST--PFH-RLSALETYFIPKDGSLASYKEYISLLPGMDPPEAFGQHPNADVASQITEAQTLFDTLLSLQPQITPTRAGGQTREEKVLELAADVKQKIPEMIDYEGTQKLLALDPSPLNVVLLQEIQRYNTLMQTILFSLTDLEKGIQGLIVMSTSLEEIFNCIFDAHVPPLWGKAYP-SQKPLAAWTRDLAMRVEQFELWASRARPPVIFWLSGFTFPTGFLTAVLQSSARQNNVSVD-SLSWEFIVSTVDDSNLVYPPKDGVWVRGLYLEGAGWDRKNSCLVEAEPMQLVCLMPTIHFRPAESRKKSAKGMYSCPCYYYPNRAGSSDRASFVIGIDLRSGAMT---PDHWIKRGTALLMSLD 4426          

HSP 2 Score: 75.0998 bits (183), Expect = 4.424e-12
Identity = 55/201 (27.36%), Postives = 104/201 (51.74%), Query Frame = 1
Query:  901 RDEFLISLKKFTSIVDQTIIQIASEVKLEIPDLDLFENDKENLSDKEIMEMIESTVLKWDQQITGTLESLQKIVPHGPS--PLAEIDFWRERNAXXXXXXXXXXXPKVKRILNLYSLAEGPV---FDTQNNELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIA 1488
            R+ F   L KF + +  T  ++     L IP   +    +  + DKE+++ +E++++ W +QI   L S Q+ V  G +  PL EI+FWR R   LS + +QL    VK + ++  LA+      F     ++     +A+ N  FLS+++  ++ +A+ +    ++  +P ++  +R+IW+ S HYN  ER+  L  ++ 
Sbjct:  194 RNHFASHLHKFLACLTDTRYKLEGHTVLYIPAEAMNMKPEMVIKDKELVQRLETSMIHWTRQIKEML-SAQETVETGENLGPLEEIEFWRNRCMDLSGISKQLVKKGVKHVESILHLAKSSYLAPFMKLAQQIQDGSRQAQSNLTFLSILKEPYQELAF-MKPKDISSKLPKLISLIRIIWVNSPHYNTRERLTSLFRKVC 392          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 1300.8 bits (3365), Expect = 0.000e+0
Identity = 951/3334 (28.52%), Postives = 1662/3334 (49.85%), Query Frame = 1
Query: 4147 GLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYP------------ELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIG-GDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSS-DCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQEIMEFRSPVLIEG-RVEDWMTKIEMEMRRT-NRVITKEAVFFYRESKVRVQ---------WMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYW-LREADEIQ---IQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLS-RFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRND---------PDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQA-------DKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQ-LHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREI--NKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLN-----------------------------KKENKFENDTLAGL-YKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTR-----EGMNQDTIEAIFIQS---------IYWSLGGCLIEDSQVKFDQFIK--SLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQY-VHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVE-KRTKDSY--GP-PMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGG-GRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKF------HYIFNLRDLSRIYQGMCQ--TTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIE---EQLSENAKSDKDYAMTDPILFGDY--RNALEVAEVRLYEDMINYEAA--KGLFQEIMEEYSEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGM-GPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAV----------------ASVFIGPENSLIPDDQ--RIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSE--CIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPM-SDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKS--LPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLF----------------TFQITLKLEMDKGNLT--QDELDFFIKGNTSIEVAKRKKPYLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCL-------LRCFRIDRI----YRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEAN-AKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLTKPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQG-----DSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKF---ATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQT------GKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQ--WVENGEPNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSV 13590
             L V+  F  +L  +   R ++  A    +L  + +             EL  ++   K L  +Y   D  K       E  W ++  + + + ++  + + +++P + +   +  ++ + L  +     L ++LK EAL+ERHW ++M +   N++++    TL  V+  ++ R +  I +I+  A  E+++E+ +RE+ E W   +  +  Y    + +  ++   D++   L ++  +L +M  S +   F  S Q+W++ L+ I+ + DVW+ VQR+W+YLEG+F G  +I + LP E+ +F  I      +M + A  P I     +      L  L+D L K QK+L +YL+ +R++FPRF+F+ D++LL I+G+S D   +Q+H+ KMF  I+++   +    + S TA  S E E ++    V  +  R+ DW+  +E EM+ T  R +      F   SK+ +Q         W+  +   V   T +IWW  E+E       KG +   +   K L    D  V   + P+ +     L T L   VH RD     V   I  A +F W   +RFY+  ++ D ++   ++    QF YG+EY+G+  RLV TPLTDR YLT+TQAL   LGG+P GPAGTGKTE+ K L   LG   +V NC E  D++++G+I  GLCQ GAWGCFDEFNR+E  +LS +S Q++TIQ  +           G+ + ++S +GIFITMNPGY+GR+ LP+++K  FR + +  PD Q I ++MLFSQGF +A+ LA K+  L+ L KEQLS Q HYDFGLRALK VLV AG ++R+           D++E ++L++++ +  +PK + ED  L   L+ D+FPG+     +  +    +     EH  I    Q        DK++QLY+     H  M+VG +G GK++  K+L  +  + + +      ++ K  S   LYG++DPNTR+WTDGL +++ R+I  N   + + R++++FDGDVD  WVEN+NSV+DDNKLLTL NGER+ +  +  ++FEV DL+YA+ ATVSRCGMV+   + +     ++ +L+                             K     E    A L  + +  P  D ++ G +   AV +L+ I+P T   L++   +M+   + +     EG+  D++E   IQS         + W+  G     S+     FI+  +  ++P              P++   L DY    ++   +W PW + VP   + +     ++++VPTIDTVR   LL   +   +P++L G  G+ KT      LR+    + +   +NFSS TT   + R  +   E +RT +     P  + + L++F D++N+P  D+YGTQ+ I+ L+ ++E  G Y R  D +W  ++ I F+ A   P   GR+ +  RF+    +    +P ++SL  IY +        F+  +    P +  +   + N ++     +   F      HY+++ R+L+R  +G+ +  T L+  + ++Q  R+W HE  R+  DRL+ ++++ +  K ++   E+   NA    D A+  P+L+  +  RN + V      E++ +Y +A  KG ++E ++        +KLVLFD  LDH+ RI R  R   GH LL+G  G+GK +L++  A+     +F++ +   Y+  D  E+++T+  + G  N+   F+  + ++++ GFLE +N +L++G VP LF  DE   +++Q++  A   G+   S + ++++F  +   NLH+V  M+P G  LR R    P + N   ++WF  W E ALY V                 SV + P   L+P     R  +V    +VH +V+++++   +K  R    TP+++LDFI  ++ L  +K    E +   L  GL K++E   Q+ EL   L ++   + EK  A    LKE+    Q A E+K+ +++  + +  Q K++ ++K   E  L +  P + +A+ A+  ++K+ +VE++S + PP  V++  E  CI + +N    +WK  + +M    F+  +   D + +T +    +   +       D++   S A   ++K+  A L Y+ +  +++P R ++ RLE+   +  +E + V   I +LE  +    + Y   I + + ++++   +Q ++N + +L++ L SE  RW         Q   L+GD L+ SAFL+Y G +    R E ++ +W + VV   +    D  R+E + T D  + +W    LP D+L  +N I+  R +R+PL IDP  QA+ +IM++    N++  +F D  F K LE A+++G   L +DV+ Y DP+++ VL + +K   GR  + +GD+++D  P+F++++ T+ S  ++ P+I  +   +N+TVT   L  Q L+ +++ ER +++++R  L++   +    L+ LE +LL  L  S G +LD+  +I TLE+ K++A+EV++K     +   E+D     Y+  +   + ++  L +++ I+ +Y YSL   +++F   LK        +  KRL+ + ++L + V+     G+    K+L                  ++    L + + +     DE D  I G       + KK            + K  ++  + F  +   ++ +  +   W+ ++ PE+  +P  + +  G    LC+       +   R DR+    +R ++    +   ++     IL+   + ++ +P  P++   + G D +  +  LA  +     +L  I++G  +  N A   L  A   G W++L+N HL   WL +LEK L  + KPH  FRL+LT E     P  IL+ S  VV EP  GLK NL  +   I    L     T    L   + + HA+VQER +Y  +GW+  Y+F+++D RV    L   +   A QG       ++PW +L+ L+ + +YGG+  + FD+ +L   ++  F      +F+  H    K+    +   P     D  + ++E L  E  P   GL +NAE    T   + M   ++ +  +       GK          + E A      LPK  ++ ++R+       P      +E+   + L+  + + L+ +      E   + E   +A SL  G++P  WKR       ++ +W+T  N+R  Q  +    +N +    WL G   PE+Y+TA  Q   + N W L++  L+  +
Sbjct: 1243 ALNVITAFEAKLNKLTEERNKMRKARVALDLSDSAHAPSEGDKLTVATEELAAMKDVWKALQPVYTGIDEAK-------EKTWLSVQPRKIRQSLDELMNQLKQLPVKCRTYKSYEHVKQMLHTYGKMNMLVAELKSEALKERHWHQMMKEMRVNWNLS--DLTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNY----QNKTRLIKGWDDLFNKLKEHQNSLSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDVVNMQGAQRLLERLADMLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDINEE---DRSITAFHSREGEKVDLVKIVSTKDVRINDWLQALEAEMKHTLARQLAASLTHF---SKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLAD-GKGAENVEQAVVKTLELLADS-VLKEQPPIRRKKMEALITEL---VHKRDTCRKLVSMKIRAANDFGWLQCMRFYFDPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKALERWENVEGVAHVIDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVWFSEEVVTSEMLFERYLSIIRRVPLDSDSAISFSSSSAPVNLIGEDAKPTRSIEIQRTAALALQTHFSP--DGIVPGSLK-YAVSELEHIMPPTPQRLLSSFFSMMSYSIRKIVSHDEGLIDDSVEIDQIQSFVLRSMLTNLVWAFSGDGKWKSREMMSDFIRQATTISLP--------------PNQQACLIDY---EVQLSGDWQPWLSKVPTMEIESHRVAAADLVVPTIDTVRHEMLLAAWLAEHKPLVLCGPPGSGKTMTLLAALRSQQEMEVVN--VNFSSSTTPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFY-RTSDHSWVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIYGT--------FNRAMLKMTPAVRGLADQLTNAMVDVYLASQEHFTQDDQPHYVYSPRELTRWVRGISEAITPLESLS-AEQLVRLWAHEAIRLFQDRLVTEEEREWTDKLVDTTAERYFGNA-CRLDEALKRPLLYSCWLSRNYVPVTR----EELQDYVSARLKGFYEEELD--------VKLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQIKEGAQRQGLILDSHDELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTVQKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGDQQKAEEEKKFSEQLQKELAEQLKQMAEKKTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILLGENVG-TDWKAIRQVMMKDDFMTRILQFDTELLTPEILKQMEKYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLRNELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDE-IFHKWFNHVVNAGLHFRHDLARIEYLSTVDDRL-QWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMKQFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDVEAY-DPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLLALLLMRIHIRSNPSAPAYEQHFDLLLGRSDFVAKNDEADSTIPGGLDFLTVENKK-----------SIAKARKV--VGFENVFAHLQHNSAAVTSWLTNDNPES-NVPVVWDDADGKLSPLCIAMNSLIVVHALRPDRLMASAHRVVSTAFDDHFMQQDKVVDILSI--VDNEVSPSEPVLLCSATGYDASGKIEDLAVETN---RQLTSIAIGSAEGFNQADSALGTATKSGRWVLLKNVHLAPSWLAQLEKRLHSM-KPHAQFRLFLTAEIHPKLPSSILRASRVVVFEPATGLKANLLRSLSSIPPQRLTK-APTERSRLYLLVCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDAAVDAVA-QGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTA---KSFEQDHVLIPKYDGDDSLFTPNMSKKDQMIGWVEELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNMLKVTDEELAFNEDGKEEVKPQWMAQLGELAKQWLQLLPK--EIVKMRRTVENIKDPLFRFFEREVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVMDWMTDLNERLKQLIRIGGADNLKRETFWLGGTFSPEAYITATRQQVAQANTWSLEQLNLHIHI 4476          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 1300.8 bits (3365), Expect = 0.000e+0
Identity = 951/3334 (28.52%), Postives = 1662/3334 (49.85%), Query Frame = 1
Query: 4147 GLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYP------------ELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIG-GDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSS-DCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQEIMEFRSPVLIEG-RVEDWMTKIEMEMRRT-NRVITKEAVFFYRESKVRVQ---------WMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYW-LREADEIQ---IQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLS-RFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRND---------PDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQA-------DKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQ-LHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREI--NKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLN-----------------------------KKENKFENDTLAGL-YKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTR-----EGMNQDTIEAIFIQS---------IYWSLGGCLIEDSQVKFDQFIK--SLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQY-VHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVE-KRTKDSY--GP-PMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGG-GRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKF------HYIFNLRDLSRIYQGMCQ--TTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIE---EQLSENAKSDKDYAMTDPILFGDY--RNALEVAEVRLYEDMINYEAA--KGLFQEIMEEYSEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGM-GPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAV----------------ASVFIGPENSLIPDDQ--RIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSE--CIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPM-SDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKS--LPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLF----------------TFQITLKLEMDKGNLT--QDELDFFIKGNTSIEVAKRKKPYLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCL-------LRCFRIDRI----YRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEAN-AKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLTKPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQG-----DSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKF---ATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQT------GKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQ--WVENGEPNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSV 13590
             L V+  F  +L  +   R ++  A    +L  + +             EL  ++   K L  +Y   D  K       E  W ++  + + + ++  + + +++P + +   +  ++ + L  +     L ++LK EAL+ERHW ++M +   N++++    TL  V+  ++ R +  I +I+  A  E+++E+ +RE+ E W   +  +  Y    + +  ++   D++   L ++  +L +M  S +   F  S Q+W++ L+ I+ + DVW+ VQR+W+YLEG+F G  +I + LP E+ +F  I      +M + A  P I     +      L  L+D L K QK+L +YL+ +R++FPRF+F+ D++LL I+G+S D   +Q+H+ KMF  I+++   +    + S TA  S E E ++    V  +  R+ DW+  +E EM+ T  R +      F   SK+ +Q         W+  +   V   T +IWW  E+E       KG +   +   K L    D  V   + P+ +     L T L   VH RD     V   I  A +F W   +RFY+  ++ D ++   ++    QF YG+EY+G+  RLV TPLTDR YLT+TQAL   LGG+P GPAGTGKTE+ K L   LG   +V NC E  D++++G+I  GLCQ GAWGCFDEFNR+E  +LS +S Q++TIQ  +           G+ + ++S +GIFITMNPGY+GR+ LP+++K  FR + +  PD Q I ++MLFSQGF +A+ LA K+  L+ L KEQLS Q HYDFGLRALK VLV AG ++R+           D++E ++L++++ +  +PK + ED  L   L+ D+FPG+     +  +    +     EH  I    Q        DK++QLY+     H  M+VG +G GK++  K+L  +  + + +      ++ K  S   LYG++DPNTR+WTDGL +++ R+I  N   + + R++++FDGDVD  WVEN+NSV+DDNKLLTL NGER+ +  +  ++FEV DL+YA+ ATVSRCGMV+   + +     ++ +L+                             K     E    A L  + +  P  D ++ G +   AV +L+ I+P T   L++   +M+   + +     EG+  D++E   IQS         + W+  G     S+     FI+  +  ++P              P++   L DY    ++   +W PW + VP   + +     ++++VPTIDTVR   LL   +   +P++L G  G+ KT      LR+    + +   +NFSS TT   + R  +   E +RT +     P  + + L++F D++N+P  D+YGTQ+ I+ L+ ++E  G Y R  D +W  ++ I F+ A   P   GR+ +  RF+    +    +P ++SL  IY +        F+  +    P +  +   + N ++     +   F      HY+++ R+L+R  +G+ +  T L+  + ++Q  R+W HE  R+  DRL+ ++++ +  K ++   E+   NA    D A+  P+L+  +  RN + V      E++ +Y +A  KG ++E ++        +KLVLFD  LDH+ RI R  R   GH LL+G  G+GK +L++  A+     +F++ +   Y+  D  E+++T+  + G  N+   F+  + ++++ GFLE +N +L++G VP LF  DE   +++Q++  A   G+   S + ++++F  +   NLH+V  M+P G  LR R    P + N   ++WF  W E ALY V                 SV + P   L+P     R  +V    +VH +V+++++   +K  R    TP+++LDFI  ++ L  +K    E +   L  GL K++E   Q+ EL   L ++   + EK  A    LKE+    Q A E+K+ +++  + +  Q K++ ++K   E  L +  P + +A+ A+  ++K+ +VE++S + PP  V++  E  CI + +N    +WK  + +M    F+  +   D + +T +    +   +       D++   S A   ++K+  A L Y+ +  +++P R ++ RLE+   +  +E + V   I +LE  +    + Y   I + + ++++   +Q ++N + +L++ L SE  RW         Q   L+GD L+ SAFL+Y G +    R E ++ +W + VV   +    D  R+E + T D  + +W    LP D+L  +N I+  R +R+PL IDP  QA+ +IM++    N++  +F D  F K LE A+++G   L +DV+ Y DP+++ VL + +K   GR  + +GD+++D  P+F++++ T+ S  ++ P+I  +   +N+TVT   L  Q L+ +++ ER +++++R  L++   +    L+ LE +LL  L  S G +LD+  +I TLE+ K++A+EV++K     +   E+D     Y+  +   + ++  L +++ I+ +Y YSL   +++F   LK        +  KRL+ + ++L + V+     G+    K+L                  ++    L + + +     DE D  I G       + KK            + K  ++  + F  +   ++ +  +   W+ ++ PE+  +P  + +  G    LC+       +   R DR+    +R ++    +   ++     IL+   + ++ +P  P++   + G D +  +  LA  +     +L  I++G  +  N A   L  A   G W++L+N HL   WL +LEK L  + KPH  FRL+LT E     P  IL+ S  VV EP  GLK NL  +   I    L     T    L   + + HA+VQER +Y  +GW+  Y+F+++D RV    L   +   A QG       ++PW +L+ L+ + +YGG+  + FD+ +L   ++  F      +F+  H    K+    +   P     D  + ++E L  E  P   GL +NAE    T   + M   ++ +  +       GK          + E A      LPK  ++ ++R+       P      +E+   + L+  + + L+ +      E   + E   +A SL  G++P  WKR       ++ +W+T  N+R  Q  +    +N +    WL G   PE+Y+TA  Q   + N W L++  L+  +
Sbjct: 1243 ALNVITAFEAKLNKLTEERNKMRKARVALDLSDSAHAPSEGDKLTVATEELAAMKDVWKALQPVYTGIDEAK-------EKTWLSVQPRKIRQSLDELMNQLKQLPVKCRTYKSYEHVKQMLHTYGKMNMLVAELKSEALKERHWHQMMKEMRVNWNLS--DLTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNY----QNKTRLIKGWDDLFNKLKEHQNSLSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDVVNMQGAQRLLERLADMLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDINEE---DRSITAFHSREGEKVDLVKIVSTKDVRINDWLQALEAEMKHTLARQLAASLTHF---SKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLAD-GKGAENVEQAVVKTLELLADS-VLKEQPPIRRKKMEALITEL---VHKRDTCRKLVSMKIRAANDFGWLQCMRFYFDPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKALERWENVEGVAHVIDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVWFSEEVVTSEMLFERYLSIIRRVPLDSDSAISFSSSSAPVNLIGEDAKPTRSIEIQRTAALALQTHFSP--DGIVPGSLK-YAVSELEHIMPPTPQRLLSSFFSMMSYSIRKIVSHDEGLIDDSVEIDQIQSFVLRSMLTNLVWAFSGDGKWKSREMMSDFIRQATTISLP--------------PNQQACLIDY---EVQLSGDWQPWLSKVPTMEIESHRVAAADLVVPTIDTVRHEMLLAAWLAEHKPLVLCGPPGSGKTMTLLAALRSQQEMEVVN--VNFSSSTTPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFY-RTSDHSWVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIYGT--------FNRAMLKMTPAVRGLADQLTNAMVDVYLASQEHFTQDDQPHYVYSPRELTRWVRGISEAITPLESLS-AEQLVRLWAHEAIRLFQDRLVTEEEREWTDKLVDTTAERYFGNA-CRLDEALKRPLLYSCWLSRNYVPVTR----EELQDYVSARLKGFYEEELD--------VKLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQIKEGAQRQGLILDSHDELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTVQKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGDQQKAEEEKKFSEQLQKELAEQLKQMAEKKTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILLGENVG-TDWKAIRQVMMKDDFMTRILQFDTELLTPEILKQMEKYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLRNELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDE-IFHKWFNHVVNAGLHFRHDLARIEYLSTVDDRL-QWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMKQFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDVEAY-DPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLLALLLMRIHIRSNPSAPAYEQHFDLLLGRSDFVAKNDEADSTIPGGLDFLTVENKK-----------SIAKARKV--VGFENVFAHLQHNSAAVTSWLTNDNPES-NVPVVWDDADGKLSPLCIAMNSLIVVHALRPDRLMASAHRVVSTAFDDHFMQQDKVVDILSI--VDNEVSPSEPVLLCSATGYDASGKIEDLAVETN---RQLTSIAIGSAEGFNQADSALGTATKSGRWVLLKNVHLAPSWLAQLEKRLHSM-KPHAQFRLFLTAEIHPKLPSSILRASRVVVFEPATGLKANLLRSLSSIPPQRLTK-APTERSRLYLLVCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDAAVDAVA-QGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTA---KSFEQDHVLIPKYDGDDSLFTPNMSKKDQMIGWVEELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNMLKVTDEELAFNEDGKEEVKPQWMAQLGELAKQWLQLLPK--EIVKMRRTVENIKDPLFRFFEREVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVMDWMTDLNERLKQLIRIGGADNLKRETFWLGGTFSPEAYITATRQQVAQANTWSLEQLNLHIHI 4476          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 1299.65 bits (3362), Expect = 0.000e+0
Identity = 947/3325 (28.48%), Postives = 1661/3325 (49.95%), Query Frame = 1
Query: 4147 GLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYP-----ELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIG-GDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSS-DCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQEIMEFRSPVLIEG-RVEDWMTKIEMEMRRT-NRVITKEAVFFYRESKVRVQ---------WMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYW-LREADEIQ---IQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLS-RFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRND---------PDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQA-------DKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQ-LHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREI--NKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLN-----------------------------KKENKFENDTLAGL-YKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTR-----EGMNQDTIEAIFIQS---------IYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQY-VHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVE-KRTKDSY--GP-PMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGG-GRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKF------HYIFNLRDLSRIYQGMCQ--TTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIE---EQLSENAKSDKDYAMTDPILFGDY--RNALEVAEVRLYEDMINYEAA--KGLFQEIMEEYSEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGM-GPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAV----------------ASVFIGPENSLIPDDQ--RIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSE--CIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPM-SDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKS--LPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLF----------------TFQITLKLEMDKGNLT--QDELDFFIKGNTSIEVAKRKKPYLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCL-------LRCFRIDRI----YRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEAN-AKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLTKPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQG-----DSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKF---ATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQT------GKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQ--WVENGEPNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSV 13590
             L V+  F  +L  +   R ++  A    +L  + +      +L    +E+  +  +++         +   E  W ++  + + + ++  + + +++P + +   +  ++ + L  +     L ++LK EAL+ERHW ++M +   N++++    TL  V+  ++ R +  I +I+  A  E+++E+ +RE+ E W   +  +  Y    + +  ++   D++   L ++  +L +M  S +   F  S Q+W++ L+ I+ + DVW+ VQR+W+YLEG+F G  +I + LP E+ +F  I      +M + A  P I     +      L  L+D L K QK+L +YL+ +R++FPRF+F+ D++LL I+G+S D   +Q+H+ KMF  I+++   +    + S TA  S E E ++    V  +  R+ DW+  +E EM+ T  R +      F   SK+ +Q         W+  +   V   T +IWW  E+E       KG +   +   K L    D  V   + P+ +     L T L   VH RD     V   I  A +F W   +RFY+  ++ D ++   ++    QF YG+EY+G+  RLV TPLTDR YLT+TQAL   LGG+P GPAGTGKTE+ K L   LG   +V NC E  D++++G+I  GLCQ GAWGCFDEFNR+E  +LS +S Q++TIQ  +           G+ + ++S +GIFITMNPGY+GR+ LP+++K  FR + +  PD Q I ++MLFSQGF +A+ LA K+  L+ L KEQLS Q HYDFGLRALK VLV AG ++R+           D++E ++L++++ +  +PK + ED  L   L+ D+FPG+     +  +    +     EH  I    Q        DK++QLY+     H  M+VG +G GK++  K+L  +  + + +      ++ K  S   LYG++DPNTR+WTDGL +++ R+I  N   + + R++++FDGDVD  WVEN+NSV+DDNKLLTL NGER+ +  +  ++FEV DL+YA+ ATVSRCGMV+   + +     ++ +L+                             K     E    A L  + +  P  D ++ G +   AV +L+ I+P T   L++   +M+   + +     EG+  D++E   IQS         + W+  G     S+     FI+      Q+     P      P++   L DY    ++   +W PW + VP   + +     ++++VPTIDTVR   LL   +   +P++L G  G+ KT      LR+    + +   +NFSS TT   + R  +   E +RT +     P  + + L++F D++N+P  D+YGTQ+ I+ L+ ++E  G Y R  D +W  ++ I F+ A   P   GR+ +  RF+    +    +P ++SL  IY +        F+  +    P +  +   + N ++     +   F      HY+++ R+L+R  +G+ +  T L+  + ++Q  R+W HE  R+  DRL+ ++++ +  K ++   E+   NA    D A+  P+L+  +  RN + V      E++ +Y +A  KG ++E ++        +KLVLFD  LDH+ RI R  R   GH LL+G  G+GK +L++  A+     +F++ +   Y+  D  E+++T+  + G  N+   F+  + ++++ GFLE +N +L++G VP LF  DE   +++Q++  A   G+   S + ++++F  +   NLH+V  M+P G  LR R    P + N   ++WF  W E ALY V                 SV + P   L+P     R  +V    +VH +V+++++   +K  R    TP+++LDFI  ++ L  +K    E +   L  GL K++E   Q+ EL   L ++   + EK  A    LKE+    Q A E+K+ +++  + +  Q K++ ++K   E  L +  P + +A+ A+  ++K+ +VE++S + PP  V++  E  CI + +N    +WK  + +M    F+  +   D + +T +    +   +       D++   S A   ++K+  A L Y+ +  +++P R ++ RLE+   +  +E + V   I +LE  +    + Y   I + + ++++   +Q ++N + +L++ L SE  RW         Q   L+GD L+ SAFL+Y G +    R E ++ +W + VV   +    D  R+E + T D  + +W    LP D+L  +N I+  R +R+PL IDP  QA+ +IM++    N++  +F D  F K LE A+++G   L +DV+ Y DP+++ VL + +K   GR  + +GD+++D  P+F++++ T+ S  ++ P+I  +   +N+TVT   L  Q L+ +++ ER +++++R  L++   +    L+ LE +LL  L  S G +LD+  +I TLE+ K++A+EV++K     +   E+D     Y+  +   + ++  L +++ I+ +Y YSL   +++F   LK        +  KRL+ + ++L + V+     G+    K+L                  ++    L + + +     DE D  I G       + KK            + K  ++  + F  +   ++ +  +   W+ ++ PE+  +P  + +  G    LC+       +   R DR+    +R ++    +   ++     IL+   + ++ +P  P++   + G D +  +  LA  +     +L  I++G  +  N A   L  A   G W++L+N HL   WL +LEK L  + KPH  FRL+LT E     P  IL+ S  VV EP  GLK NL  +   I    L     T    L   + + HA+VQER +Y  +GW+  Y+F+++D RV    L   +   A QG       ++PW +L+ L+ + +YGG+  + FD+ +L   ++  F      +F+  H    K+    +   P     D  + ++E L  E  P   GL +NAE    T   + M   ++ +  +       GK          + E A      LPK  ++ ++R+       P      +E+   + L+  + + L+ +      E   + E   +A SL  G++P  WKR       ++ +W+T  N+R  Q  +    +N +    WL G   PE+Y+TA  Q   + N W L++  L+  +
Sbjct:  311 ALNVITAFEAKLNKLTEERNKMRKARVALDLSDSAHAPSEGDKLTVATEELAAMKDVWKALQPVYTGIDEAKEKTWLSVQPRKIRQSLDELMNQLKQLPVKCRTYKSYEHVKQMLHTYGKMNMLVAELKSEALKERHWHQMMKEMRVNWNLS--DLTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNY----QNKTRLIKGWDDLFNKLKEHQNSLSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDVVNMQGAQRLLERLADMLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDINEE---DRSITAFHSREGEKVDLVKIVSTKDVRINDWLQALEAEMKHTLARQLAASLTHF---SKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLAD-GKGAENVEQAVVKTLELLADS-VLKEQPPIRRKKMEALITEL---VHKRDTCRKLVSMKIRAANDFGWLQCMRFYFDPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKALERWENVEGVAHVIDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVWFSEEVVTSEMLFERYLSIIRRVPLDSDSAISFSSSSAPVNLIGEDAKPTRSIEIQRTAALALQTHFSP--DGIVPGSLK-YAVSELEHIMPPTPQRLLSSFFSMMSYSIRKIVSHDEGLIDDSVEIDQIQSFVLRSMLTNLVWAFSGDGKWKSREMMSDFIR------QATTISLP------PNQQACLIDY---EVQLSGDWQPWLSKVPTMEIESHRVAAADLVVPTIDTVRHEMLLAAWLAEHKPLVLCGPPGSGKTMTLLAALRSQQEMEVVN--VNFSSSTTPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFY-RTSDHSWVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIYGT--------FNRAMLKMTPAVRGLADQLTNAMVDVYLASQEHFTQDDQPHYVYSPRELTRWVRGISEAITPLESLS-AEQLVRLWAHEAIRLFQDRLVTEEEREWTDKLVDTTAERYFGNA-CRLDEALKRPLLYSCWLSRNYVPVTR----EELQDYVSARLKGFYEEELD--------VKLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQIKEGAQRQGLILDSHDELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTVQKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGDQQKAEEEKKFSEQLQKELAEQLKQMAEKKTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILLGENVG-TDWKAIRQVMMKDDFMTRILQFDTELLTPEILKQMEKYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLRNELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDE-IFHKWFNHVVNAGLHFRHDLARIEYLSTVDDRL-QWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMKQFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDVEAY-DPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLLALLLMRIHIRSNPSAPAYEQHFDLLLGRSDFVAKNDEADSTIPGGLDFLTVENKK-----------SIAKARKV--VGFENVFAHLQHNSAAVTSWLTNDNPES-NVPVVWDDADGKLSPLCIAMNSLIVVHALRPDRLMASAHRVVSTAFDDHFMQQDKVVDILSI--VDNEVSPSEPVLLCSATGYDASGKIEDLAVETN---RQLTSIAIGSAEGFNQADSALGTATKSGRWVLLKNVHLAPSWLAQLEKRLHSM-KPHAQFRLFLTAEIHPKLPSSILRASRVVVFEPATGLKANLLRSLSSIPPQRLTK-APTERSRLYLLVCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDAAVDAVA-QGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTA---KSFEQDHVLIPKYDGDDSLFTPNMSKKDQMIGWVEELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNMLKVTDEELAFNEDGKEEVKPQWMAQLGELAKQWLQLLPK--EIVKMRRTVENIKDPLFRFFEREVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVMDWMTDLNERLKQLIRIGGADNLKRETFWLGGTFSPEAYITATRQQVAQANTWSLEQLNLHIHI 3544          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Celegans
Match: che-3 (Cytoplasmic dynein 2 heavy chain 1 [Source:UniProtKB/Swiss-Prot;Acc:Q19542])

HSP 1 Score: 533.872 bits (1374), Expect = 2.492e-151
Identity = 341/1024 (33.30%), Postives = 550/1024 (53.71%), Query Frame = 1
Query: 4300 IYELYDAQ--KKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQ--DVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILG-SSDCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFR------KIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNP---GYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFEND 7329
            IYE+++ +    ++E W     K     + DE ++ ++++ +    +    V      E  KE   AL      + + L   HW E+    G       +    + + ++  N  +  D + ++ + A  E++I   ++E+       +F++  Y     +   I+    E +  L D+   LQS+ +S +   F      WE  L+ +   L     +QRKW+YLE IF     R  LP EA +F  +D  ++ I+ + +K   +   C   +    L  + D L +CQK+LN +L+ KR AFPRF+FI DD+LL ILG S++ + +Q HM K+F  I+ ++F+   S   +  +M+SSE E +     V I  +VE W+ ++  EMRRT + +T +AV   + S  +      Y   V     ++ ++  +E+           K      LK Y  +   ++D+ V ++          KL ++++  +H  D+VD  + +       + W+ QLRFY +     I ++Q + +F Y YEY G   +LV TPLTD+ YLTLTQA+ M LGG P GPAGTGKTE+ K LA  +G   +V NC EG+D  S+G+IF G+ +CGAWGCFDEFNR++ +VLS +S Q++TIQ  +  +     F G+ ++++    IF+T+NP   GY GR ++P+++K  FR VV+  PD + I   +L+S+GF+ A  LA+K+ ++++LS++ LSKQ HYD+GLRALK VL   G LRR   + +E  ++++AL    L K  F D+  F  LI D+F  +     ++ +  + +     E    +   Q +K+ QLYE M+ R   +VVG  G GKS + KIL  S    +   K+   NPK  +  +L G +D +TR+W+DG+++   RE+ K  D +   +++ DGD+D  WVE +NSV+DDN+LLT+ +GERI+  ++   LFE   LQ+ASPATVSR GM+Y+  +++        WL K       D
Sbjct: 1094 IYEMFNNELDTMSQEEWIVFRSKTY---LFDEFLQKWMEKLKGTGSQTHMSVRLMKDVEHFKEVSSALKF---CRGDVLSADHWHEMFRFLGLPRGTTIEKLKFADLLSVSKNIIENTDQLKQLNSRAQGEVAIRDAIQELTLWAAQTEFTLADYKHSNGQNLKIIKEWKESINSLKDSQALLQSLKSSPYYSQFTDKTAVWETRLADLDVFLAQMNEIQRKWIYLEPIFG----RGALPSEASRFSRVDSEYRAILNDVSKDARLVSLCSRQSLKKSLEQIVDQLNRCQKALNQFLEQKRTAFPRFYFIGDDDLLEILGQSTNPQVIQTHMKKLFQGINRVQFS---STGETIISMVSSEGETVPLSKAVRIVPQVESWLQELSDEMRRTLKDLTAQAVADAQPSLAK------YPSQVLCLAEEVKFSASIENNLNGSSDLNSFKSQLLEKLKAYTNM---KVDDKVSDL----------KLKSLILDLIHHIDVVDQLLTNQAKSINSWTWQRQLRFYLVNGG--IVLRQVSSEFEYTYEYQGNYAKLVHTPLTDKCYLTLTQAMYMGLGGNPYGPAGTGKTESVKALAALMGRQVLVFNCDEGIDVTSMGRIFTGIVECGAWGCFDEFNRLDSTVLSAVSMQIQTIQGAIKSRAGSCTFGGKNVQVNPNSAIFVTLNPAGKGYGGRQKMPDNLKQLFRAVVMGKPDNELISSTILYSEGFVDATALARKIVSVFQLSRQMLSKQQHYDWGLRALKVVLGGCGALRRTQTNKNETDLVVQALLLNTLSKLTFSDSERFNSLIDDIFSNVTKEMTKFEELVEPLGVAAQEMGIKLGDKQMEKVFQLYEQMRQRIGVVVVGAAGSGKSTIWKILQRSLILTKKPLKVTQFNPKAVNRSKLLGNMDMDTREWSDGIITMAAREVTK--DTSVHHWIVCDGDIDPEWVEALNSVLDDNRLLTMPSGERIQFGSNVNFLFETDSLQFASPATVSRMGMIYISEEDVTPKDIVASWLVKTTEDLHAD 2081          

HSP 2 Score: 479.559 bits (1233), Expect = 8.733e-135
Identity = 494/2003 (24.66%), Postives = 925/2003 (46.18%), Query Frame = 1
Query: 7792 LVPTIDTVRLT-----WLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDS---YGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPG-GGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIE-----EQLSENAK-SDKDYAMTDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEAVSPM--KLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDERE---AIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLK--FVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQK--EESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFF----IKGNTSIEVAKRKKPYLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLTKPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYI----ESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTGKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKK----YGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRL--APDTLKSLANWITHFNDRYTQYSQWVENGEPNVMWL--SGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWD 13680
             V T DT R +     WL   Q   +   L+ G TG  K  + +   +N DP+  +  ++  S++++S  + + ++ N  + +  +   + P     +++F+  +N+P  D+YGT + +A+L+ +L  +G +D   +L W  +++I F+ +M   G G    +  R   LFS+      + +    + S   +    +  +  +    II    + IYN++     PT S   ++F+ RDL+     + +  LD+     +   V   E  R+  DRL  ++DK   ++ +       Q +E     +K Y  T  ++ G+    L +  + + +   N   AK +      E +    P+  +L  F   +D      R +   GGH  L G  G G++   +L A+  +  +F   ++  +S K     LK    +    N+  V +  D  + +  FL+ IN++L+SG VP LF   E +   A++S+  N+AS  G      ++ Q+  ++  S +H+VL +       +      P ++ +  + +   +   +L  +  + +  +     D     I+  F  V +++ E+             + P  Y  F+  + +LL  K      + +RL+GG+ KL EA  ++A++  K   +   + EK    +  LK IT     A ++K   ++     E ++  IE++K + +  L E  P++++AR A+  ++   + EIRS   PP+ V+ + + + +F    + +W+  +  ++       +   D + IT +    V   + +   + +E  +   +        +V A L Y+ +  +I P   +  +L K   + ++++E +   +  ++  + +L +++E+ + E  +++ + D  Q  +  A  L+  LS E +RW + ++   +++ ++    L+ SAF++Y+G  S + RK ++ S  K         M   F+     + + E   W ++GLP D+LS++NG +   +   PL ID   Q ++  + K  E+S   K A    PD + Q+ELAI++G   +  D+ E+ D  +  +L K++     R+ +  G K +DF+P+F++Y  T+       PN + +  ++N+T T+  L  QLL V +  E+ ELEE+   L+++    K  L+ LE  LL++LA+S GN+L+NT L+++L ++K  A  +++ +    +  +E+   +D Y   +   + LFF  + +   N MY YS++  + +F  ++ KS  D +   R++ +   +   V+ +   GIF + +L+F     +   M K      E + F    +  +T +   + +    W+S    Q + ++   +P  F+       +D+ +W ++      E  A PK+   K+  FQK+  ++  + +R+Y  +  +V++ +    + PP    + I  +S    PI+FIL+ G+DP+ +   L+E +         ISMGQGQE  A   +  + ++G WL L N HL+++ +  + K L  LT PH +FRLWLTTE    FP  +LQ+SLK+  EPP G++ NL  TY +I  S+ N     +    +F LA+ HA++QERR +   GW   Y+F  SD RV    ++   Q  A++ D +   G LK+    V+YGGR  +DFD ++L +Y++  F D      +  +  A       I    T + Q +YI    +S+P  + P +FGL  N +  +    A    S +  +     K+  S   D+I     S I S   KL   D L K+          P   VL  E      L+ ++ +S+  + +++      S  +    +SL   Q P  W  +   P       N +        Q  +  ++       +  S L  P  +L AL Q T R+   PLD+  L ++ T     A+      Q   V GL L+GA +D
Sbjct: 2197 FVQTADTQRYSDIIGSWL---QSGNRESFLITGTTGCGKQQLLKHCFQN-DPESQLA-SLYCSAQSSSSHLLQLIQQNCVQASNPTGRVWRPKDRPNMILFLKGINLPAPDKYGTNELLALLQQLLTYQGFFDH--NLEWVSIENIQFVGSMNPIGDGAAVSISNR---LFSLLRCVSLNTTDSSQLTSIYRTYLTPILEEVGERNSEIIANRMVDIYNKVQSNFRPTDSVV-FLFSPRDLTNWVVSLLRHELDQ----GKLEAVICFEARRIFADRLPTENDKLKFEEILRNVIPISQANETVIFKEKVYVTTGTVVPGESNTGLPLTPINMSD--FNQLLAKSI-NRFAFEIANFNCPLTSQLAFFCACID------RVLTGPGGHLFLPGRPGFGRRDSVRLVAHMHNIQVFSPPVTANFSAKQFDNELKNAITQAVTNNEHVVLILEDHQLRKNIFLQAINSLLASGNVPGLFTQQELDGLVALVSEAANQASFTG------ALQQFLAHRIRSLVHVVLILEVEANDFKINITENPAILKHCNVIFADRFDRNSLVEIPKIQMESQGITTTD----AILTGFNDVLVNLPEHLS-----------IQPIKYRQFVENFFQLLGYKRLTLSVRLERLKGGVSKLNEARDEVAKMQKKAGKKSKLLAEKQAEADEALKAITESMSGAEDQKLSMEQLKAATEKENVRIEEQKAKIDEQLKEVQPLIDEARRAVGSIKSESLSEIRSLRAPPEAVRDILQAVLLFMGILDTSWEAMRKFLSKSGVKDDIMNFDANRITNEIHKKVTALVKQKSNSFEEANAKRASAAAAPLAAWVKANLEYSKILEKIAPLEGEKNKLVKNLKKAEKQMENLSKGLQSVDEVVGELKRKFEVLMKEATQIKVDLDREQDTIRIAGTLVESLSGEFERWKIQIETFGEEQSKMELCSLITSAFITYLGGCSEKDRKSLLKSMCK------MFNMPPTFKPLSFASLETEQLNWKTKGLPADQLSLENGSILFTSCHAPLIIDRSGQ-VSLFLSKFLEKSETFKAA---QPDLMTQIELAIRFGKTIIIDDIVEF-DSALIPILRKDLSSQGPRQVISFGGKSIDFNPDFKIYFCTRDEKVDIRPNSYVQLNIVNFTTTISALSAQLLDVAIHLEKPELEERSSSLLRDAELKKLELEGLEQLLLQQLASSQGNLLENTALLDSLNKSKESAEIITKSIVESEQLHKELTTQKDIYVPLSLFTSSLFFSFSNLQFHNPMYNYSVNTIMHLFGKTI-KSCEDKS-STRVETLARQMQLTVFYHISRGIFRQDRLMFAVAF-INATMPKM-FQPKEWELFTGVLVDESTDLSALRVQ----WISPDRLQSLARIRTHLPSLFNNFQ---IQDDATWNEFSKTLQCEN-AFPKNVELKMTHFQKVLFIQAVKPERLYNCLMDFVLKTLNIPSINPPAFELKHIFQESESTEPILFILADGADPSQE---LSEFASSMNVPYHSISMGQGQEIAAYEAIRESASKGEWLCLNNLHLMLQAVPSIFKHLS-LTTPHENFRLWLTTEGDARFPSMMLQQSLKITFEPPPGVRNNLLRTYTQIDRSTKNVITCQS----IFVLAWLHALLQERRTFIPQGWTKFYEFGASDVRVAKSFVE---QLTANKADWEFVRGILKF----VIYGGRIENDFDFKVLDSYLNVLFCD------EKINGRAGSQLVKGIDLLATTNVQ-EYIGHISKSVPSVDEPYLFGLPENIKYSWQIVEADRTISSIRTLALGDTKNALSDQSDKI-----SQIVSLWKKLCQSDDLPKRELPTAIRSADPISEVLCLETINALSLIKQLHRSIGHVAKSMKTPSLASPAVQKTIQSLVFQQTPDEWDSMWAGPSDPADYLNVVVKKTRGTLQLFESSKSSSLLSSPIDFSDLFYPNIFLNALRQTTSRQIKIPLDQLILSSAWTPSQLPAK------QCVQVQGLLLQGATFD 4098          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Celegans
Match: dhc-3 (Dynein Heavy Chain [Source:UniProtKB/TrEMBL;Acc:G5EDV4])

HSP 1 Score: 114.775 bits (286), Expect = 1.840e-24
Identity = 113/488 (23.16%), Postives = 226/488 (46.31%), Query Frame = 1
Query: 4474 LKEFKDALPLFSDLKHEALRERHWKELM--TKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTE-TAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSS--DCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQEIMEFRSPV---LIEGRVEDWMTKIEMEMRRTNRVITKEAVFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLI-IDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLN 5910
            L EF+  LP+   +  +A+++RHWK ++  ++T    + NP    +S +  M      D   ++   A KE  +E  + +++  W+T  F      +GG+    +   L+  +Q    +    Q++ +S      L  +++W   L  ++  + ++     +W  +EG+F   DI  Q+P E + F  I   +  I  + T ++PI++Q   V     +L+ L     + +   + YL  KR  FPR F +SD+ +LS++  S     C + ++  +F ++++  F + T +E+ +   +S++ E +    PV   L +  VE WM +++ +++ T R   +  +         V+ + +    VA    +I +TW++E+    +K+   T L    K+        V      L K+DR +   VL  I   +  +V+  + + ++   ++ W SQLR+YW    + + I+  T    Y YE  G++
Sbjct:  685 LAEFEKLLPVLGAISCQAMKDRHWKMILQDSETSVKVEGNP---LVSELLEMNFIEKADKFEQVGAQAEKERVLETSIEKMKSQWVTATFVTH---QGGE---LLTTELNVQMQA---HLARSQTILSSPHAFSILDHIRHWLDTLLNLNTFVHLYKQCDTRWRKIEGVFSTEDIAYQMPHEFRTFKKISLRWLHINNQITEERPILEQMDLVQQLNLELSELEVLFGRMENGFHAYLRKKRAVFPRLFALSDELVLSLICDSREPANC-KSYIPLLFPSLTT--FDQNTKMEIIS---VSTKLETISLVKPVNVNLSKRHVEKWMHELDSQIKYTLRTRIRLLIEKMNYKLSPVETILNEPIQVAAVYLKIAFTWQMEN---SMKQNSLTILASELKICIRDCQHAV------LHKHDRWEFLPVLYHIYKSSTHLVNKLMNEQVIFIDDYRWTSQLRYYW--HLENVFIRVGTVSTRYDYEVQGVD 1143          

HSP 2 Score: 78.9518 bits (193), Expect = 1.200e-13
Identity = 72/325 (22.15%), Postives = 155/325 (47.69%), Query Frame = 1
Query: 9580 LDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYK------EIN------WKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDS-LDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRW 10515
            L  ++T  KL + K +       + + G++K+  A  Q+A +  +L   +  +   +I    L+  I   T      +++           + + +  K E+EA L  A+P LE A  AL+ + ++DV  +++   PP  V++  E + +    K      EI       W   + +++D  FL  +++   D ++ K   ++R+  L K +   + ++  S A  GL ++V A+  Y  +++ ++PKRE++ + E    Q+ ++LE  +  + K+  +L+ L+ ++     ++Q L+ +    + R+  A++L+  LS E  +W
Sbjct: 2101 LKMVSTITKLAKKKREEVRKTMTKYEKGMEKMKRAEEQVAGMQGELLRLQPQLVRTSIETSMLMSTIEKETIDVENAREVVAANENKANEAATKAQSLKAESEAELASAIPALESAVEALETMTQSDVSSLKTMRFPPYAVRLCMEAVCILLGVKPAKITNEIGEVVNDYWVSGQKLLSDIHFLAKIRSFARDTVSKKTVKLIREKYLSKEEFDPENVKQCSLAAEGLCRWVLAIDMYNQISKIVEPKRERLRKAEVLVKQHLKQLEVKRKALLKVTEKLQGLSDQFSQMCQKKQELESQISSCEVRMERAERLVQALSGEKDKW 2425          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Fly
Match: Dhc98D (gene:FBgn0013813 transcript:FBtr0301303)

HSP 1 Score: 3950.21 bits (10243), Expect = 0.000e+0
Identity = 2033/3964 (51.29%), Postives = 2675/3964 (67.48%), Query Frame = 1
Query: 2437 ENVPEETIDKMDDDLRVDFGFEINEIITETRNLELLGYKVPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISDYIEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFKL-----------QSGNKFLK------------------------------------------CKEFFEFMESERTSDFEHLGRKYSTIGPLITKLQGEIIGDRDVNPFEKFQPFYEFWEKRIFDRVYNMVLKNLQDYQNMLRDENFPTCLFEVDLMLAGTDVIGNPQTTEIYKLAIQDLRDAVEATRVFIRWKRNSCIETTGMKIDGQDELFYFTFYLDIGN-------SVEITYFCEQIANYYRNIIGKLRKYQDKWKKHKRVFIPNKQAQIDKWLTKDPTVMDFYERIRDTIDRKEELLNQPVIRKIGFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDLSLIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSNHPIDQEEIEESDKLRQLFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVF-FYRESKV-RVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKK-GQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQL-------------TREGMNQDTIEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMP-QSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQM--FSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAI------------EEQ-----------------LSENAKSD------------------------KDYAMTDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKRKKPYLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLTKPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDT--GDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTGKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGEPNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMGVGLVVEADLATTEHPSHWVLQGVCLILNTD 13926
            E V E+T+ + D D  V+   ++ +++ E +  E LG+ +P + R   ++ +   K  E +  +V  Y S+I +L   EV  L   I + +  I+ G+ R  W S  I  + ++ N  L    S V+ I+ + +D+  ++  I +  LF L            SG  +L+                                          C+ +FE +E+ R      + + Y ++GP++ KL+  ++G       ++ + +YE+WE   F  + +M  +NL+ Y N L   N P  +FEV+ +L  ++++  P   E+    +   +D +   R+F RW   +CI    +++ G+   + +T+Y D+          + I     ++AN  R  + + RKY + W   K  FI        K+L K  T+++  E+        E L N    + I  + +NL+ LL+ +  H + W       L      N+ +++N+++    +L+    +LE+ K +++TI T+Q  +L  E +I ++QE + +L+        E++  +  L + +  L   +     +L P+K KF D+T  EI +F  DL  F   + E GPGS+G +L+ G+ ++  +  ++   E RR+EL  AE+LF++ +  Y E   VQ E + L Q+Y+LY AQK ARE W +TLW +LD  VL EG+E +LKE+RK  + V+ +     L   +K+FK  +PL   LKHEALRERHW +LM KTGQ FD++P  FTL ++FAM+L+++Q++  +I+T+A KEL IE+GV+ V ETW ++ F    + KG  +RG++LG +DE++QIL+DNAMNLQSM AS+FIGPFL +V  WE+ L+LISE++D W+VVQRKW+YLEGIFIGGDIR+QLPEEA+KFD IDK++++IM + AK P++   C VP RL ++  L  GLE CQKSLN+YLDSKR  FPRF+FIS DELLSILGSS+   VQ H+IKM+DNI SLR  K  S +   T MISSE E+MEFR      GRVE WM  +  EMRR+NR I K A++ F  + ++ R  W+ +YQGMV L  +Q+WWT EVE+ F + +  G   A+KD+    + QI+E+V  VRS LS+NDR K      +DVHARDI+D+FVRD+++DA EF WESQLRFYW++  D + + QC+G F +GYEYMGLNGRLVITPLTDRIYLT+TQAL M LGGAPAGPAGTGKTET KDLAKA+GLLCVVTNCGEGMDYR+VG I +GL QCGAWGCFDEFNRI++SVLSVISTQL+TI+NGLI KL RF FEG EI LD + G+F+TMNPGYAGRTELPESVKA FRPV  I PDL+ IC I LFS GFL+AKVLAKKMT LY L++ QLSKQ HYD+GLR+L SVL MAG ++R   DL E  VLMR LRDMN PKF+FED PLFLGLI+DLFPG+DCPR+ YPDFN +V   L    YI+L DQ DK+VQ+YETM TRH+TM+VGPTGGGK+VVI  L  +QT + L TK + +NPK  SVIELYG LD  TRDW DGL SNIFRE+NKP ++ ERRY  FDGDVDALW+ENMNSVMDDNKLLTLANGERIRL+N+CALLFEVG+L YASPATVSR GMVYVDPKNL Y+PFWQ W+  +    + + L   ++K I  +I  ++EG+        LK +I  T+LN+VTQ CN+ D  L              ++  N D++E  F+Q++Y S+G CL+E  Q  FD+++K +   P   +  + PA  G+ P   PTL+DY++D   +   W  W  +V  Y H+P+ KFSEILVPT+D  R    L+   +I+RPVLLVGE GTSKTA    +LRN +P   + L INFSSRT+SLD+Q  LE+ VEKRTKD+YGPPMGKR+  FIDDMNMPQVD YGTQQPIA+LKL  ER G YDR KDLNWKK +D+ F AAMG  GGGRN+VDPRFIS+FS +N  FP+  SL  IYSSI  GH     F  E      +I  MT+ ++  +IV LPPTPSKFHYIFNL+DLSRI+ GM       F       RVWR+E+TR+I DRLI D+D   V++ +            EE+                 L E +K+D                        KDY + DP+LFGD+RN    +E RLYED+++Y +   LF EI+EEY E    M LVLF+D L+HLTR+HRT+RM+ GH LL+GVGGSGK+ +T+LAA+   CD+FEI +SRGY+E   RE+LK LY   G++ K  VF+F    V EEGFLELINN+L+ G VPALFPD++++ I++QVR  A   G+  SK+++W YF+  CA NLH+VLCMSP G+ LR RCRNFPG++ +T IDW FPWP QALYAVA +F+  E+ LIP   R  IV+H V VH S+++YSK+++ K RR N+VTPK+YLD+INTY  LLE+K KF   Q  RL  G++K+ EASVQ+ EL   +  QK  V   +  CE +L  I S TQ A  KK  A EKS  VE++ K+I  EK EAE  L EA+P LE+ARLAL  LEK  + EIRSFA PP  VQVV EC+A+ K YKEINWK AKGMM+D +FL+SL  MD + +T KQ    R  +      +++M  +S AG GLL+FV AVLG+ DV +E+KPK+E++  L +      + L  +  EI KLE +L +LN+ Y  ++ + + L E     +RRL A+DKLI+GL+SE  RW  ++  L  Q +  +G CL+ ++FL+Y GAF+WEFRK MV+  W +D+    IP+  PF+++  LT DVEIS+W++EGLPPDELSIQNGILT RASRFPLCIDPQ QAL WI ++E  NNLK  +F+D DFLKQLE+AI YG P LF+DVD+YIDPVID++L+KNI+   GR+FV+LGDKEVD+DP+FR+YL TK SNPK+ P ++ K++VINYTVT  GLEDQLLSV+V  ER +LE QRE LI +TS+NK+LL+ LEDSLLREL+TSTGNMLDN ELI TLE TK+KA  V E+LKL A T+ +I+  R+GYR AAKRGA+LFF L++M+T+NSMYQY+L+AYLDVF +SL+K++PD +L KRL N++ TLT NVY YGCTGIFE+HKLLF+FQI  KL    G L Q ELDFFIKG+ ++  ++R  P  WLS+ SW+DV KL    P  F  L +   R    WK+W + E PE    P DY+ K  +FQKL  LRCFR+DRI+R+I  Y++E M E Y+ PP+++F  I++Q++   P+ F+LS GSDP +D++KLA+ +  G +    IS+GQGQE  A  LLD AI +G WL+LQN HLL++++RELEK L+R+  PHPDFRLW+TT+PT  FPIGILQ+SLKVVTEPPNGLKLNLRSTY K+    L + +H AF  LV+ LAFFHAVVQERRKY K+GWNI YDFN++DF VC +IL+TYL +    G  KIPW SLKYLIGEVMYGGR IDDFDRRI   YM+EY GDFLFD F+ FHFY      Y +P+ +T   +D + +I+ LPL N P+VFGLH NAEIGYYT AA+ +W+ LI++QPQTG+     SRD+ I+  A+GI  KLP  F+  R+RK+  + +SPT VVLLQEL+RFN+LV R+ K+L  L +A+ GE+GM   LD++A SL+NG +P  W +LAP T K LA+W+ H   R  QY  W  +GEP VMWLSGLHIP+SYLTALVQ  CR+N WPLD+STL+T VT+FA   +V ER   GC VHGLY+EG  +D +   L R  PK L++ L ++ V PIEAHRLK QNT+L PVY TS RRNAMGVGLV EA+LAT+E  SHW+LQGVCL LNTD
Sbjct: 1132 ELVGEKTLIEYDMDFVVNLKRDVFDVLFEAQQFEHLGFTLPAVLRTAIMKKDLLFKDYERMTEVVDRYRSIINNLSMSEVIFLRGHIYDTELFIQMGVGRYTWTSFNIGKFCDQINSQLRKLTSIVSQINFIRLDLRSRIDMIKSFNLFNLDDELKVEDTSRSSGESYLQDRKNPSQRFKSVTGETITMFSVEKDVPADEKAEQACGSGIYPCQGYFELLEASRNRKAAQMKKLYDSLGPVLVKLESLVLGTFSGRS-DRMKTYYEYWEGETFKCIVDMTYQNLKCYINRLLS-NKP--MFEVNAVLLMSEIVLEPSVQELQNTIVTATKDYISRLRIFTRWMTGTCIACPLVEM-GKQFKYNYTYYEDVIQIRSIVDLVINIHDLASRVANEARGFVSQFRKYFNLWAFEKS-FI------CQKFLEKQVTLIEIDEKFTFYSSIVETLANTRKFQDIKCVRINLEPLLASITQHAQDWCTTLGEELLRHVNDNMRAMRNEVKTLSLNLNKTTRELEDFKLVMTTIGTVQSSTLTNEQKIHEMQETFTILSEHKIMFPYEDMLMAHHLEKRWKRLFLSALYRYEKLQPIKQKFADMTSVEIDEFCDDLAEFIKDYDENGPGSVGAELERGVRLMDPYGQKIAERESRREELANAERLFDMAMVDYHEFARVQTEFEGLQQLYKLYKAQKYAREGWGKTLWADLDPNVLTEGVESYLKEFRKFTKAVRTLPVGVQLEIHMKQFKGTVPLMVSLKHEALRERHWLQLMEKTGQYFDMSPARFTLENMFAMQLHKYQEIAEQILTNAIKELQIERGVQAVIETWASMAFKTFKHFKGSDDRGWVLGPVDEIMQILEDNAMNLQSMGASQFIGPFLETVNKWERTLALISEIIDEWLVVQRKWLYLEGIFIGGDIRTQLPEEARKFDDIDKSYRRIMVDCAKNPLVVPFCTVPGRLVEIQGLGIGLENCQKSLNEYLDSKRRIFPRFYFISTDELLSILGSSEPSAVQNHIIKMYDNIKSLRLVKEGS-QTIVTGMISSEGEVMEFRHSARAAGRVEYWMNDVLDEMRRSNRFINKTAIYDFGTDLQISRPDWLMNYQGMVGLAASQVWWTAEVEEAFDQAQNHGNMRAMKDFLGKNNYQIEELVLKVRSNLSRNDRLKFKAQCTVDVHARDIIDNFVRDNVLDASEFSWESQLRFYWIKFYDNLHVLQCSGSFDFGYEYMGLNGRLVITPLTDRIYLTITQALLMNLGGAPAGPAGTGKTETVKDLAKAMGLLCVVTNCGEGMDYRAVGTILSGLVQCGAWGCFDEFNRIDISVLSVISTQLQTIRNGLIRKLDRFVFEGVEIHLDPKCGVFVTMNPGYAGRTELPESVKALFRPVTCIKPDLELICLISLFSDGFLTAKVLAKKMTVLYSLAQAQLSKQCHYDWGLRSLNSVLRMAGVMKRQSEDLPEAVVLMRVLRDMNFPKFVFEDVPLFLGLIKDLFPGIDCPRIGYPDFNAAVRHVLVNDGYILLPDQEDKVVQMYETMMTRHSTMLVGPTGGGKTVVINALVKAQTHMGLPTKCLVLNPKACSVIELYGFLDMETRDWIDGLFSNIFREMNKPIEREERRYACFDGDVDALWIENMNSVMDDNKLLTLANGERIRLENYCALLFEVGNLNYASPATVSRAGMVYVDPKNLRYSPFWQRWVLTRPEP-QRELLNDFFEKIITQSIAFILEGLDGTTQGNPLKLVIMQTDLNMVTQFCNLYDALLPNYVMDSKNYDEPVQQNYNTDSLECCFLQAVYGSMGACLVEKHQPVFDEYMKRISGFPLVQDTPENPASGGQFPQSKPTLYDYFWDV--KDNVWKAWEWVVQPYTHDPQVKFSEILVPTVDNTRTNRTLSLMSEIKRPVLLVGEAGTSKTATIMQYLRNLNPSVNVILNINFSSRTSSLDVQHTLEAAVEKRTKDTYGPPMGKRIACFIDDMNMPQVDDYGTQQPIALLKLFFERGGMYDRDKDLNWKKFKDLTFYAAMGTAGGGRNEVDPRFISMFSTYNIIFPNDESLIQIYSSIFKGHMVFVKFQPEYMLIADMIVHMTLKLFKMVIVDLPPTPSKFHYIFNLKDLSRIFAGMLLIEPTCFKGLRDLIRVWRNEYTRIICDRLITDNDIANVRRNLAVEVAERFPPTFEEEHGFIDAAAAEAEAQARLLYEPSKADIDGGEEEGEEEEEGEEAPQVILSLKDYVLRDPLLFGDFRNFTNESEPRLYEDLLDYNSVYFLFTEILEEYCERKQKMTLVLFEDCLEHLTRVHRTLRMNRGHVLLIGVGGSGKKCITRLAAFAAECDVFEITISRGYNEAAFREDLKVLYTIAGVKRKKVVFLFTGAQVAEEGFLELINNILTVGQVPALFPDEDKDGIVNQVRKFAEEDGVSASKDAVWGYFLRTCAENLHVVLCMSPAGDALRNRCRNFPGLIGSTYIDWVFPWPRQALYAVAKLFL-TEHRLIPASHREAIVEHVVHVHTSIQQYSKDYLAKLRRNNFVTPKHYLDYINTYRGLLEEKAKFITQQRSRLGEGIKKIEEASVQIDELRIIVTEQKKNVAVASEECEAMLVTIESSTQKANVKKAEASEKSVEVEIKGKQIAIEKDEAEEILAEAMPALEEARLALSQLEKAQITEIRSFATPPAAVQVVCECVAILKGYKEINWKSAKGMMSDVNFLKSLMEMDCEALTQKQITQCRQHMKTG--NLEDMAKISVAGAGLLRFVRAVLGFFDVYKEVKPKKERLDFLVEEQEVQIKLLNHLNGEIQKLEEKLNELNENYATSMKQMRALTEMMQQAERRLIASDKLISGLTSELIRWSKEMASLGQQLIDSVGGCLISASFLAYTGAFTWEFRKAMVFDDWLEDIASLGIPIQLPFKIDGYLTTDVEISQWSNEGLPPDELSIQNGILTMRASRFPLCIDPQLQALQWIRKREFKNNLKVLSFSDSDFLKQLEMAIMYGTPVLFEDVDDYIDPVIDDILQKNIRIQGGRKFVMLGDKEVDWDPSFRVYLTTKFSNPKFDPAVYAKALVINYTVTQTGLEDQLLSVVVGTERPDLEAQRESLIAQTSENKQLLQQLEDSLLRELSTSTGNMLDNVELIETLENTKTKAGVVMEQLKLAADTAADIEVLRNGYRPAAKRGAVLFFALSDMATVNSMYQYALAAYLDVFVYSLRKAVPDASLNKRLNNIIKTLTENVYCYGCTGIFERHKLLFSFQIATKLAQRDGILLQSELDFFIKGSIALTKSERSNPCKWLSEKSWEDVLKLAFDFPDIFGTLPDHFGRYLTEWKEWFDLENPEEVPCPGDYNIKCNAFQKLMFLRCFRVDRIFRSINQYIVETMDEFYIMPPVVSFSAIYEQTSSTIPVCFVLSAGSDPTNDLIKLAD-TIVGMSNFCHISLGQGQEKAALRLLDGAIKQGMWLMLQNGHLLIRFVRELEKHLDRIENPHPDFRLWITTDPTPTFPIGILQKSLKVVTEPPNGLKLNLRSTYFKVRQERLESCSHVAFRPLVYVLAFFHAVVQERRKYDKLGWNIAYDFNDTDFDVCTEILRTYLTRC---GTGKIPWNSLKYLIGEVMYGGRVIDDFDRRITNCYMNEYMGDFLFDEFKVFHFYEDDNVDYCLPEEETILKEDYIAHIDKLPLVNKPDVFGLHPNAEIGYYTMAARNIWNSLIELQPQTGEGTGGISRDDFIDSVAAGILKKLPPAFETWRIRKQIQMSLSPTGVVLLQELDRFNLLVVRIKKTLELLRKAIAGEIGMDNVLDNIANSLFNGLLPAAWSKLAPATCKQLASWLEHLRLRAVQYKYWTLSGEPLVMWLSGLHIPQSYLTALVQIACRRNAWPLDRSTLFTYVTKFADPDDVEERPVTGCLVHGLYIEGGRFDLATNQLARSHPKVLVEELAILAVEPIEAHRLKLQNTYLAPVYTTSLRRNAMGVGLVFEANLATSEDLSHWILQGVCLTLNTD 5072          

HSP 2 Score: 139.428 bits (350), Expect = 8.065e-32
Identity = 112/477 (23.48%), Postives = 224/477 (46.96%), Query Frame = 1
Query: 1048 EMIESTVLKWDQQITGTLESLQKIVPHGPSPLAEIDFWRERNAXXXXXXXXXXXPKVKRILNLYSLAEGPVFDTQNNELNKFHIE---AKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIAWNLSDRVARLIDVNTIFNLPLEHVLKDTAEAEKMLRVWNDTYFEVRASIEASGRDARWEFDRKRLFEKTNYMADICHDLNEIAMILQEFYNIFGPELKSVTNEAKRIXXXXXXXXXXXXPL-KEMPFNPFNLMKHKYDWSNFMEDFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEVESIDQLFKTNMNNPPLYHFKSCVAGGISWERHLFYNIKRPILRFLTMDEMMQSDNGKRIRT---KYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILAL----ANSENFVSENV 2445
            + +E  V  W + +  T+++L        +P+AE  +W +    L   LEQLK   V  +L   +  + PV D     + K       AK+N+ +L  +  + + +    +F  V   IP +M  LR IW +S HY +D  M  L+ +I+     +V  +I+   IF     +  +       +LR W   Y   R  IE SG  +RWEFDR  LF + N++  +  D+  +  +  ++ N+FG  LK+   +   ++ +++KV  ++  L K + ++ F     + +W   +E F +++ ++EN+A + I+    +L S+E   D+++   +I +R  + + +  K  +++  +  E+ +++++F     +PP+   +      I W R L   +K  +L F  +++     N    R+   +Y  +   M  FE+  F  +      +++   R N+L +     ++ +++SE V
Sbjct:  516 QQLEEVVDGWIKYLKKTMKTLTDAKLDDFTPMAEHRYWHKMEVELYGTLEQLKTEFVVAVLQRLTDDKSPVLDEWQAVVEKTEARFKLAKENSDYLGTIIDYLEKVRSYESFKMVVLQIPNIMVGLRHIWTMSSHYCRDPEMQVLLCQISNVFVQKVKSIINFENIFKYSATYTYETATNCANLLRCWKQAYKLSRQHIEDSGAGSRWEFDRVALFNEVNHIHRVAVDIAYVGRVFVQYENLFGHRLKACIADPSIVDNLMRKVYRMLDDLIKSVDYDMFRPGNWE-NWEYSLELFNKRLDNVENEAKNVIDQSINSLLSSEKGLDLVVNAMNIDTRATLQEFVATKHENLLRFFVTEINAVERVFTKLKKSPPMAKHQPAKISAIFWARLLGKKLKTSVLAFKRVEDEPAIKNSFLKRSSFKQYFELMTVMFQFEKVLFENFIQNATYLVNTTNRSNVLRIRICKESTMSYISEAV 991          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Fly
Match: Dhc98D (gene:FBgn0013813 transcript:FBtr0301302)

HSP 1 Score: 3949.05 bits (10240), Expect = 0.000e+0
Identity = 2033/3964 (51.29%), Postives = 2675/3964 (67.48%), Query Frame = 1
Query: 2437 ENVPEETIDKMDDDLRVDFGFEINEIITETRNLELLGYKVPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISDYIEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFKL-----------QSGNKFLK------------------------------------------CKEFFEFMESERTSDFEHLGRKYSTIGPLITKLQGEIIGDRDVNPFEKFQPFYEFWEKRIFDRVYNMVLKNLQDYQNMLRDENFPTCLFEVDLMLAGTDVIGNPQTTEIYKLAIQDLRDAVEATRVFIRWKRNSCIETTGMKIDGQDELFYFTFYLDIGN-------SVEITYFCEQIANYYRNIIGKLRKYQDKWKKHKRVFIPNKQAQIDKWLTKDPTVMDFYERIRDTIDRKEELLNQPVIRKIGFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDLSLIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSNHPIDQEEIEESDKLRQLFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVF-FYRESKV-RVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKK-GQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQL-------------TREGMNQDTIEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMP-QSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQM--FSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAI------------EEQ-----------------LSENAKSD------------------------KDYAMTDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKRKKPYLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLTKPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDT--GDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTGKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGEPNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMGVGLVVEADLATTEHPSHWVLQGVCLILNTD 13926
            E V E+T+ + D D  V+   ++ +++ E +  E LG+ +P + R   ++ +   K  E +  +V  Y S+I +L   EV  L   I + +  I+ G+ R  W S  I  + ++ N  L    S V+ I+ + +D+  ++  I +  LF L            SG  +L+                                          C+ +FE +E+ R      + + Y ++GP++ KL+  ++G       ++ + +YE+WE   F  + +M  +NL+ Y N L   N P  +FEV+ +L  ++++  P   E+    +   +D +   R+F RW   +CI    +++ G+   + +T+Y D+          + I     ++AN  R  + + RKY + W   K  FI        K+L K  T+++  E+        E L N    + I  + +NL+ LL+ +  H + W       L      N+ +++N+++    +L+    +LE+ K +++TI T+Q  +L  E +I ++QE + +L+        E++  +  L + +  L   +     +L P+K KF D+T  EI +F  DL  F   + E GPGS+G +L+ G+ ++  +  ++   E RR+EL  AE+LF++ +  Y E   VQ E + L Q+Y+LY AQK ARE W +TLW +LD  VL EG+E +LKE+RK  + V+ +     L   +K+FK  +PL   LKHEALRERHW +LM KTGQ FD++P  FTL ++FAM+L+++Q++  +I+T+A KEL IE+GV+ V ETW ++ F    + KG  +RG++LG +DE++QIL+DNAMNLQSM AS+FIGPFL +V  WE+ L+LISE++D W+VVQRKW+YLEGIFIGGDIR+QLPEEA+KFD IDK++++IM + AK P++   C VP RL ++  L  GLE CQKSLN+YLDSKR  FPRF+FIS DELLSILGSS+   VQ H+IKM+DNI SLR  K  S +   T MISSE E+MEFR      GRVE WM  +  EMRR+NR I K A++ F  + ++ R  W+ +YQGMV L  +Q+WWT EVE+ F + +  G   A+KD+    + QI+E+V  VRS LS+NDR K      +DVHARDI+D+FVRD+++DA EF WESQLRFYW++  D + + QC+G F +GYEYMGLNGRLVITPLTDRIYLT+TQAL M LGGAPAGPAGTGKTET KDLAKA+GLLCVVTNCGEGMDYR+VG I +GL QCGAWGCFDEFNRI++SVLSVISTQL+TI+NGLI KL RF FEG EI LD + G+F+TMNPGYAGRTELPESVKA FRPV  I PDL+ IC I LFS GFL+AKVLAKKMT LY L++ QLSKQ HYD+GLR+L SVL MAG ++R   DL E  VLMR LRDMN PKF+FED PLFLGLI+DLFPG+DCPR+ YPDFN +V   L    YI+L DQ DK+VQ+YETM TRH+TM+VGPTGGGK+VVI  L  +QT + L TK + +NPK  SVIELYG LD  TRDW DGL SNIFRE+NKP ++ ERRY  FDGDVDALW+ENMNSVMDDNKLLTLANGERIRL+N+CALLFEVG+L YASPATVSR GMVYVDPKNL Y+PFWQ W+  +    + + L   ++K I  +I  ++EG+        LK +I  T+LN+VTQ CN+ D  L              ++  N D++E  F+Q++Y S+G CL+E  Q  FD+++K +   P   +  + PA  G+ P   PTL+DY++D   +   W  W  +V  Y H+P+ KFSEILVPT+D  R    L+   +I+RPVLLVGE GTSKTA    +LRN +P   + L INFSSRT+SLD+Q  LE+ VEKRTKD+YGPPMGKR+  FIDDMNMPQVD YGTQQPIA+LKL  ER G YDR KDLNWKK +D+ F AAMG  GGGRN+VDPRFIS+FS +N  FP+  SL  IYSSI  GH     F  E      +I  MT+ ++  +IV LPPTPSKFHYIFNL+DLSRI+ GM       F       RVWR+E+TR+I DRLI D+D   V++ +            EE+                 L E +K+D                        KDY + DP+LFGD+RN    +E RLYED+++Y +   LF EI+EEY E    M LVLF+D L+HLTR+HRT+RM+ GH LL+GVGGSGK+ +T+LAA+   CD+FEI +SRGY+E   RE+LK LY   G++ K  VF+F    V EEGFLELINN+L+ G VPALFPD++++ I++QVR  A   G+  SK+++W YF+  CA NLH+VLCMSP G+ LR RCRNFPG++ +T IDW FPWP QALYAVA +F+  E+ LIP   R  IV+H V VH S+++YSK+++ K RR N+VTPK+YLD+INTY  LLE+K KF   Q  RL  G++K+ EASVQ+ EL   +  QK  V   +  CE +L  I S TQ A  KK  A EKS  VE++ K+I  EK EAE  L EA+P LE+ARLAL  LEK  + EIRSFA PP  VQVV EC+A+ K YKEINWK AKGMM+D +FL+SL  MD + +T KQ    R  +      +++M  +S AG GLL+FV AVLG+ DV +E+KPK+E++  L +      + L  +  EI KLE +L +LN+ Y  ++ + + L E     +RRL A+DKLI+GL+SE  RW  ++  L  Q +  +G CL+ ++FL+Y GAF+WEFRK MV+  W +D+    IP+  PF+++  LT DVEIS+W++EGLPPDELSIQNGILT RASRFPLCIDPQ QAL WI ++E  NNLK  +F+D DFLKQLE+AI YG P LF+DVD+YIDPVID++L+KNI+   GR+FV+LGDKEVD+DP+FR+YL TK SNPK+ P ++ K++VINYTVT  GLEDQLLSV+V  ER +LE QRE LI +TS+NK+LL+ LEDSLLREL+TSTGNMLDN ELI TLE TK+KA  V E+LKL A T+ +I+  R+GYR AAKRGA+LFF L++M+T+NSMYQY+L+AYLDVF +SL+K++PD +L KRL N++ TLT NVY YGCTGIFE+HKLLF+FQI  KL    G L Q ELDFFIKG+ ++  ++R  P  WLS+ SW+DV KL    P  F  L +   R    WK+W + E PE    P DY+ K  +FQKL  LRCFR+DRI+R+I  Y++E M E Y+ PP+++F  I++Q++   P+ F+LS GSDP +D++KLA+ +  G +    IS+GQGQE  A  LLD AI +G WL+LQN HLL++++RELEK L+R+  PHPDFRLW+TT+PT  FPIGILQ+SLKVVTEPPNGLKLNLRSTY K+    L + +H AF  LV+ LAFFHAVVQERRKY K+GWNI YDFN++DF VC +IL+TYL +    G  KIPW SLKYLIGEVMYGGR IDDFDRRI   YM+EY GDFLFD F+ FHFY      Y +P+ +T   +D + +I+ LPL N P+VFGLH NAEIGYYT AA+ +W+ LI++QPQTG+     SRD+ I+  A+GI  KLP  F+  R+RK+  + +SPT VVLLQEL+RFN+LV R+ K+L  L +A+ GE+GM   LD++A SL+NG +P  W +LAP T K LA+W+ H   R  QY  W  +GEP VMWLSGLHIP+SYLTALVQ  CR+N WPLD+STL+T VT+FA   +V ER   GC VHGLY+EG  +D +   L R  PK L++ L ++ V PIEAHRLK QNT+L PVY TS RRNAMGVGLV EA+LAT+E  SHW+LQGVCL LNTD
Sbjct: 1139 ELVGEKTLIEYDMDFVVNLKRDVFDVLFEAQQFEHLGFTLPAVLRTAIMKKDLLFKDYERMTEVVDRYRSIINNLSMSEVIFLRGHIYDTELFIQMGVGRYTWTSFNIGKFCDQINSQLRKLTSIVSQINFIRLDLRSRIDMIKSFNLFNLDDELKVEDTSRSSGESYLQDRKNPSQRFKSVTGETITMFSVEKDVPADEKAEQACGSGIYPCQGYFELLEASRNRKAAQMKKLYDSLGPVLVKLESLVLGTFSGRS-DRMKTYYEYWEGETFKCIVDMTYQNLKCYINRLLS-NKP--MFEVNAVLLMSEIVLEPSVQELQNTIVTATKDYISRLRIFTRWMTGTCIACPLVEM-GKQFKYNYTYYEDVIQIRSIVDLVINIHDLASRVANEARGFVSQFRKYFNLWAFEKS-FI------CQKFLEKQVTLIEIDEKFTFYSSIVETLANTRKFQDIKCVRINLEPLLASITQHAQDWCTTLGEELLRHVNDNMRAMRNEVKTLSLNLNKTTRELEDFKLVMTTIGTVQSSTLTNEQKIHEMQETFTILSEHKIMFPYEDMLMAHHLEKRWKRLFLSALYRYEKLQPIKQKFADMTSVEIDEFCDDLAEFIKDYDENGPGSVGAELERGVRLMDPYGQKIAERESRREELANAERLFDMAMVDYHEFARVQTEFEGLQQLYKLYKAQKYAREGWGKTLWADLDPNVLTEGVESYLKEFRKFTKAVRTLPVGVQLEIHMKQFKGTVPLMVSLKHEALRERHWLQLMEKTGQYFDMSPARFTLENMFAMQLHKYQEIAEQILTNAIKELQIERGVQAVIETWASMAFKTFKHFKGSDDRGWVLGPVDEIMQILEDNAMNLQSMGASQFIGPFLETVNKWERTLALISEIIDEWLVVQRKWLYLEGIFIGGDIRTQLPEEARKFDDIDKSYRRIMVDCAKNPLVVPFCTVPGRLVEIQGLGIGLENCQKSLNEYLDSKRRIFPRFYFISTDELLSILGSSEPSAVQNHIIKMYDNIKSLRLVKEGS-QTIVTGMISSEGEVMEFRHSARAAGRVEYWMNDVLDEMRRSNRFINKTAIYDFGTDLQISRPDWLMNYQGMVGLAASQVWWTAEVEEAFDQAQNHGNMRAMKDFLGKNNYQIEELVLKVRSNLSRNDRLKFKAQCTVDVHARDIIDNFVRDNVLDASEFSWESQLRFYWIKFYDNLHVLQCSGSFDFGYEYMGLNGRLVITPLTDRIYLTITQALLMNLGGAPAGPAGTGKTETVKDLAKAMGLLCVVTNCGEGMDYRAVGTILSGLVQCGAWGCFDEFNRIDISVLSVISTQLQTIRNGLIRKLDRFVFEGVEIHLDPKCGVFVTMNPGYAGRTELPESVKALFRPVTCIKPDLELICLISLFSDGFLTAKVLAKKMTVLYSLAQAQLSKQCHYDWGLRSLNSVLRMAGVMKRQSEDLPEAVVLMRVLRDMNFPKFVFEDVPLFLGLIKDLFPGIDCPRIGYPDFNAAVRHVLVNDGYILLPDQEDKVVQMYETMMTRHSTMLVGPTGGGKTVVINALVKAQTHMGLPTKCLVLNPKACSVIELYGFLDMETRDWIDGLFSNIFREMNKPIEREERRYACFDGDVDALWIENMNSVMDDNKLLTLANGERIRLENYCALLFEVGNLNYASPATVSRAGMVYVDPKNLRYSPFWQRWVLTRPEP-QRELLNDFFEKIITQSIAFILEGLDGTTQGNPLKLVIMQTDLNMVTQFCNLYDALLPNYVMDSKNYDEPVQQNYNTDSLECCFLQAVYGSMGACLVEKHQPVFDEYMKRISGFPLVQDTPENPASGGQFPQSKPTLYDYFWDV--KDNVWKAWEWVVQPYTHDPQVKFSEILVPTVDNTRTNRTLSLMSEIKRPVLLVGEAGTSKTATIMQYLRNLNPSVNVILNINFSSRTSSLDVQHTLEAAVEKRTKDTYGPPMGKRIACFIDDMNMPQVDDYGTQQPIALLKLFFERGGMYDRDKDLNWKKFKDLTFYAAMGTAGGGRNEVDPRFISMFSTYNIIFPNDESLIQIYSSIFKGHMVFVKFQPEYMLIADMIVHMTLKLFKMVIVDLPPTPSKFHYIFNLKDLSRIFAGMLLIEPTCFKGLRDLIRVWRNEYTRIICDRLITDNDIANVRRNLAVEVAERFPPTFEEEHGFIDAAAAEAEAQARLLYEPSKADIDGGEEEGEEEEEGEEAPQVILSLKDYVLRDPLLFGDFRNFTNESEPRLYEDLLDYNSVYFLFTEILEEYCERKQKMTLVLFEDCLEHLTRVHRTLRMNRGHVLLIGVGGSGKKCITRLAAFAAECDVFEITISRGYNEAAFREDLKVLYTIAGVKRKKVVFLFTGAQVAEEGFLELINNILTVGQVPALFPDEDKDGIVNQVRKFAEEDGVSASKDAVWGYFLRTCAENLHVVLCMSPAGDALRNRCRNFPGLIGSTYIDWVFPWPRQALYAVAKLFL-TEHRLIPASHREAIVEHVVHVHTSIQQYSKDYLAKLRRNNFVTPKHYLDYINTYRGLLEEKAKFITQQRSRLGEGIKKIEEASVQIDELRIIVTEQKKNVAVASEECEAMLVTIESSTQKANVKKAEASEKSVEVEIKGKQIAIEKDEAEEILAEAMPALEEARLALSQLEKAQITEIRSFATPPAAVQVVCECVAILKGYKEINWKSAKGMMSDVNFLKSLMEMDCEALTQKQITQCRQHMKTG--NLEDMAKISVAGAGLLRFVRAVLGFFDVYKEVKPKKERLDFLVEEQEVQIKLLNHLNGEIQKLEEKLNELNENYATSMKQMRALTEMMQQAERRLIASDKLISGLTSELIRWSKEMASLGQQLIDSVGGCLISASFLAYTGAFTWEFRKAMVFDDWLEDIASLGIPIQLPFKIDGYLTTDVEISQWSNEGLPPDELSIQNGILTMRASRFPLCIDPQLQALQWIRKREFKNNLKVLSFSDSDFLKQLEMAIMYGTPVLFEDVDDYIDPVIDDILQKNIRIQGGRKFVMLGDKEVDWDPSFRVYLTTKFSNPKFDPAVYAKALVINYTVTQTGLEDQLLSVVVGTERPDLEAQRESLIAQTSENKQLLQQLEDSLLRELSTSTGNMLDNVELIETLENTKTKAGVVMEQLKLAADTAADIEVLRNGYRPAAKRGAVLFFALSDMATVNSMYQYALAAYLDVFVYSLRKAVPDASLNKRLNNIIKTLTENVYCYGCTGIFERHKLLFSFQIATKLAQRDGILLQSELDFFIKGSIALTKSERSNPCKWLSEKSWEDVLKLAFDFPDIFGTLPDHFGRYLTEWKEWFDLENPEEVPCPGDYNIKCNAFQKLMFLRCFRVDRIFRSINQYIVETMDEFYIMPPVVSFSAIYEQTSSTIPVCFVLSAGSDPTNDLIKLAD-TIVGMSNFCHISLGQGQEKAALRLLDGAIKQGMWLMLQNGHLLIRFVRELEKHLDRIENPHPDFRLWITTDPTPTFPIGILQKSLKVVTEPPNGLKLNLRSTYFKVRQERLESCSHVAFRPLVYVLAFFHAVVQERRKYDKLGWNIAYDFNDTDFDVCTEILRTYLTRC---GTGKIPWNSLKYLIGEVMYGGRVIDDFDRRITNCYMNEYMGDFLFDEFKVFHFYEDDNVDYCLPEEETILKEDYIAHIDKLPLVNKPDVFGLHPNAEIGYYTMAARNIWNSLIELQPQTGEGTGGISRDDFIDSVAAGILKKLPPAFETWRIRKQIQMSLSPTGVVLLQELDRFNLLVVRIKKTLELLRKAIAGEIGMDNVLDNIANSLFNGLLPAAWSKLAPATCKQLASWLEHLRLRAVQYKYWTLSGEPLVMWLSGLHIPQSYLTALVQIACRRNAWPLDRSTLFTYVTKFADPDDVEERPVTGCLVHGLYIEGGRFDLATNQLARSHPKVLVEELAILAVEPIEAHRLKLQNTYLAPVYTTSLRRNAMGVGLVFEANLATSEDLSHWILQGVCLTLNTD 5079          

HSP 2 Score: 139.428 bits (350), Expect = 8.771e-32
Identity = 112/477 (23.48%), Postives = 224/477 (46.96%), Query Frame = 1
Query: 1048 EMIESTVLKWDQQITGTLESLQKIVPHGPSPLAEIDFWRERNAXXXXXXXXXXXPKVKRILNLYSLAEGPVFDTQNNELNKFHIE---AKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIAWNLSDRVARLIDVNTIFNLPLEHVLKDTAEAEKMLRVWNDTYFEVRASIEASGRDARWEFDRKRLFEKTNYMADICHDLNEIAMILQEFYNIFGPELKSVTNEAKRIXXXXXXXXXXXXPL-KEMPFNPFNLMKHKYDWSNFMEDFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEVESIDQLFKTNMNNPPLYHFKSCVAGGISWERHLFYNIKRPILRFLTMDEMMQSDNGKRIRT---KYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILAL----ANSENFVSENV 2445
            + +E  V  W + +  T+++L        +P+AE  +W +    L   LEQLK   V  +L   +  + PV D     + K       AK+N+ +L  +  + + +    +F  V   IP +M  LR IW +S HY +D  M  L+ +I+     +V  +I+   IF     +  +       +LR W   Y   R  IE SG  +RWEFDR  LF + N++  +  D+  +  +  ++ N+FG  LK+   +   ++ +++KV  ++  L K + ++ F     + +W   +E F +++ ++EN+A + I+    +L S+E   D+++   +I +R  + + +  K  +++  +  E+ +++++F     +PP+   +      I W R L   +K  +L F  +++     N    R+   +Y  +   M  FE+  F  +      +++   R N+L +     ++ +++SE V
Sbjct:  523 QQLEEVVDGWIKYLKKTMKTLTDAKLDDFTPMAEHRYWHKMEVELYGTLEQLKTEFVVAVLQRLTDDKSPVLDEWQAVVEKTEARFKLAKENSDYLGTIIDYLEKVRSYESFKMVVLQIPNIMVGLRHIWTMSSHYCRDPEMQVLLCQISNVFVQKVKSIINFENIFKYSATYTYETATNCANLLRCWKQAYKLSRQHIEDSGAGSRWEFDRVALFNEVNHIHRVAVDIAYVGRVFVQYENLFGHRLKACIADPSIVDNLMRKVYRMLDDLIKSVDYDMFRPGNWE-NWEYSLELFNKRLDNVENEAKNVIDQSINSLLSSEKGLDLVVNAMNIDTRATLQEFVATKHENLLRFFVTEINAVERVFTKLKKSPPMAKHQPAKISAIFWARLLGKKLKTSVLAFKRVEDEPAIKNSFLKRSSFKQYFELMTVMFQFEKVLFENFIQNATYLVNTTNRSNVLRIRICKESTMSYISEAV 998          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Fly
Match: Dhc98D (gene:FBgn0013813 transcript:FBtr0337034)

HSP 1 Score: 3944.43 bits (10228), Expect = 0.000e+0
Identity = 2033/3964 (51.29%), Postives = 2675/3964 (67.48%), Query Frame = 1
Query: 2437 ENVPEETIDKMDDDLRVDFGFEINEIITETRNLELLGYKVPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISDYIEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFKL-----------QSGNKFLK------------------------------------------CKEFFEFMESERTSDFEHLGRKYSTIGPLITKLQGEIIGDRDVNPFEKFQPFYEFWEKRIFDRVYNMVLKNLQDYQNMLRDENFPTCLFEVDLMLAGTDVIGNPQTTEIYKLAIQDLRDAVEATRVFIRWKRNSCIETTGMKIDGQDELFYFTFYLDIGN-------SVEITYFCEQIANYYRNIIGKLRKYQDKWKKHKRVFIPNKQAQIDKWLTKDPTVMDFYERIRDTIDRKEELLNQPVIRKIGFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDLSLIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSNHPIDQEEIEESDKLRQLFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVF-FYRESKV-RVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKK-GQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQL-------------TREGMNQDTIEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMP-QSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQM--FSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAI------------EEQ-----------------LSENAKSD------------------------KDYAMTDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKRKKPYLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLTKPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDT--GDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTGKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGEPNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMGVGLVVEADLATTEHPSHWVLQGVCLILNTD 13926
            E V E+T+ + D D  V+   ++ +++ E +  E LG+ +P + R   ++ +   K  E +  +V  Y S+I +L   EV  L   I + +  I+ G+ R  W S  I  + ++ N  L    S V+ I+ + +D+  ++  I +  LF L            SG  +L+                                          C+ +FE +E+ R      + + Y ++GP++ KL+  ++G       ++ + +YE+WE   F  + +M  +NL+ Y N L   N P  +FEV+ +L  ++++  P   E+    +   +D +   R+F RW   +CI    +++ G+   + +T+Y D+          + I     ++AN  R  + + RKY + W   K  FI        K+L K  T+++  E+        E L N    + I  + +NL+ LL+ +  H + W       L      N+ +++N+++    +L+    +LE+ K +++TI T+Q  +L  E +I ++QE + +L+        E++  +  L + +  L   +     +L P+K KF D+T  EI +F  DL  F   + E GPGS+G +L+ G+ ++  +  ++   E RR+EL  AE+LF++ +  Y E   VQ E + L Q+Y+LY AQK ARE W +TLW +LD  VL EG+E +LKE+RK  + V+ +     L   +K+FK  +PL   LKHEALRERHW +LM KTGQ FD++P  FTL ++FAM+L+++Q++  +I+T+A KEL IE+GV+ V ETW ++ F    + KG  +RG++LG +DE++QIL+DNAMNLQSM AS+FIGPFL +V  WE+ L+LISE++D W+VVQRKW+YLEGIFIGGDIR+QLPEEA+KFD IDK++++IM + AK P++   C VP RL ++  L  GLE CQKSLN+YLDSKR  FPRF+FIS DELLSILGSS+   VQ H+IKM+DNI SLR  K  S +   T MISSE E+MEFR      GRVE WM  +  EMRR+NR I K A++ F  + ++ R  W+ +YQGMV L  +Q+WWT EVE+ F + +  G   A+KD+    + QI+E+V  VRS LS+NDR K      +DVHARDI+D+FVRD+++DA EF WESQLRFYW++  D + + QC+G F +GYEYMGLNGRLVITPLTDRIYLT+TQAL M LGGAPAGPAGTGKTET KDLAKA+GLLCVVTNCGEGMDYR+VG I +GL QCGAWGCFDEFNRI++SVLSVISTQL+TI+NGLI KL RF FEG EI LD + G+F+TMNPGYAGRTELPESVKA FRPV  I PDL+ IC I LFS GFL+AKVLAKKMT LY L++ QLSKQ HYD+GLR+L SVL MAG ++R   DL E  VLMR LRDMN PKF+FED PLFLGLI+DLFPG+DCPR+ YPDFN +V   L    YI+L DQ DK+VQ+YETM TRH+TM+VGPTGGGK+VVI  L  +QT + L TK + +NPK  SVIELYG LD  TRDW DGL SNIFRE+NKP ++ ERRY  FDGDVDALW+ENMNSVMDDNKLLTLANGERIRL+N+CALLFEVG+L YASPATVSR GMVYVDPKNL Y+PFWQ W+  +    + + L   ++K I  +I  ++EG+        LK +I  T+LN+VTQ CN+ D  L              ++  N D++E  F+Q++Y S+G CL+E  Q  FD+++K +   P   +  + PA  G+ P   PTL+DY++D   +   W  W  +V  Y H+P+ KFSEILVPT+D  R    L+   +I+RPVLLVGE GTSKTA    +LRN +P   + L INFSSRT+SLD+Q  LE+ VEKRTKD+YGPPMGKR+  FIDDMNMPQVD YGTQQPIA+LKL  ER G YDR KDLNWKK +D+ F AAMG  GGGRN+VDPRFIS+FS +N  FP+  SL  IYSSI  GH     F  E      +I  MT+ ++  +IV LPPTPSKFHYIFNL+DLSRI+ GM       F       RVWR+E+TR+I DRLI D+D   V++ +            EE+                 L E +K+D                        KDY + DP+LFGD+RN    +E RLYED+++Y +   LF EI+EEY E    M LVLF+D L+HLTR+HRT+RM+ GH LL+GVGGSGK+ +T+LAA+   CD+FEI +SRGY+E   RE+LK LY   G++ K  VF+F    V EEGFLELINN+L+ G VPALFPD++++ I++QVR  A   G+  SK+++W YF+  CA NLH+VLCMSP G+ LR RCRNFPG++ +T IDW FPWP QALYAVA +F+  E+ LIP   R  IV+H V VH S+++YSK+++ K RR N+VTPK+YLD+INTY  LLE+K KF   Q  RL  G++K+ EASVQ+ EL   +  QK  V   +  CE +L  I S TQ A  KK  A EKS  VE++ K+I  EK EAE  L EA+P LE+ARLAL  LEK  + EIRSFA PP  VQVV EC+A+ K YKEINWK AKGMM+D +FL+SL  MD + +T KQ    R  +      +++M  +S AG GLL+FV AVLG+ DV +E+KPK+E++  L +      + L  +  EI KLE +L +LN+ Y  ++ + + L E     +RRL A+DKLI+GL+SE  RW  ++  L  Q +  +G CL+ ++FL+Y GAF+WEFRK MV+  W +D+    IP+  PF+++  LT DVEIS+W++EGLPPDELSIQNGILT RASRFPLCIDPQ QAL WI ++E  NNLK  +F+D DFLKQLE+AI YG P LF+DVD+YIDPVID++L+KNI+   GR+FV+LGDKEVD+DP+FR+YL TK SNPK+ P ++ K++VINYTVT  GLEDQLLSV+V  ER +LE QRE LI +TS+NK+LL+ LEDSLLREL+TSTGNMLDN ELI TLE TK+KA  V E+LKL A T+ +I+  R+GYR AAKRGA+LFF L++M+T+NSMYQY+L+AYLDVF +SL+K++PD +L KRL N++ TLT NVY YGCTGIFE+HKLLF+FQI  KL    G L Q ELDFFIKG+ ++  ++R  P  WLS+ SW+DV KL    P  F  L +   R    WK+W + E PE    P DY+ K  +FQKL  LRCFR+DRI+R+I  Y++E M E Y+ PP+++F  I++Q++   P+ F+LS GSDP +D++KLA+ +  G +    IS+GQGQE  A  LLD AI +G WL+LQN HLL++++RELEK L+R+  PHPDFRLW+TT+PT  FPIGILQ+SLKVVTEPPNGLKLNLRSTY K+    L + +H AF  LV+ LAFFHAVVQERRKY K+GWNI YDFN++DF VC +IL+TYL +    G  KIPW SLKYLIGEVMYGGR IDDFDRRI   YM+EY GDFLFD F+ FHFY      Y +P+ +T   +D + +I+ LPL N P+VFGLH NAEIGYYT AA+ +W+ LI++QPQTG+     SRD+ I+  A+GI  KLP  F+  R+RK+  + +SPT VVLLQEL+RFN+LV R+ K+L  L +A+ GE+GM   LD++A SL+NG +P  W +LAP T K LA+W+ H   R  QY  W  +GEP VMWLSGLHIP+SYLTALVQ  CR+N WPLD+STL+T VT+FA   +V ER   GC VHGLY+EG  +D +   L R  PK L++ L ++ V PIEAHRLK QNT+L PVY TS RRNAMGVGLV EA+LAT+E  SHW+LQGVCL LNTD
Sbjct:  504 ELVGEKTLIEYDMDFVVNLKRDVFDVLFEAQQFEHLGFTLPAVLRTAIMKKDLLFKDYERMTEVVDRYRSIINNLSMSEVIFLRGHIYDTELFIQMGVGRYTWTSFNIGKFCDQINSQLRKLTSIVSQINFIRLDLRSRIDMIKSFNLFNLDDELKVEDTSRSSGESYLQDRKNPSQRFKSVTGETITMFSVEKDVPADEKAEQACGSGIYPCQGYFELLEASRNRKAAQMKKLYDSLGPVLVKLESLVLGTFSGRS-DRMKTYYEYWEGETFKCIVDMTYQNLKCYINRLLS-NKP--MFEVNAVLLMSEIVLEPSVQELQNTIVTATKDYISRLRIFTRWMTGTCIACPLVEM-GKQFKYNYTYYEDVIQIRSIVDLVINIHDLASRVANEARGFVSQFRKYFNLWAFEKS-FI------CQKFLEKQVTLIEIDEKFTFYSSIVETLANTRKFQDIKCVRINLEPLLASITQHAQDWCTTLGEELLRHVNDNMRAMRNEVKTLSLNLNKTTRELEDFKLVMTTIGTVQSSTLTNEQKIHEMQETFTILSEHKIMFPYEDMLMAHHLEKRWKRLFLSALYRYEKLQPIKQKFADMTSVEIDEFCDDLAEFIKDYDENGPGSVGAELERGVRLMDPYGQKIAERESRREELANAERLFDMAMVDYHEFARVQTEFEGLQQLYKLYKAQKYAREGWGKTLWADLDPNVLTEGVESYLKEFRKFTKAVRTLPVGVQLEIHMKQFKGTVPLMVSLKHEALRERHWLQLMEKTGQYFDMSPARFTLENMFAMQLHKYQEIAEQILTNAIKELQIERGVQAVIETWASMAFKTFKHFKGSDDRGWVLGPVDEIMQILEDNAMNLQSMGASQFIGPFLETVNKWERTLALISEIIDEWLVVQRKWLYLEGIFIGGDIRTQLPEEARKFDDIDKSYRRIMVDCAKNPLVVPFCTVPGRLVEIQGLGIGLENCQKSLNEYLDSKRRIFPRFYFISTDELLSILGSSEPSAVQNHIIKMYDNIKSLRLVKEGS-QTIVTGMISSEGEVMEFRHSARAAGRVEYWMNDVLDEMRRSNRFINKTAIYDFGTDLQISRPDWLMNYQGMVGLAASQVWWTAEVEEAFDQAQNHGNMRAMKDFLGKNNYQIEELVLKVRSNLSRNDRLKFKAQCTVDVHARDIIDNFVRDNVLDASEFSWESQLRFYWIKFYDNLHVLQCSGSFDFGYEYMGLNGRLVITPLTDRIYLTITQALLMNLGGAPAGPAGTGKTETVKDLAKAMGLLCVVTNCGEGMDYRAVGTILSGLVQCGAWGCFDEFNRIDISVLSVISTQLQTIRNGLIRKLDRFVFEGVEIHLDPKCGVFVTMNPGYAGRTELPESVKALFRPVTCIKPDLELICLISLFSDGFLTAKVLAKKMTVLYSLAQAQLSKQCHYDWGLRSLNSVLRMAGVMKRQSEDLPEAVVLMRVLRDMNFPKFVFEDVPLFLGLIKDLFPGIDCPRIGYPDFNAAVRHVLVNDGYILLPDQEDKVVQMYETMMTRHSTMLVGPTGGGKTVVINALVKAQTHMGLPTKCLVLNPKACSVIELYGFLDMETRDWIDGLFSNIFREMNKPIEREERRYACFDGDVDALWIENMNSVMDDNKLLTLANGERIRLENYCALLFEVGNLNYASPATVSRAGMVYVDPKNLRYSPFWQRWVLTRPEP-QRELLNDFFEKIITQSIAFILEGLDGTTQGNPLKLVIMQTDLNMVTQFCNLYDALLPNYVMDSKNYDEPVQQNYNTDSLECCFLQAVYGSMGACLVEKHQPVFDEYMKRISGFPLVQDTPENPASGGQFPQSKPTLYDYFWDV--KDNVWKAWEWVVQPYTHDPQVKFSEILVPTVDNTRTNRTLSLMSEIKRPVLLVGEAGTSKTATIMQYLRNLNPSVNVILNINFSSRTSSLDVQHTLEAAVEKRTKDTYGPPMGKRIACFIDDMNMPQVDDYGTQQPIALLKLFFERGGMYDRDKDLNWKKFKDLTFYAAMGTAGGGRNEVDPRFISMFSTYNIIFPNDESLIQIYSSIFKGHMVFVKFQPEYMLIADMIVHMTLKLFKMVIVDLPPTPSKFHYIFNLKDLSRIFAGMLLIEPTCFKGLRDLIRVWRNEYTRIICDRLITDNDIANVRRNLAVEVAERFPPTFEEEHGFIDAAAAEAEAQARLLYEPSKADIDGGEEEGEEEEEGEEAPQVILSLKDYVLRDPLLFGDFRNFTNESEPRLYEDLLDYNSVYFLFTEILEEYCERKQKMTLVLFEDCLEHLTRVHRTLRMNRGHVLLIGVGGSGKKCITRLAAFAAECDVFEITISRGYNEAAFREDLKVLYTIAGVKRKKVVFLFTGAQVAEEGFLELINNILTVGQVPALFPDEDKDGIVNQVRKFAEEDGVSASKDAVWGYFLRTCAENLHVVLCMSPAGDALRNRCRNFPGLIGSTYIDWVFPWPRQALYAVAKLFL-TEHRLIPASHREAIVEHVVHVHTSIQQYSKDYLAKLRRNNFVTPKHYLDYINTYRGLLEEKAKFITQQRSRLGEGIKKIEEASVQIDELRIIVTEQKKNVAVASEECEAMLVTIESSTQKANVKKAEASEKSVEVEIKGKQIAIEKDEAEEILAEAMPALEEARLALSQLEKAQITEIRSFATPPAAVQVVCECVAILKGYKEINWKSAKGMMSDVNFLKSLMEMDCEALTQKQITQCRQHMKTG--NLEDMAKISVAGAGLLRFVRAVLGFFDVYKEVKPKKERLDFLVEEQEVQIKLLNHLNGEIQKLEEKLNELNENYATSMKQMRALTEMMQQAERRLIASDKLISGLTSELIRWSKEMASLGQQLIDSVGGCLISASFLAYTGAFTWEFRKAMVFDDWLEDIASLGIPIQLPFKIDGYLTTDVEISQWSNEGLPPDELSIQNGILTMRASRFPLCIDPQLQALQWIRKREFKNNLKVLSFSDSDFLKQLEMAIMYGTPVLFEDVDDYIDPVIDDILQKNIRIQGGRKFVMLGDKEVDWDPSFRVYLTTKFSNPKFDPAVYAKALVINYTVTQTGLEDQLLSVVVGTERPDLEAQRESLIAQTSENKQLLQQLEDSLLRELSTSTGNMLDNVELIETLENTKTKAGVVMEQLKLAADTAADIEVLRNGYRPAAKRGAVLFFALSDMATVNSMYQYALAAYLDVFVYSLRKAVPDASLNKRLNNIIKTLTENVYCYGCTGIFERHKLLFSFQIATKLAQRDGILLQSELDFFIKGSIALTKSERSNPCKWLSEKSWEDVLKLAFDFPDIFGTLPDHFGRYLTEWKEWFDLENPEEVPCPGDYNIKCNAFQKLMFLRCFRVDRIFRSINQYIVETMDEFYIMPPVVSFSAIYEQTSSTIPVCFVLSAGSDPTNDLIKLAD-TIVGMSNFCHISLGQGQEKAALRLLDGAIKQGMWLMLQNGHLLIRFVRELEKHLDRIENPHPDFRLWITTDPTPTFPIGILQKSLKVVTEPPNGLKLNLRSTYFKVRQERLESCSHVAFRPLVYVLAFFHAVVQERRKYDKLGWNIAYDFNDTDFDVCTEILRTYLTRC---GTGKIPWNSLKYLIGEVMYGGRVIDDFDRRITNCYMNEYMGDFLFDEFKVFHFYEDDNVDYCLPEEETILKEDYIAHIDKLPLVNKPDVFGLHPNAEIGYYTMAARNIWNSLIELQPQTGEGTGGISRDDFIDSVAAGILKKLPPAFETWRIRKQIQMSLSPTGVVLLQELDRFNLLVVRIKKTLELLRKAIAGEIGMDNVLDNIANSLFNGLLPAAWSKLAPATCKQLASWLEHLRLRAVQYKYWTLSGEPLVMWLSGLHIPQSYLTALVQIACRRNAWPLDRSTLFTYVTKFADPDDVEERPVTGCLVHGLYIEGGRFDLATNQLARSHPKVLVEELAILAVEPIEAHRLKLQNTYLAPVYTTSLRRNAMGVGLVFEANLATSEDLSHWILQGVCLTLNTD 4444          

HSP 2 Score: 123.635 bits (309), Expect = 4.438e-27
Identity = 86/363 (23.69%), Postives = 175/363 (48.21%), Query Frame = 1
Query: 1381 VTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIAWNLSDRVARLIDVNTIFNLPLEHVLKDTAEAEKMLRVWNDTYFEVRASIEASGRDARWEFDRKRLFEKTNYMADICHDLNEIAMILQEFYNIFGPELKSVTNEAKRIXXXXXXXXXXXXPL-KEMPFNPFNLMKHKYDWSNFMEDFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEVESIDQLFKTNMNNPPLYHFKSCVAGGISWERHLFYNIKRPILRFLTMDEMMQSDNGKRIRT---KYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILAL----ANSENFVSENV 2445
            V   IP +M  LR IW +S HY +D  M  L+ +I+     +V  +I+   IF     +  +       +LR W   Y   R  IE SG  +RWEFDR  LF + N++  +  D+  +  +  ++ N+FG  LK+   +   ++ +++KV  ++  L K + ++ F     + +W   +E F +++ ++EN+A + I+    +L S+E   D+++   +I +R  + + +  K  +++  +  E+ +++++F     +PP+   +      I W R L   +K  +L F  +++     N    R+   +Y  +   M  FE+  F  +      +++   R N+L +     ++ +++SE V
Sbjct:    2 VVLQIPNIMVGLRHIWTMSSHYCRDPEMQVLLCQISNVFVQKVKSIINFENIFKYSATYTYETATNCANLLRCWKQAYKLSRQHIEDSGAGSRWEFDRVALFNEVNHIHRVAVDIAYVGRVFVQYENLFGHRLKACIADPSIVDNLMRKVYRMLDDLIKSVDYDMFRPGNWE-NWEYSLELFNKRLDNVENEAKNVIDQSINSLLSSEKGLDLVVNAMNIDTRATLQEFVATKHENLLRFFVTEINAVERVFTKLKKSPPMAKHQPAKISAIFWARLLGKKLKTSVLAFKRVEDEPAIKNSFLKRSSFKQYFELMTVMFQFEKVLFENFIQNATYLVNTTNRSNVLRIRICKESTMSYISEAV 363          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Fly
Match: Dhc93AB (gene:FBgn0013812 transcript:FBtr0273236)

HSP 1 Score: 2199.48 bits (5698), Expect = 0.000e+0
Identity = 1440/4460 (32.29%), Postives = 2400/4460 (53.81%), Query Frame = 1
Query:  850 IESIDEKVHETRAAVQARDEFLISLKKFTSIVDQTIIQIASE-VKLEIPDLDLFENDKENLSDKEIMEMIESTVLKWDQQITGTL-ESLQKIVPHG--PSPLAEIDFWRERNAXXXXXXXXXXXPKVKR---ILNLYSLAEGPVFDTQNNELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIAWNLSDRVARLIDVNTIFNLPLEHVLKDTAEAEKMLRVWNDT--YFEVRASIEASGRDAR----WEFDRKRLFEKTNYMADICHDLNEIAMILQEFYNIFGPELKSVTNE--AKRIXXXXXXXXXXXXPLKEMPFNPFNLMKHKYDWSNFMEDFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEVESIDQLFKTNMN----NPPLYHFKSC--VAGGISWERHLFYNIKRPILRFLTMD-EMMQSDNGKRIRTKYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILALANSENFVSENVPEETIDKMDDDLRVDFGFEINEIITETRNLELLGYK-VPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISDYIEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFKLQSGNKFLKCKEFFEFMESERTSDFEHLGRKYSTIGPL---ITKLQGEIIGDRDVNPFEK---FQPFYEFWEKRIFDRVYNMVLKNLQDYQNMLRDENFPTCLFEVDLMLAGTDVIGNPQ-----TTEIYKLAIQDLRDAVEATRVFIRWKRNSCIETTGMKIDGQDELFYFTFYLDIGNSV-----EITYFCEQIANYYRNIIGKLRKYQDKWKKHKRVFIPNKQAQI---DKWLTKDPTVMDFYERIRDTIDRKEELLNQPVIRKIG-------FISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDL--SLIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSNHPIDQEEIEESDKLRQLFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGG-DIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSS-DCECVQEHMIKMFDNISSLRFTKGTSLEM-SATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQAD---KIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTREGMNQDTI----EAIFIQSIYWSLGGCLIEDSQVKFD-QFIKSLCAMPQSNEEDKPAKAGELPSRFP---TLFDYYFDSIEEKQEWIPWANLVPQYVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQMFSDEIKNTVPIITKM-------TMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDD--------KTFVQKAIEEQLSENAKSDKDYAMTDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVF-----KNYKEINWKVAKGMMAD-PSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKD--DVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNI--KGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKRKKPYLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKF--ISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLTK-PHPDFRLWLTTEPTEA-----FPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTA-FPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTGKS--GSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGE-PNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMGVGLVVEADLATTEHPSHWVLQGVCLILNT 13923
            + S+   VH+ +  V    E ++++     +  + I++ A E V+ E    DL+           +   IE  V+KW  QI   + ES      +G  P+P  E  FW  R   LS + +QL+  +++    IL     A  P F T    +     EAKD T +L+ ++R  + +   ++F      + P M  + ++W  SR+Y +  ++  L++ I   +  +  R +D ++IF+  ++  ++    + ++L+ + +   Y++ R +   +  + R    W F    +F++ N   +    +      + EF  +   E+  +     + RI +V  +  +         ++  +   H++D  +F + F+ +++ ++ +    +   F    + E  F ++     +  R  I +  TQ++ +I+   + E+   + ++   M        LY   +C  VA  I W   L   I  P+  F  +  E+ +++  + I  +Y  +   + + + + F++W   +D  + E L+K+++A                 D+  + L ++F   +  I+ E   ++ +  + +P++A + A + + +      L   +  Y+S+ +    +E++++  EIK +   +  G+ +L WNS  I  Y++K    +   ++++         I + +       LF+ +       CK+       ER    +   ++Y+ I      I KL  + +   D+   +    +  + +F +  +++ +   V  ++      +  EN    LFE  L L   +++  P            + I+ +RD ++   +  R K N       M  + QD         +I N V     E + FC Q   Y    +    +  + + ++ R+  P++   I   D             E  R+ ID  E L N+  I  IG       +  V+++     + +   +W +++   L  +  ++L ++ + I      L  ++   D E L ++++ +  ++  + + +     +QE  ++L   +  I +E      +L + + +    +  V  +++P++       + +I+ F   ++ F + FK         D     +++ + +D++   E   +++  +  LF + I  +  L   +KE++ L Q+++  +    + ++W  T W+ +D++ +D   + F K+ R + +E++   T  NL   +K    +L    +L++ A+RERHW +LM  T   F ++ +T TL+ +  + L+  ++ +  IV  A KE+S+EK +R++  TW  ++F  + + + G     +L A +E+++ L+DN + LQ++  S++I  FL  V  W+  L +  +V+ VW  VQR W +LE IF+   DIR QLP ++ +FD ID  F+ +M E +    +  +      +  L +L   L  C+K+L +YL++KR AFPRF+F+S  +LL +L +    E V +H+ K+FD+I+ L+F +  S E+ +A+ M + + E +EF     I G VE W+ +I+  MR + R    EAV  Y E K R QW+FDY   V+LC +QIWW+ EV   F ++++G   A+KDY K   +Q+  ++  +   LSK DR K+ T+  IDVH+RD+V   ++  +     F W+SQLR  +     +     C  +F Y +EY+G   RLVITPLTDR Y+TLTQ+L + +GGAPAGPAGTGKTETTKDL +A+G+   V NC E MDY+S G I+ GL Q GAWGCFDEFNRI V VLSV++ Q+K++Q+ +  K  +F+F G+ I     VGIFITMNPGYAGRTELPE++KA FRP  ++VPD + ICEIML ++GF  A+VLA+K  TLY L KE LSKQ+HYD+GLRA+KSVLV+AG L+R DP   E++VLMRALRD N+PK I +D P+F+GLI DLFP LD PR R  DF  +V++  ++   ++L  + +   K+VQL E ++ RH+  +VG  G GK+ V K L  +   ++       +NPK  +  EL+GI++P TR+W DGL S + R+    T  ++ ++++ DGD+D +W+E++N+VMDDNK+LTLA+ ERI L     LLFE+ +L+ A+PATVSR G++Y++P++LG+NP+   W+  ++   E   L  L+ KYIPP+++ +           + K I P+  +  +  LC++L+C L       D      E  F+ +  W+ G  + +D  + +  +F K          E K  K       FP   T+FDY+ DS  E + ++PW   +P++  + +     ++V T +++RL + L   +  + PV+LVG  G  KT +    L++   + Y    I F+  TTS  +Q+ LE  +EK+   +YGPP  K L  F+DD+NMP+VD YGT QP  +++  L+    YDR K L  K + +  ++A M  P  G   ++PR    F V   +FP   S+  +YSSIL+ H   F++  +   PI+T+M       T+ ++N+ +    PT  K HYIFNLRD+S ++QG+  ++ +  T S    R+W+HE  RV  D+L +D D           V+K+ EE + E+   DK      P ++  +   +   +   Y  +  +     L QE M  Y++ V+ M LVLF+DA+ H+ RI+R +    G ALLVGVGGSGKQSL +LAA+  S ++ +I L +GY   DL+     LY K G++N   +F+  D  +  E FL LIN+ML++G +P LFPDDE E II+ VRNE   AG+  ++E+ W++F+++    L IVLC SPVG TLR R R FP ++N T+I+WF  WP++AL +VA  F+  +N ++P++ R  + K    VH SV   SK ++Q  RR NY TPK+YL+ IN Y+KLL  K++  +S+ +RL+ GL+KL   ++Q+A+L  KLA+Q++ + EK  A + L++ +   T+    +K +A E+   V + + E+ K++ + E  L++A P L  A+ AL+ L K ++ E++SF  PP  V  V+  + V      K  K+ +WK AK  MA   +FL SL   D +NI  + +  ++  L   +   + +RS S A  GL  +V  ++ + +V  +++PKR+ +A         + +L  +K ++  LE +L  L   +E A  ++ R Q+E D  Q  +  A++L+ GL+SEN RW   +     Q + L GD L+ +AF+SYVG F+  FR +++   W      ++  IP ++      +LT+D  I+ W +EGLP D +SI+N  + + + R+PL IDPQ Q + WI QK    +LK        +L  +E +I  G   L +++DE +DPV+D++L +N+  KG    + + +GDKE++++ NFRL L+TKL+NP Y P +  ++ +IN+TVT  GLEDQLL+ +VK ER +LEE +  L ++ +D K +LK LED LL  L+++  N+L +T L+  LE TKS ASE+ +K+     TS+EIDK R+ YR AA R ++L+F+L E++TIN +YQ+SL A+  VF+ ++ K+ P   L  R+ N++  +T +V+ Y   G+FE  KL+F  Q+T ++ +    +T  ELDF ++      V     P  +L++ SW  +  L      +F  L  DIE     WK+ +  E PE    P+++ NK  + Q+LC++R  R DR+  A+  ++ E++G +YV    + F + +++++P +PI FILSPG +P  DV  L ++ GF      F  +S+GQGQEA A+  +D A   GHW++LQN HL+ KWL  LEK LE   +  HPD+R++L+ EP         P GIL+ S+K+  EPP G+  NL    +     +L      A F +++F+L +FHAVV ERRK+G  GWN  Y FN  D  + + +L  YL     + ++K+PW  L+YL GE+MYGG   DD+DRR+  TY++EY    L D      F A  F     P  D         E +P E +P ++GLH NAEIG+ T+ A+ ++  + ++QP+   +  G++ +R++ + +    I  KLP+ F++  +  K   + +P ++V  QE ER N L   M +SL  L   L GE+ ++++++ +  SL+  Q+P IW + A  +L  L NW      R  +   W  +   P+ +WL+G   P+S LTA++Q+T R+N  PLDK  L   VT+     E T     GC VHG+++EGA WD  Q  ++  + K+L  S+PVI +  I   +   +N +  PVY T  R     V      +L T + P  W+L GV L+L T
Sbjct:  156 VHSLKSTVHQVKGQVSG--ETILAM----PVGVEKIVKAAKELVETEQCQFDLY-----------LKSAIEGVVIKWATQIHEVIKESPSNAFANGQNPTPHTEFTFWNNRLKNLSFIYDQLRNERIRAMALILEYSMSAYHPCFQTLFKNVVTALAEAKDITLYLNPLKRPLQHLE-EIDFAECKPLLIPFMNTVGILWGNSRYYCQSAKITVLLQEICNLIIHQAKRYLDPSSIFHSDIDEAMQRLTLSIQILKFFRELFDYYKERLATFFTEPEERPPILWTFHPNSVFKRFNAFLERLTTIQWFFFTVIEFLKLEKVEIGGLRGRQLSTRITDVYVEFNQYFTAFASKSYDVLDPDDHEFD-EDF-KGFQTRILELDMKLAAILCQAFDDCHNLESIFKLISIVGSVLDRPKIKEEFTQRYAEIVRMLDDEMTICESIYDKQMELKKVGDNLYPNYNCPPVAAFIRWCHQLETRITAPVKNFKALQHEITKTEKSQEIVERYEILMVKLGSCKTQFFDDWAGQLDGQIEENLKKSLIAR----------------DRRHNSLILNFSAALFSILREVHYMQQMKIEGIPQIAIDFAEKSDVFRSYTLNLEKTIDWYNSIQEGSSPVELRLIEPEIKMIDDLVEIGVNQLVWNSSDILSYLDKLRKPVAALQNRMDHTQGNLRQIRKIMGVWAKQPLFERRD------CKKDTVLSIDERP---DRTSKRYAEIQAASIEIHKLLQDNMLQFDMESKQDDAVWLSYVDFVDNIVYENILKTVGVSVGYLAENMDPENNYAPLFESRLELVEPNLVFVPSLDPEDPMGFNNMLIELMRDIMKMGSLIKRLKPNEKRNYVEMIKENQD---IIDMRREILNGVDLVMEEASRFCRQFERYSYLWLDDREECMEYFLEYGRMLDPDEIELILINDPNQPPPQPCQPTIEAFREQIDNYESLFNE--IEDIGPFQVFSSWFQVDVRPFRQALLNTVCKWGNMFKEHLVTTVTSSLMNLSHFIRKADEGLLQTVKEKDYEGLVSIMAYLMQVKERAAKTDEMFEPMQETIQLLKYYDMDIPEEVNVLLQELPEQWANTKKIASTVKQQVSPLQATEVVSIRNKIALFESHIQLFREVFKTYD--FFRFDCYKPYLLMDRINDDMFLCESEMRDIQESGSLFEVNIPEFKVLKQCRKELRMLKQLWDYVNIVATSIDDWKTTPWRKVDVENMDIECKKFAKDIRLLDKEMRPWDTFINLESTVKNMLTSLRAVGELQNPAIRERHWNQLMNSTKVKFIMDHET-TLAELLGLNLHECEEEVKNIVDKAVKEMSMEKILRDLNTTWTVMEFDHELHPRTGCN---LLKASEELIETLEDNQVCLQNLITSKYIAHFLEEVSTWQNKLMIADQVITVWFEVQRTWTHLESIFMSSEDIRKQLPVDSDRFDNIDAEFRVLMDEMSVSSNVVASTNRSGLIERLEHLQKELTLCEKALAEYLETKRLAFPRFYFVSSADLLDVLSNGIQPEMVTKHLTKLFDSIARLKFNRDESNEINTASGMYAKDGEYVEFNELASIRGPVEVWLNRIQAAMRASLRHYVMEAVIAYEE-KQREQWLFDYPAQVSLCGSQIWWSTEVNIAFSRLEEGYDNAIKDYYKKQISQLSLLITLLLGELSKGDRQKIMTICTIDVHSRDVVAKMIQAKLDSGSAFMWQSQLRHRFDDVEKDCFANICDAEFQYCHEYLGNTPRLVITPLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDLGRAIGISVYVFNCSEQMDYQSCGNIYKGLAQTGAWGCFDEFNRITVEVLSVVAVQVKSVQDAIRDKKDKFNFMGEMISCVPTVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFQDARVLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDPGRPEEEVLMRALRDFNIPKIITDDMPVFMGLISDLFPALDVPRKRDQDFERTVKQAASD---LLLQPEDNFILKVVQLEELLEVRHSVFIVGNAGTGKTQVWKTLLRTYQNIKRKPIFNDLNPKAVTNDELFGIINPATREWKDGLFSVLMRDQANITG-DQPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTPSMRLLFEISNLRTATPATVSRAGILYINPQDLGWNPYVTSWVETRKIPAEKSNLVMLFDKYIPPSLETI---------RVRFKKITPVAEMAHIQMLCHLLNCFLIPANTPADCPKEWHELYFVFACIWAFGSAMFQDQAIDYRVEFSKWWV------NEFKTVK-------FPPGGTVFDYFLDS--ETKTFLPWTEKIPKFELDSDLPLQAVIVHTSESIRLRFFLDLLMDKKHPVMLVGNAGCGKTVLVNEKLQSLS-ENYAVTTIPFNYYTTSEMLQKILEKPLEKKAGRNYGPPGNKLLCYFVDDINMPEVDAYGTVQPHTLMRQHLDYGHWYDRNK-LTLKDIHNCQYVACMN-PTSGSFTINPRLQRHFCVLAVSFPGPESITVMYSSILAQH---FANAEQKFTPIVTRMTPNIVAATIALHNKCLQVFLPTAIKSHYIFNLRDISNVFQGLLFSSTECLTGSTDLIRLWQHETQRVYSDKLTDDKDIDSFTKMQHDIVKKSFEE-IDESVIFDK------PNIYCHFAGGIGDPK---YMPIKGWPELHKLLQEAMSSYNDLVAAMNLVLFEDAMMHVCRINRILESPRGSALLVGVGGSGKQSLARLAAFISSLEVVQIQLKKGYGVNDLKNEFSGLYLKAGLKNVGIMFLMTDAQIPSEDFLVLINDMLATGEIPDLFPDDEIENIIAGVRNEVKGAGLVDTRENCWKFFIDRVRKQLKIVLCFSPVGSTLRVRSRKFPAIINATSINWFHEWPQEALISVAMNFLA-QNKVLPENHRDSVAKFMAYVHTSVNTTSKVYLQNERRYNYTTPKSYLEQINLYIKLLNHKNEDLQSKIERLENGLEKLRSTALQVADLKVKLAVQEIELKEKNEAADALIEIVGIETEKVQTEKAVADEEEMKVALIADEVSKKQRDCEEDLLKAEPALMAAQDALNTLNKANLTELKSFGSPPGAVTNVTAAVMVLLSQGGKVPKDRSWKAAKIAMAKVDTFLDSLINYDKENIHPEITKAIQPYLKDPEFEPEFVRSKSGAAAGLCAWVINIIKFYEVYCDVEPKRKALAAANAELAAAQDKLAGIKRKVMSLEEQLGKLTADFEKATADKLRCQQEADATQATIALANRLVGGLASENVRWAEAVNNFVKQGITLPGDILLITAFISYVGCFTKGFRIDLLLKMWTPFLKSIDPPIPTTENLDPLSLLTDDTTIAIWTNEGLPSDRMSIENATILSNSDRWPLMIDPQLQGVKWIKQK-YGEDLKVIRLGQRSYLDIIEKSINAGCNVLIENIDENLDPVLDSLLGRNLIKKG----KAIKIGDKEIEYNSNFRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKAERPDLEELKADLTKQQNDFKIMLKKLEDDLLSRLSSAGENILGDTALVENLETTKSTASEIEQKVAEAKITSKEIDKAREYYRPAAARASLLYFILNELNTINPIYQFSLKAFSVVFQKAIAKAEPGDTLDLRVSNLIDCITYSVFQYTSRGLFECDKLIFASQMTFQILLMNEEVTSAELDFLLRFPIKPHVT---SPVDFLTNQSWGGICSLAS--KDEFRNLDRDIETSSKRWKKLVESELPEKEKFPQEWKNK-TALQRLCMIRALRPDRMTYALADFIEEKLGSKYVESRAMEFAKSYEEASPSTPIFFILSPGVNPLKDVEALGKQMGFSMDLGNFHNVSLGQGQEAIAEAAMDTAAKHGHWVVLQNIHLVRKWLPVLEKKLEYYAEDSHPDYRMFLSAEPASTPSAHIIPQGILESSIKITNEPPTGMLANLHKALDNFTQETLEMSGKEAEFKAILFSLCYFHAVVAERRKFGPQGWNKIYPFNVGDLNISVSVLYNYL-----EANAKVPWEDLRYLFGEIMYGGHITDDWDRRLCITYLEEYMQPDLVDGEL---FLAPSFPA--PPNTDYQGYHTYVDEMMPAE-SPYLYGLHPNAEIGFLTTRAENIFRTVFEMQPRDAGAGGGATVTREDKVKQIVDEIIEKLPEEFNMVEIMNKVE-ERTPYVIVAFQECERMNFLTSEMKRSLKELDLGLKGELTITSDMEVLENSLFLDQVPPIWTQRAYPSLLGLNNWFIDLCLRLRELETWSTDFVLPSCVWLAGFFNPQSLLTAIMQSTARRNDLPLDKMCLQCDVTK-KQKEEFTTAPRDGCCVHGIFMEGARWDIQQGIIMESRLKELYPSMPVINIRAITQDKQDLRNMYECPVYKTRTRGPTTYVS---NLNLKTKDKPGKWILAGVALLLQT 4486          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Fly
Match: Dhc93AB (gene:FBgn0013812 transcript:FBtr0336774)

HSP 1 Score: 2191 bits (5676), Expect = 0.000e+0
Identity = 1441/4477 (32.19%), Postives = 2402/4477 (53.65%), Query Frame = 1
Query:  829 SQSDGDKIESIDEKVHETRAAVQARDEFLISLKKFTSIVDQTIIQIASE-VKLEIPDLDLFENDKENLSDKEIMEMIESTVLKWDQQITGTL-ESLQKIVPHG--PSPLAEIDFWRERNAXXXXXXXXXXXPKVKR---ILNLYSLAEGPVFDTQNNELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIAWNLSDRVARLIDVNTIFNLPLEHVLKDTAEAEKMLRVWNDT--YFEVRASIEASGRDAR----WEFDRKRLFEKTNYMADICHDLNEIAMILQEFYNIFGPELKSVTNE--AKRIXXXXXXXXXXXXPLKEMPFNPFNLMKHKYDWSNFMEDFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEVESIDQLFKTNMN----NPPLYHFKSC--VAGGISWERHLFYNIKRPILRFLTMD-EMMQSDNGKRIRTKYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILALANSENFVSENVPEETIDKMDDDLRVDFGFEINEIITETRNLELLGYK-VPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISDYIEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFKLQSGNKFLKCKEFFEFMESERTSDFEHLGRKYSTIGPL---ITKLQGEIIGDRDVNPFEK---FQPFYEFWEKRIFDRVYNMVLKNLQDYQNMLRDENFPTCLFEVDLMLAGTDVIGNPQ-----TTEIYKLAIQDLRDAVEATRVFIRWKRNSCIETTGMKIDGQDELFYFTFYLDIGNSV-----EITYFCEQIANYYRNIIGKLRKYQDKWKKHKRVFIPNKQAQI---DKWLTKDPTVMDFYERIRDTIDRKEELLNQPVIRKIG-------FISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDL--SLIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSNHPIDQEEIEESDKLRQLFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQ----------NFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGG-DIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSS-DCECVQEHMIKMFDNISSLRFTKGTSLEM-SATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQAD---KIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTREGMNQDTI----EAIFIQSIYWSLGGCLIEDSQVKFD-QFIKSLCAMPQSNEEDKPAKAGELPSRFP---TLFDYYFDSIEEKQEWIPWANLVPQYVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQMFSDEIKNTVPIITKM-------TMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDD--------KTFVQKAIEEQLSENAKSDKDYAMTDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVF-----KNYKEINWKVAKGMMAD-PSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKD--DVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNI--KGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKRKKPYLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKF--ISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLTK-PHPDFRLWLTTEPTEA-----FPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTA-FPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTGKS--GSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGE-PNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMGVGLVVEADLATTEHPSHWVLQGVCLILNT 13923
            +Q     + S+   VH+ +  V    E ++++     +  + I++ A E V+ E    DL+           +   IE  V+KW  QI   + ES      +G  P+P  E  FW  R   LS + +QL+  +++    IL     A  P F T    +     EAKD T +L+ ++R  + +   ++F      + P M  + ++W  SR+Y +  ++  L++ I   +  +  R +D ++IF+  ++  ++    + ++L+ + +   Y++ R +   +  + R    W F    +F++ N   +    +      + EF  +   E+  +     + RI +V  +  +         ++  +   H++D  +F + F+ +++ ++ +    +   F    + E  F ++     +  R  I +  TQ++ +I+   + E+   + ++   M        LY   +C  VA  I W   L   I  P+  F  +  E+ +++  + I  +Y  +   + + + + F++W   +D  + E L+K+++A                 D+  + L ++F   +  I+ E   ++ +  + +P++A + A + + +      L   +  Y+S+ +    +E++++  EIK +   +  G+ +L WNS  I  Y++K    +   ++++         I + +       LF+ +       CK+       ER    +   ++Y+ I      I KL  + +   D+   +    +  + +F +  +++ +   V  ++      +  EN    LFE  L L   +++  P            + I+ +RD ++   +  R K N       M  + QD         +I N V     E + FC Q   Y    +    +  + + ++ R+  P++   I   D             E  R+ ID  E L N+  I  IG       +  V+++     + +   +W +++   L  +  ++L ++ + I      L  ++   D E L ++++ +  ++  + + +     +QE  ++L   +  I +E      +L + + +    +  V  +++P++       + +I+ F   ++ F + FK         D     +++ + +D++   E   +++  +  LF + I  +  L   +KE++ L Q+++  +    + ++W  T W+ +D++ +D   + F K+ R + +E++   T  NL   +K    +L    +L++ A+RERHW +LM  T             F ++ +T TL+ +  + L+  ++ +  IV  A KE+S+EK +R++  TW  ++F  + + + G     +L A +E+++ L+DN + LQ++  S++I  FL  V  W+  L +  +V+ VW  VQR W +LE IF+   DIR QLP ++ +FD ID  F+ +M E +    +  +      +  L +L   L  C+K+L +YL++KR AFPRF+F+S  +LL +L +    E V +H+ K+FD+I+ L+F +  S E+ +A+ M + + E +EF     I G VE W+ +I+  MR + R    EAV  Y E K R QW+FDY   V+LC +QIWW+ EV   F ++++G   A+KDY K   +Q+  ++  +   LSK DR K+ T+  IDVH+RD+V   ++  +     F W+SQLR  +     +     C  +F Y +EY+G   RLVITPLTDR Y+TLTQ+L + +GGAPAGPAGTGKTETTKDL +A+G+   V NC E MDY+S G I+ GL Q GAWGCFDEFNRI V VLSV++ Q+K++Q+ +  K  +F+F G+ I     VGIFITMNPGYAGRTELPE++KA FRP  ++VPD + ICEIML ++GF  A+VLA+K  TLY L KE LSKQ+HYD+GLRA+KSVLV+AG L+R DP   E++VLMRALRD N+PK I +D P+F+GLI DLFP LD PR R  DF  +V++  ++   ++L  + +   K+VQL E ++ RH+  +VG  G GK+ V K L  +   ++       +NPK  +  EL+GI++P TR+W DGL S + R+    T  ++ ++++ DGD+D +W+E++N+VMDDNK+LTLA+ ERI L     LLFE+ +L+ A+PATVSR G++Y++P++LG+NP+   W+  ++   E   L  L+ KYIPP+++ +           + K I P+  +  +  LC++L+C L       D      E  F+ +  W+ G  + +D  + +  +F K          E K  K       FP   T+FDY+ DS  E + ++PW   +P++  + +     ++V T +++RL + L   +  + PV+LVG  G  KT +    L++   + Y    I F+  TTS  +Q+ LE  +EK+   +YGPP  K L  F+DD+NMP+VD YGT QP  +++  L+    YDR K L  K + +  ++A M  P  G   ++PR    F V   +FP   S+  +YSSIL+ H   F++  +   PI+T+M       T+ ++N+ +    PT  K HYIFNLRD+S ++QG+  ++ +  T S    R+W+HE  RV  D+L +D D           V+K+ EE + E+   DK      P ++  +   +   +   Y  +  +     L QE M  Y++ V+ M LVLF+DA+ H+ RI+R +    G ALLVGVGGSGKQSL +LAA+  S ++ +I L +GY   DL+     LY K G++N   +F+  D  +  E FL LIN+ML++G +P LFPDDE E II+ VRNE   AG+  ++E+ W++F+++    L IVLC SPVG TLR R R FP ++N T+I+WF  WP++AL +VA  F+  +N ++P++ R  + K    VH SV   SK ++Q  RR NY TPK+YL+ IN Y+KLL  K++  +S+ +RL+ GL+KL   ++Q+A+L  KLA+Q++ + EK  A + L++ +   T+    +K +A E+   V + + E+ K++ + E  L++A P L  A+ AL+ L K ++ E++SF  PP  V  V+  + V      K  K+ +WK AK  MA   +FL SL   D +NI  + +  ++  L   +   + +RS S A  GL  +V  ++ + +V  +++PKR+ +A         + +L  +K ++  LE +L  L   +E A  ++ R Q+E D  Q  +  A++L+ GL+SEN RW   +     Q + L GD L+ +AF+SYVG F+  FR +++   W      ++  IP ++      +LT+D  I+ W +EGLP D +SI+N  + + + R+PL IDPQ Q + WI QK    +LK        +L  +E +I  G   L +++DE +DPV+D++L +N+  KG    + + +GDKE++++ NFRL L+TKL+NP Y P +  ++ +IN+TVT  GLEDQLL+ +VK ER +LEE +  L ++ +D K +LK LED LL  L+++  N+L +T L+  LE TKS ASE+ +K+     TS+EIDK R+ YR AA R ++L+F+L E++TIN +YQ+SL A+  VF+ ++ K+ P   L  R+ N++  +T +V+ Y   G+FE  KL+F  Q+T ++ +    +T  ELDF ++      V     P  +L++ SW  +  L      +F  L  DIE     WK+ +  E PE    P+++ NK  + Q+LC++R  R DR+  A+  ++ E++G +YV    + F + +++++P +PI FILSPG +P  DV  L ++ GF      F  +S+GQGQEA A+  +D A   GHW++LQN HL+ KWL  LEK LE   +  HPD+R++L+ EP         P GIL+ S+K+  EPP G+  NL    +     +L      A F +++F+L +FHAVV ERRK+G  GWN  Y FN  D  + + +L  YL     + ++K+PW  L+YL GE+MYGG   DD+DRR+  TY++EY    L D      F A  F     P  D         E +P E +P ++GLH NAEIG+ T+ A+ ++  + ++QP+   +  G++ +R++ + +    I  KLP+ F++  +  K   + +P ++V  QE ER N L   M +SL  L   L GE+ ++++++ +  SL+  Q+P IW + A  +L  L NW      R  +   W  +   P+ +WL+G   P+S LTA++Q+T R+N  PLDK  L   VT+     E T     GC VHG+++EGA WD  Q  ++  + K+L  S+PVI +  I   +   +N +  PVY T  R     V      +L T + P  W+L GV L+L T
Sbjct:  149 AQDVQKHVHSLKSTVHQVKGQVSG--ETILAM----PVGVEKIVKAAKELVETEQCQFDLY-----------LKSAIEGVVIKWATQIHEVIKESPSNAFANGQNPTPHTEFTFWNNRLKNLSFIYDQLRNERIRAMALILEYSMSAYHPCFQTLFKNVVTALAEAKDITLYLNPLKRPLQHLE-EIDFAECKPLLIPFMNTVGILWGNSRYYCQSAKITVLLQEICNLIIHQAKRYLDPSSIFHSDIDEAMQRLTLSIQILKFFRELFDYYKERLATFFTEPEERPPILWTFHPNSVFKRFNAFLERLTTIQWFFFTVIEFLKLEKVEIGGLRGRQLSTRITDVYVEFNQYFTAFASKSYDVLDPDDHEFD-EDF-KGFQTRILELDMKLAAILCQAFDDCHNLESIFKLISIVGSVLDRPKIKEEFTQRYAEIVRMLDDEMTICESIYDKQMELKKVGDNLYPNYNCPPVAAFIRWCHQLETRITAPVKNFKALQHEITKTEKSQEIVERYEILMVKLGSCKTQFFDDWAGQLDGQIEENLKKSLIAR----------------DRRHNSLILNFSAALFSILREVHYMQQMKIEGIPQIAIDFAEKSDVFRSYTLNLEKTIDWYNSIQEGSSPVELRLIEPEIKMIDDLVEIGVNQLVWNSSDILSYLDKLRKPVAALQNRMDHTQGNLRQIRKIMGVWAKQPLFERRD------CKKDTVLSIDERP---DRTSKRYAEIQAASIEIHKLLQDNMLQFDMESKQDDAVWLSYVDFVDNIVYENILKTVGVSVGYLAENMDPENNYAPLFESRLELVEPNLVFVPSLDPEDPMGFNNMLIELMRDIMKMGSLIKRLKPNEKRNYVEMIKENQD---IIDMRREILNGVDLVMEEASRFCRQFERYSYLWLDDREECMEYFLEYGRMLDPDEIELILINDPNQPPPQPCQPTIEAFREQIDNYESLFNE--IEDIGPFQVFSSWFQVDVRPFRQALLNTVCKWGNMFKEHLVTTVTSSLMNLSHFIRKADEGLLQTVKEKDYEGLVSIMAYLMQVKERAAKTDEMFEPMQETIQLLKYYDMDIPEEVNVLLQELPEQWANTKKIASTVKQQVSPLQATEVVSIRNKIALFESHIQLFREVFKTYD--FFRFDCYKPYLLMDRINDDMFLCESEMRDIQESGSLFEVNIPEFKVLKQCRKELRMLKQLWDYVNIVATSIDDWKTTPWRKVDVENMDIECKKFAKDIRLLDKEMRPWDTFINLESTVKNMLTSLRAVGELQNPAIRERHWNQLMNSTKSLAALPKEVTVKFIMDHET-TLAELLGLNLHECEEEVKNIVDKAVKEMSMEKILRDLNTTWTVMEFDHELHPRTGCN---LLKASEELIETLEDNQVCLQNLITSKYIAHFLEEVSTWQNKLMIADQVITVWFEVQRTWTHLESIFMSSEDIRKQLPVDSDRFDNIDAEFRVLMDEMSVSSNVVASTNRSGLIERLEHLQKELTLCEKALAEYLETKRLAFPRFYFVSSADLLDVLSNGIQPEMVTKHLTKLFDSIARLKFNRDESNEINTASGMYAKDGEYVEFNELASIRGPVEVWLNRIQAAMRASLRHYVMEAVIAYEE-KQREQWLFDYPAQVSLCGSQIWWSTEVNIAFSRLEEGYDNAIKDYYKKQISQLSLLITLLLGELSKGDRQKIMTICTIDVHSRDVVAKMIQAKLDSGSAFMWQSQLRHRFDDVEKDCFANICDAEFQYCHEYLGNTPRLVITPLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDLGRAIGISVYVFNCSEQMDYQSCGNIYKGLAQTGAWGCFDEFNRITVEVLSVVAVQVKSVQDAIRDKKDKFNFMGEMISCVPTVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFQDARVLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDPGRPEEEVLMRALRDFNIPKIITDDMPVFMGLISDLFPALDVPRKRDQDFERTVKQAASD---LLLQPEDNFILKVVQLEELLEVRHSVFIVGNAGTGKTQVWKTLLRTYQNIKRKPIFNDLNPKAVTNDELFGIINPATREWKDGLFSVLMRDQANITG-DQPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTPSMRLLFEISNLRTATPATVSRAGILYINPQDLGWNPYVTSWVETRKIPAEKSNLVMLFDKYIPPSLETI---------RVRFKKITPVAEMAHIQMLCHLLNCFLIPANTPADCPKEWHELYFVFACIWAFGSAMFQDQAIDYRVEFSKWWV------NEFKTVK-------FPPGGTVFDYFLDS--ETKTFLPWTEKIPKFELDSDLPLQAVIVHTSESIRLRFFLDLLMDKKHPVMLVGNAGCGKTVLVNEKLQSLS-ENYAVTTIPFNYYTTSEMLQKILEKPLEKKAGRNYGPPGNKLLCYFVDDINMPEVDAYGTVQPHTLMRQHLDYGHWYDRNK-LTLKDIHNCQYVACMN-PTSGSFTINPRLQRHFCVLAVSFPGPESITVMYSSILAQH---FANAEQKFTPIVTRMTPNIVAATIALHNKCLQVFLPTAIKSHYIFNLRDISNVFQGLLFSSTECLTGSTDLIRLWQHETQRVYSDKLTDDKDIDSFTKMQHDIVKKSFEE-IDESVIFDK------PNIYCHFAGGIGDPK---YMPIKGWPELHKLLQEAMSSYNDLVAAMNLVLFEDAMMHVCRINRILESPRGSALLVGVGGSGKQSLARLAAFISSLEVVQIQLKKGYGVNDLKNEFSGLYLKAGLKNVGIMFLMTDAQIPSEDFLVLINDMLATGEIPDLFPDDEIENIIAGVRNEVKGAGLVDTRENCWKFFIDRVRKQLKIVLCFSPVGSTLRVRSRKFPAIINATSINWFHEWPQEALISVAMNFLA-QNKVLPENHRDSVAKFMAYVHTSVNTTSKVYLQNERRYNYTTPKSYLEQINLYIKLLNHKNEDLQSKIERLENGLEKLRSTALQVADLKVKLAVQEIELKEKNEAADALIEIVGIETEKVQTEKAVADEEEMKVALIADEVSKKQRDCEEDLLKAEPALMAAQDALNTLNKANLTELKSFGSPPGAVTNVTAAVMVLLSQGGKVPKDRSWKAAKIAMAKVDTFLDSLINYDKENIHPEITKAIQPYLKDPEFEPEFVRSKSGAAAGLCAWVINIIKFYEVYCDVEPKRKALAAANAELAAAQDKLAGIKRKVMSLEEQLGKLTADFEKATADKLRCQQEADATQATIALANRLVGGLASENVRWAEAVNNFVKQGITLPGDILLITAFISYVGCFTKGFRIDLLLKMWTPFLKSIDPPIPTTENLDPLSLLTDDTTIAIWTNEGLPSDRMSIENATILSNSDRWPLMIDPQLQGVKWIKQK-YGEDLKVIRLGQRSYLDIIEKSINAGCNVLIENIDENLDPVLDSLLGRNLIKKG----KAIKIGDKEIEYNSNFRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKAERPDLEELKADLTKQQNDFKIMLKKLEDDLLSRLSSAGENILGDTALVENLETTKSTASEIEQKVAEAKITSKEIDKAREYYRPAAARASLLYFILNELNTINPIYQFSLKAFSVVFQKAIAKAEPGDTLDLRVSNLIDCITYSVFQYTSRGLFECDKLIFASQMTFQILLMNEEVTSAELDFLLRFPIKPHVT---SPVDFLTNQSWGGICSLAS--KDEFRNLDRDIETSSKRWKKLVESELPEKEKFPQEWKNK-TALQRLCMIRALRPDRMTYALADFIEEKLGSKYVESRAMEFAKSYEEASPSTPIFFILSPGVNPLKDVEALGKQMGFSMDLGNFHNVSLGQGQEAIAEAAMDTAAKHGHWVVLQNIHLVRKWLPVLEKKLEYYAEDSHPDYRMFLSAEPASTPSAHIIPQGILESSIKITNEPPTGMLANLHKALDNFTQETLEMSGKEAEFKAILFSLCYFHAVVAERRKFGPQGWNKIYPFNVGDLNISVSVLYNYL-----EANAKVPWEDLRYLFGEIMYGGHITDDWDRRLCITYLEEYMQPDLVDGEL---FLAPSFPA--PPNTDYQGYHTYVDEMMPAE-SPYLYGLHPNAEIGFLTTRAENIFRTVFEMQPRDAGAGGGATVTREDKVKQIVDEIIEKLPEEFNMVEIMNKVE-ERTPYVIVAFQECERMNFLTSEMKRSLKELDLGLKGELTITSDMEVLENSLFLDQVPPIWTQRAYPSLLGLNNWFIDLCLRLRELETWSTDFVLPSCVWLAGFFNPQSLLTAIMQSTARRNDLPLDKMCLQCDVTK-KQKEEFTTAPRDGCCVHGIFMEGARWDIQQGIIMESRLKELYPSMPVINIRAITQDKQDLRNMYECPVYKTRTRGPTTYVS---NLNLKTKDKPGKWILAGVALLLQT 4496          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Zebrafish
Match: si:dkeyp-86b9.1 (si:dkeyp-86b9.1 [Source:ZFIN;Acc:ZDB-GENE-060531-163])

HSP 1 Score: 5313.43 bits (13782), Expect = 0.000e+0
Identity = 2661/4458 (59.69%), Postives = 3382/4458 (75.86%), Query Frame = 1
Query:  586 FFLVRTTDDMVVLPSNINEANSELPSYFESGTLKGDMLLLLSQLIHSVYDYMLSYHQHRVTSDLGMSRASTPASQGRIPKKSQSDGDKIESIDEKVHETRAAVQARDEFLISLKKFTSIVDQTIIQIASEVKLEIPDLDLFENDKENLSDKEIMEMIESTVLKWDQQITGTLESLQKIVPHGPSPLAEIDFWRERNAXXXXXXXXXXXPKVKRILNLYSLAEGPV---FDTQNNELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIAWNLSDRVARLIDVNTIFNLPLEHVLKDTAEAEKMLRVWNDTYFEVRASIEASGRDARWEFDRKRLFEKTNYMADICHDLNEIAMILQEFYNIFGPELKSVTNEAKRIXXXXXXXXXXXXPLKEMPFNPFNLMKHKYDWSNFMEDFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEVESIDQLFKTNMNNPPLYHFKSCVAGGISWERHLFYNIKRPILRFLTMDEMMQSDNGKRIRTKYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILALANSENFVSEN-----VPEETIDKMDDDLRVDFGFEINEIITETRNLELLGYKVPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISDYIEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFKLQSGNK---FLKCKEFFEFMESERTSDFEHLGRKYSTIGPLITKLQGEIIGDRDVNPFEKFQPFYEFWEKRIFDRVYNMVLKNLQDYQNMLRDENFPTCLFEVDLMLAGTDVIGNPQTTEIYKLAIQDLRDAVEATRVFIRWKRNSCIETTGMKIDGQDELFYFTFYLDIGNSVEITYFCEQIANYYRNIIGKLRKYQDKWKKHKRVFIPNKQAQIDKWLTKDPTVMDFYERIRDTIDRKEELLNQPVIRKIGFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDLSLIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSNHPIDQEEIEESDKLRQLFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTREGMNQDTIEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSENAKSDKDYAMTDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKRKKPYLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLTKPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTGKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGEPNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMGVGLVVEADLATTEHPSHWVLQGVCLILNTD 13926
             + +R T + +  P +INEAN  +P   E G +    L +LS L++ VY   LS +Q R+T+  G  +    +    I K ++  G+K + +     E+R + + RD+ L S  KF  ++DQT+ Q+  E KL +P++DL    +  LS+  +++ +E  V+ W  QIT  +E  ++  P GP PLAEI+FWRER A+ S+L+EQL L  VK+IL + + A+  +    +    EL K++ E+  N +FL+ VERHF+++  GV+F  V ++IP ++  LRMIWI+SR YN DERM  LMERIAW LS+RVAR++DV+ +F            + +++L +W   YFEVRA IE S RD RWEF+R++LFEKT+YMA IC DL  +   L EFY IFGPELK+VT + KRI++VL  V  LV+P++E+ F+PF+  K    W   M++F  +V  IE +AI FI++ F TLRS+  AFD+LL+F++IR R AIN  + +KF+DI++QY KE+  I+ +F    +NPPL      +AG I W+R L   ++ P+ RF    ++M +  GK + +K++ V   MR +E   +N+W+   ++ L  L+RK++L + NS   V  +        E + + D    V+F  E+ EII+E + L+ +G  +P+  +NVALQ+E + + + GL  +V  YH ++ +L   E  ++ D+++E+++ +  G +R+NWN+LGI  +I++ N A   FES    I K   DI++KLK I++A LFK    ++       +EF EF+ESER      L   Y+ I PL+TK++  I+G       +    FY +WE++IFD +  MV +N+Q +   L      T LF++D +LA  ++   P+++E+YKL  Q + D VE T+ F+RW   SCI+     +DG+DE F FTFY DI    +I      ++   + ++  +  Y   W  ++ ++  +K   ++K+  K P+ + + E+ +  +    E+  QP+++    I +NL+ L   V+++ + W       L++SA+  L +++N++     +L   P  LE+LK +L TI  I+ +SL  E RI D QERYR L++      +EE++ S  +  L++ L  ES+ V+  L  VK  F +IT  +I ++ ++L  FA+ F   GPG++G DL+ GL ++  +  EL  +E RRQEL  AE+LFNLPIT YPEL NVQKEM+ L QIYE++ +QK+A+  W++TLW NLDI++L EGI+GF+K  RK+P++ +A+  +  L  ++KEF+++LPL  DLK++ALRERHWK LM +TG NF++NP+TFTL ++FAMEL+++ +VI+EIVTSA KEL IEKGV+EVEETW ++KF+V  Y KG +E G+ILGA+D++LQ LDD+AMNLQSM+ S F+GPFL +VQ WEKNLSLISE ++VWM+VQ+KWMYLE IFIGGDIRSQLPEEAKKFD IDKTFKKIMT+T K P IK+ C VPNRL+DL NLSDGLE+CQKSLNDYLDSKRNAFPRFFFISDDELLSILGSS+  CVQEHMIKM+DNI++LRF  G + EM A A++S+E E+ME + PV  EGRVEDWMT + +EMRRTNR+ITKEA++FY   K RV WM DYQGMV L TNQ+WWT+EVEDVFR++ +G+K ALK YAK +H QI+++V  +  PL KNDR K+ TVLIIDVHARDIVDSFVRDSI DA+EFEWESQLRFYW++E DE+ ++QC+ QF YGYEYMGLNGRLVITPLTDRIYLTLTQALSM+LGGAPAGPAGTGKTE+TKDLAKALGLLCVVTNCGEGMDY +VGKI +GL QCGAWGCFDEFNRI+ SVLSVIS+Q++TI+N L++ L RFHFEGQEI LD+R+GIFITMNPGYAGRTELPESVKA FRPVVVIVPDLQQICEIMLFS+GFL AKVLAKKMT LY+L++EQLSKQ+HYDFGLRALKSVLVMAGEL+R  P+LSED VLMRALRDMNLPKF+FED PLFLGLI DLFPGLDCPRVRYP FND+VE  L E++YI++  Q DK+VQ+YETM TRHTTMVVGPTGGGKSVVI  LC SQT+L L TKL  +NPK  SVIELYGILDP TRDWTDG+LSNIFR+INKPTDK ERRY+LFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQ+HCALLFEVGDLQYASPATVSRCGMV+VDPKNL Y P+W+ W+N +  K E   L  L++KY+P  ID +++G+++G+  EKLKT+I  T+LN+V QL  M+D  L  E    + +E  F++++Y SLG  L++  + KFD FIK L ++   ++E   A  GE+P   PTL+D++FD  ++K  W+PW+++V +Y+HNPE KF +ILVPT+DT R  WLL + +K++RPV+LVGE+GTSKTA  Q FL N + D  I + INFSSRTTS+D+QR LE+NVEKRTKD++GPPMGKRLLVF+DD+NMP+VD+YGTQQPIA+LKL+L+R G YDRGK+LN+K ++D+GF+AAMGK GGGRN+VDPRFISLFSVFN  FP + SL  IYSSIL GH + F + I+N    +T  T+ +Y  II  LPPTPSKFHYIFNLRDLSR+Y G+  T  +RF    QF RVWR+E  RV  DRLIN+ DK  VQ  ++  + E+ KSD D AM DPILFGDYR AL+ +E R+YED+++Y+A+K LFQEI+EEY+E  + M LVLFDDAL+HLT IHR IRMD GHALLVGVGGSGKQSLTKLAA+T   ++FEI LSRGYSE + R++LKTLY KLGIENK  VF+F D HV EEGFLELINNML+SG+VPALF DDE+E++++Q+R+EA  +G GPSKESIWQYFVNK A+NLHIVL MSPVG+TLRTRCRNFPG+VNNT+IDWF PWP QALYAVA  F+G E+ +IP      ++ H  MVH SV +YSK F+Q  RR NYVTPKNYLDFINTY  LLEDKDK+  +Q  RL+GGL KL EAS QLAELN KL  QKV + EKT ACE LL+EI + T +A EKK +A+EK++ +E Q+K I  EK +AE++L EALP LE AR+AL DL+K+DV EIRSF KPPK VQ V ECI V + YKEINWK AKGMM++ +FL+SL  MD D+I   Q   V+  L  L  +++EM+ +SKAG G+L+FV AV+GY +VAR+IKPKREKVARLE+ F Q+KRELE+++NE+  ++ EL+ L  +YE A+ E+Q LQEE ++M+RRL AADKLI+GL+SENKRW+ DL+ LK ++VRLLGDCL+C+AFLSY GAFSW+FR EMVY  W+ DV+ER IP+S PFR+E++LT++VEIS+W SEGLPPDELS+QNGILTTR+SRFPLCIDPQQQALNW+ +KEE NNLK ++FNDPDFLK LELAIKYG PFLF+DVDEYIDPVIDNVLEKNIKG +GR+ V+LGDKEVD+DPNF+LYLNTKL+NPK+ P +FGK+MVINYTVTLKGLEDQLLSVIV FERKELEEQRERLI ETS+NKRLLKDLEDSLLRELATSTGNMLDN ELI TL+ETKSKA+EV EKLKL  +T+ +ID  RDGYR AAKRGA+LFFVLAEM+ ++SMYQYSL+++L+VF  SL KSLP+  L  RL+N++ TLT+NVY YGCTG+FE+HKLLF+F +T+K+E  +G   QDEL+FF KGN S+E +KRKK   WL D  W+D+ +L E+ P +F  L +DIE++   WK W + + PE A+ P  Y   L  FQKL L+RCFR+DR+YRA++ YV   MGE+YV PP+++FE I DQS+P SPIVFILSPGS+PASD++KLA+ SGFG  +LKF++MGQGQE  A  LLD A+ARG WL+LQNCHLLVKWLR+LEK LER+TKPHPDFRLWLTTEP + FPIGILQ+SLKVVTEPPNGLKLN+R+TY KI+   L N  H AF SLV+ LAFFHAVVQERRKYGKIGWN+PYDFNESDF VC++IL TYL KA +QGD  IPWGSLKYLIGEVMYGGR ID FDRRIL  Y DEY GDF+FDTFQPFHF+ +    Y IP        +  IESLPL NT EVFGLH NAEIGYYT AA++MW+ LI++QPQTG SG   SRDE I++ A  I+SKLP++FDLD +RKK GL+ISPT VVLLQELERFN L  RM++SL  L RAL GEVGMS+ELD+VA++L+NGQIP IW++LAPDTLKSL NW+ HF  R+ QYS WV  GEP VMWLSGLHIPESYLTALVQATCRKNGWPLD STLYT VTQ+++  +V ER  QGCFV GLYLEGA WD    CLVR KP+ L+  LP++K+IPIEA RLK QNT  TPVY TS RRNAMGVGLV EADL TT+H SHWVL+GVCL LN+D
Sbjct:  188 LYFLRNTKETITEPVDINEANHLMPRLIEFGMMNDHPLKMLSGLLNHVYIPRLSANQQRLTN--GGYQGVAGSEDNDISKTTE--GEKQQPV-----ESRGSFEVRDDLLHSTHKFLQVIDQTLRQLEGEFKLHMPEIDLEGEVELFLSNSVMVDKLEQCVMNWHTQITIVIEEQKRKKPQGPGPLAEIEFWRERVAVFSSLIEQLNLQAVKKILEVMTRADSFIMQELEKTTAELRKYYDESVSNVQFLTTVERHFRNLVTGVDFKVVLETIPELINGLRMIWILSRCYNTDERMEALMERIAWELSERVARVVDVHVLFKEKRVVAKAKVQDGKRVLDIWKACYFEVRARIENSERDPRWEFNRRKLFEKTDYMASICQDLYSVLQTLDEFYIIFGPELKAVTGDPKRIDDVLHCVNSLVKPIEEVTFDPFDNRKMT-SWKMVMQEFNNEVQVIEREAITFIDHSFKTLRSSSAAFDLLLKFKNIRCRDAINDQLMKKFSDILAQYCKEMVLINDIFVKFKDNPPLSKNHPPMAGAIIWQRFLLDQMRYPMKRFREDRDLMNNQEGKAVESKFIEVASRMRQYEVDLYNKWKADTNQTLPILMRKSLLVMVNSYGTVCADSTRHRTGSEKVLERDVRFSVNFPPELQEIISEAKCLDRIGIVLPDELQNVALQEEVFLRYINGLKKLVRRYHLLMDNLNDAEFLLMADQVQELRQVLSVGCKRINWNNLGIPQFIQRGNQAASKFESLENQIQKNERDIDDKLKSIESANLFKFPLADQTGYLPGIREFCEFIESERAKTVNLLVNMYAAISPLLTKMESLIMGT-STGKAKGMAQFYAYWERKIFDSLTKMVFQNIQAFNTALMGN---TPLFQIDTILAAPEIALLPKSSEVYKLIRQCVGDCVETTKRFVRWMHGSCIQCPPQHVDGEDESFLFTFYSDICQLPQINEQATAVSQTIQRLLNGISVYLKSWMSYRSLWKLDKAIVMEKFAAKKPSCVMYDEKFQFYVKVSNEVAKQPMVKHEHIIRLNLEPLARAVQENIQVWVTSLGKLLNDSAREELFNLRNELLILSENLKRSPNTLEDLKFVLVTITDIRDMSLSVEMRINDAQERYRTLSMYIVETTEEEMQLSANISILWNDLFMESRQVDRSLVKVKKTFAEITLNQIEEYKQELFIFAESFNMHGPGAVGDDLEKGLQIMSTYETELVRVEARRQELAKAEKLFNLPITMYPELLNVQKEMRGLRQIYEIFKSQKEAKTEWSQTLWVNLDIQLLQEGIDGFIKSLRKLPKDARALPVSFFLEGRMKEFRESLPLLLDLKNKALRERHWKSLMERTGTNFEMNPNTFTLENMFAMELHKYGNVISEIVTSAVKELGIEKGVKEVEETWDSMKFTVHRYFKGTQEHGFILGAVDDILQHLDDDAMNLQSMAGSHFVGPFLATVQQWEKNLSLISETIEVWMLVQQKWMYLESIFIGGDIRSQLPEEAKKFDNIDKTFKKIMTDTVKDPGIKRCCLVPNRLADLQNLSDGLERCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSEPTCVQEHMIKMYDNIAALRFDTGMNGEMVANALVSAEGEVMELKQPVPAEGRVEDWMTAVLLEMRRTNRLITKEAIYFYSHQKSRVDWMLDYQGMVVLATNQVWWTYEVEDVFRRMNEGEKQALKQYAKKMHQQINDLVKRITEPLKKNDRRKINTVLIIDVHARDIVDSFVRDSITDAREFEWESQLRFYWVKEPDELFVRQCSAQFCYGYEYMGLNGRLVITPLTDRIYLTLTQALSMFLGGAPAGPAGTGKTESTKDLAKALGLLCVVTNCGEGMDYMAVGKILSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALMLHLQRFHFEGQEISLDNRIGIFITMNPGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLVAKVLAKKMTVLYKLAREQLSKQSHYDFGLRALKSVLVMAGELKRGSPNLSEDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRVRYPSFNDAVEAILEENRYIMMPSQVDKVVQMYETMMTRHTTMVVGPTGGGKSVVINTLCQSQTRLGLLTKLYSLNPKAMSVIELYGILDPVTRDWTDGILSNIFRDINKPTDKKERRYILFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQSHCALLFEVGDLQYASPATVSRCGMVFVDPKNLRYAPYWEKWVNSRAPK-EKADLCKLFEKYVPSAIDMIVDGVVDGKQTEKLKTVILQTDLNMVMQLTVMVDSLLENEDFLFEELECCFLEALYCSLGASLLDKGRQKFDAFIKKLSSLNSVHDEKVLAGPGEIPVYLPTLYDFHFDGTQKK--WVPWSSMVSKYIHNPEMKFIDILVPTVDTTRANWLLEQMVKVKRPVVLVGESGTSKTATIQNFLSNLNTDTTIMMTINFSSRTTSMDLQRTLEANVEKRTKDTFGPPMGKRLLVFMDDLNMPRVDEYGTQQPIALLKLLLDRGGMYDRGKELNYKLIKDLGFIAAMGKAGGGRNEVDPRFISLFSVFNIPFPEEESLHLIYSSILRGHTKPFEECIRNICDKLTFCTLELYKTIIKDLPPTPSKFHYIFNLRDLSRVYHGLTLTNPERFCTVTQFVRVWRNECLRVFHDRLINETDKIMVQGHVKNLVEEHFKSDLDSAMRDPILFGDYRTALK-SEPRVYEDILDYDASKALFQEILEEYNENKTKMNLVLFDDALEHLTVIHRIIRMDRGHALLVGVGGSGKQSLTKLAAFTAGYEVFEIVLSRGYSETNFRDDLKTLYLKLGIENKKMVFLFTDAHVAEEGFLELINNMLTSGMVPALFADDEKESVLNQLRDEAMKSGCGPSKESIWQYFVNKSANNLHIVLAMSPVGDTLRTRCRNFPGLVNNTSIDWFSPWPLQALYAVAKSFLG-ESPMIPKSHSEAVIDHVCMVHSSVGDYSKLFLQTLRRSNYVTPKNYLDFINTYSNLLEDKDKYILAQYKRLEGGLDKLKEASGQLAELNVKLDEQKVVLAEKTSACEILLEEICANTAVAEEKKTLAEEKAKEIEEQNKVIVVEKKDAESSLAEALPALEAARIALQDLDKSDVTEIRSFTKPPKQVQTVCECILVIRGYKEINWKTAKGMMSEGNFLRSLMEMDCDSINANQVKHVKAYLRNLNTSLEEMQGISKAGSGMLRFVEAVMGYCEVARDIKPKREKVARLERNFHQSKRELERIQNELGAIQKELRALGDKYEGAMTEKQLLQEEAEVMERRLVAADKLISGLASENKRWIKDLEELKQRRVRLLGDCLICAAFLSYEGAFSWDFRNEMVYKVWQADVLERGIPLSQPFRIENLLTDEVEISRWGSEGLPPDELSVQNGILTTRSSRFPLCIDPQQQALNWVKKKEEKNNLKISSFNDPDFLKGLELAIKYGFPFLFQDVDEYIDPVIDNVLEKNIKGAEGRQVVVLGDKEVDYDPNFKLYLNTKLANPKFLPAVFGKAMVINYTVTLKGLEDQLLSVIVGFERKELEEQRERLILETSENKRLLKDLEDSLLRELATSTGNMLDNVELIQTLDETKSKANEVFEKLKLAEKTAVDIDTLRDGYRPAAKRGAVLFFVLAEMALVSSMYQYSLASFLEVFDLSLSKSLPNPILPSRLKNIIDTLTQNVYNYGCTGLFERHKLLFSFNMTIKIEQAEGRAPQDELEFFFKGNLSLEKSKRKKLLDWLPDQGWEDIIRLMELFPNEFGTLADDIEKNPEEWKNWYDLDAPEQASFPMKYKENLSPFQKLLLIRCFRLDRVYRAVSDYVTLTMGEKYVQPPVISFEAIFDQSSPNSPIVFILSPGSEPASDLMKLAKHSGFGVNRLKFLAMGQGQEKVAFQLLDTAVARGQWLMLQNCHLLVKWLRDLEKTLERITKPHPDFRLWLTTEPIKDFPIGILQKSLKVVTEPPNGLKLNMRATYFKISHDKLMNCAHPAFRSLVYVLAFFHAVVQERRKYGKIGWNVPYDFNESDFLVCMEILDTYLTKAQNQGDEIIPWGSLKYLIGEVMYGGRVIDSFDRRILTVYTDEYLGDFIFDTFQPFHFFHNADVDYKIPALGPKQVYVDEIESLPLANTAEVFGLHPNAEIGYYTQAARDMWTHLIELQPQTGDSGGGISRDEYISQVARDIQSKLPEVFDLDVIRKKLGLEISPTSVVLLQELERFNKLTVRMSRSLAELQRALAGEVGMSSELDEVARALFNGQIPVIWRKLAPDTLKSLGNWMIHFKRRHEQYSSWVNEGEPYVMWLSGLHIPESYLTALVQATCRKNGWPLDHSTLYTQVTQYSSEDQVKERPGQGCFVSGLYLEGADWDIDNGCLVRSKPRVLVSQLPILKIIPIEARRLKLQNTLRTPVYTTSMRRNAMGVGLVFEADLYTTKHISHWVLEGVCLCLNSD 4626          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Zebrafish
Match: DNAH10 (si:dkeyp-86b9.1 [Source:ZFIN;Acc:ZDB-GENE-060531-163])

HSP 1 Score: 5313.43 bits (13782), Expect = 0.000e+0
Identity = 2661/4458 (59.69%), Postives = 3382/4458 (75.86%), Query Frame = 1
Query:  586 FFLVRTTDDMVVLPSNINEANSELPSYFESGTLKGDMLLLLSQLIHSVYDYMLSYHQHRVTSDLGMSRASTPASQGRIPKKSQSDGDKIESIDEKVHETRAAVQARDEFLISLKKFTSIVDQTIIQIASEVKLEIPDLDLFENDKENLSDKEIMEMIESTVLKWDQQITGTLESLQKIVPHGPSPLAEIDFWRERNAXXXXXXXXXXXPKVKRILNLYSLAEGPV---FDTQNNELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIAWNLSDRVARLIDVNTIFNLPLEHVLKDTAEAEKMLRVWNDTYFEVRASIEASGRDARWEFDRKRLFEKTNYMADICHDLNEIAMILQEFYNIFGPELKSVTNEAKRIXXXXXXXXXXXXPLKEMPFNPFNLMKHKYDWSNFMEDFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEVESIDQLFKTNMNNPPLYHFKSCVAGGISWERHLFYNIKRPILRFLTMDEMMQSDNGKRIRTKYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILALANSENFVSEN-----VPEETIDKMDDDLRVDFGFEINEIITETRNLELLGYKVPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISDYIEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFKLQSGNK---FLKCKEFFEFMESERTSDFEHLGRKYSTIGPLITKLQGEIIGDRDVNPFEKFQPFYEFWEKRIFDRVYNMVLKNLQDYQNMLRDENFPTCLFEVDLMLAGTDVIGNPQTTEIYKLAIQDLRDAVEATRVFIRWKRNSCIETTGMKIDGQDELFYFTFYLDIGNSVEITYFCEQIANYYRNIIGKLRKYQDKWKKHKRVFIPNKQAQIDKWLTKDPTVMDFYERIRDTIDRKEELLNQPVIRKIGFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDLSLIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSNHPIDQEEIEESDKLRQLFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTREGMNQDTIEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSENAKSDKDYAMTDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKRKKPYLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLTKPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTGKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGEPNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMGVGLVVEADLATTEHPSHWVLQGVCLILNTD 13926
             + +R T + +  P +INEAN  +P   E G +    L +LS L++ VY   LS +Q R+T+  G  +    +    I K ++  G+K + +     E+R + + RD+ L S  KF  ++DQT+ Q+  E KL +P++DL    +  LS+  +++ +E  V+ W  QIT  +E  ++  P GP PLAEI+FWRER A+ S+L+EQL L  VK+IL + + A+  +    +    EL K++ E+  N +FL+ VERHF+++  GV+F  V ++IP ++  LRMIWI+SR YN DERM  LMERIAW LS+RVAR++DV+ +F            + +++L +W   YFEVRA IE S RD RWEF+R++LFEKT+YMA IC DL  +   L EFY IFGPELK+VT + KRI++VL  V  LV+P++E+ F+PF+  K    W   M++F  +V  IE +AI FI++ F TLRS+  AFD+LL+F++IR R AIN  + +KF+DI++QY KE+  I+ +F    +NPPL      +AG I W+R L   ++ P+ RF    ++M +  GK + +K++ V   MR +E   +N+W+   ++ L  L+RK++L + NS   V  +        E + + D    V+F  E+ EII+E + L+ +G  +P+  +NVALQ+E + + + GL  +V  YH ++ +L   E  ++ D+++E+++ +  G +R+NWN+LGI  +I++ N A   FES    I K   DI++KLK I++A LFK    ++       +EF EF+ESER      L   Y+ I PL+TK++  I+G       +    FY +WE++IFD +  MV +N+Q +   L      T LF++D +LA  ++   P+++E+YKL  Q + D VE T+ F+RW   SCI+     +DG+DE F FTFY DI    +I      ++   + ++  +  Y   W  ++ ++  +K   ++K+  K P+ + + E+ +  +    E+  QP+++    I +NL+ L   V+++ + W       L++SA+  L +++N++     +L   P  LE+LK +L TI  I+ +SL  E RI D QERYR L++      +EE++ S  +  L++ L  ES+ V+  L  VK  F +IT  +I ++ ++L  FA+ F   GPG++G DL+ GL ++  +  EL  +E RRQEL  AE+LFNLPIT YPEL NVQKEM+ L QIYE++ +QK+A+  W++TLW NLDI++L EGI+GF+K  RK+P++ +A+  +  L  ++KEF+++LPL  DLK++ALRERHWK LM +TG NF++NP+TFTL ++FAMEL+++ +VI+EIVTSA KEL IEKGV+EVEETW ++KF+V  Y KG +E G+ILGA+D++LQ LDD+AMNLQSM+ S F+GPFL +VQ WEKNLSLISE ++VWM+VQ+KWMYLE IFIGGDIRSQLPEEAKKFD IDKTFKKIMT+T K P IK+ C VPNRL+DL NLSDGLE+CQKSLNDYLDSKRNAFPRFFFISDDELLSILGSS+  CVQEHMIKM+DNI++LRF  G + EM A A++S+E E+ME + PV  EGRVEDWMT + +EMRRTNR+ITKEA++FY   K RV WM DYQGMV L TNQ+WWT+EVEDVFR++ +G+K ALK YAK +H QI+++V  +  PL KNDR K+ TVLIIDVHARDIVDSFVRDSI DA+EFEWESQLRFYW++E DE+ ++QC+ QF YGYEYMGLNGRLVITPLTDRIYLTLTQALSM+LGGAPAGPAGTGKTE+TKDLAKALGLLCVVTNCGEGMDY +VGKI +GL QCGAWGCFDEFNRI+ SVLSVIS+Q++TI+N L++ L RFHFEGQEI LD+R+GIFITMNPGYAGRTELPESVKA FRPVVVIVPDLQQICEIMLFS+GFL AKVLAKKMT LY+L++EQLSKQ+HYDFGLRALKSVLVMAGEL+R  P+LSED VLMRALRDMNLPKF+FED PLFLGLI DLFPGLDCPRVRYP FND+VE  L E++YI++  Q DK+VQ+YETM TRHTTMVVGPTGGGKSVVI  LC SQT+L L TKL  +NPK  SVIELYGILDP TRDWTDG+LSNIFR+INKPTDK ERRY+LFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQ+HCALLFEVGDLQYASPATVSRCGMV+VDPKNL Y P+W+ W+N +  K E   L  L++KY+P  ID +++G+++G+  EKLKT+I  T+LN+V QL  M+D  L  E    + +E  F++++Y SLG  L++  + KFD FIK L ++   ++E   A  GE+P   PTL+D++FD  ++K  W+PW+++V +Y+HNPE KF +ILVPT+DT R  WLL + +K++RPV+LVGE+GTSKTA  Q FL N + D  I + INFSSRTTS+D+QR LE+NVEKRTKD++GPPMGKRLLVF+DD+NMP+VD+YGTQQPIA+LKL+L+R G YDRGK+LN+K ++D+GF+AAMGK GGGRN+VDPRFISLFSVFN  FP + SL  IYSSIL GH + F + I+N    +T  T+ +Y  II  LPPTPSKFHYIFNLRDLSR+Y G+  T  +RF    QF RVWR+E  RV  DRLIN+ DK  VQ  ++  + E+ KSD D AM DPILFGDYR AL+ +E R+YED+++Y+A+K LFQEI+EEY+E  + M LVLFDDAL+HLT IHR IRMD GHALLVGVGGSGKQSLTKLAA+T   ++FEI LSRGYSE + R++LKTLY KLGIENK  VF+F D HV EEGFLELINNML+SG+VPALF DDE+E++++Q+R+EA  +G GPSKESIWQYFVNK A+NLHIVL MSPVG+TLRTRCRNFPG+VNNT+IDWF PWP QALYAVA  F+G E+ +IP      ++ H  MVH SV +YSK F+Q  RR NYVTPKNYLDFINTY  LLEDKDK+  +Q  RL+GGL KL EAS QLAELN KL  QKV + EKT ACE LL+EI + T +A EKK +A+EK++ +E Q+K I  EK +AE++L EALP LE AR+AL DL+K+DV EIRSF KPPK VQ V ECI V + YKEINWK AKGMM++ +FL+SL  MD D+I   Q   V+  L  L  +++EM+ +SKAG G+L+FV AV+GY +VAR+IKPKREKVARLE+ F Q+KRELE+++NE+  ++ EL+ L  +YE A+ E+Q LQEE ++M+RRL AADKLI+GL+SENKRW+ DL+ LK ++VRLLGDCL+C+AFLSY GAFSW+FR EMVY  W+ DV+ER IP+S PFR+E++LT++VEIS+W SEGLPPDELS+QNGILTTR+SRFPLCIDPQQQALNW+ +KEE NNLK ++FNDPDFLK LELAIKYG PFLF+DVDEYIDPVIDNVLEKNIKG +GR+ V+LGDKEVD+DPNF+LYLNTKL+NPK+ P +FGK+MVINYTVTLKGLEDQLLSVIV FERKELEEQRERLI ETS+NKRLLKDLEDSLLRELATSTGNMLDN ELI TL+ETKSKA+EV EKLKL  +T+ +ID  RDGYR AAKRGA+LFFVLAEM+ ++SMYQYSL+++L+VF  SL KSLP+  L  RL+N++ TLT+NVY YGCTG+FE+HKLLF+F +T+K+E  +G   QDEL+FF KGN S+E +KRKK   WL D  W+D+ +L E+ P +F  L +DIE++   WK W + + PE A+ P  Y   L  FQKL L+RCFR+DR+YRA++ YV   MGE+YV PP+++FE I DQS+P SPIVFILSPGS+PASD++KLA+ SGFG  +LKF++MGQGQE  A  LLD A+ARG WL+LQNCHLLVKWLR+LEK LER+TKPHPDFRLWLTTEP + FPIGILQ+SLKVVTEPPNGLKLN+R+TY KI+   L N  H AF SLV+ LAFFHAVVQERRKYGKIGWN+PYDFNESDF VC++IL TYL KA +QGD  IPWGSLKYLIGEVMYGGR ID FDRRIL  Y DEY GDF+FDTFQPFHF+ +    Y IP        +  IESLPL NT EVFGLH NAEIGYYT AA++MW+ LI++QPQTG SG   SRDE I++ A  I+SKLP++FDLD +RKK GL+ISPT VVLLQELERFN L  RM++SL  L RAL GEVGMS+ELD+VA++L+NGQIP IW++LAPDTLKSL NW+ HF  R+ QYS WV  GEP VMWLSGLHIPESYLTALVQATCRKNGWPLD STLYT VTQ+++  +V ER  QGCFV GLYLEGA WD    CLVR KP+ L+  LP++K+IPIEA RLK QNT  TPVY TS RRNAMGVGLV EADL TT+H SHWVL+GVCL LN+D
Sbjct:  188 LYFLRNTKETITEPVDINEANHLMPRLIEFGMMNDHPLKMLSGLLNHVYIPRLSANQQRLTN--GGYQGVAGSEDNDISKTTE--GEKQQPV-----ESRGSFEVRDDLLHSTHKFLQVIDQTLRQLEGEFKLHMPEIDLEGEVELFLSNSVMVDKLEQCVMNWHTQITIVIEEQKRKKPQGPGPLAEIEFWRERVAVFSSLIEQLNLQAVKKILEVMTRADSFIMQELEKTTAELRKYYDESVSNVQFLTTVERHFRNLVTGVDFKVVLETIPELINGLRMIWILSRCYNTDERMEALMERIAWELSERVARVVDVHVLFKEKRVVAKAKVQDGKRVLDIWKACYFEVRARIENSERDPRWEFNRRKLFEKTDYMASICQDLYSVLQTLDEFYIIFGPELKAVTGDPKRIDDVLHCVNSLVKPIEEVTFDPFDNRKMT-SWKMVMQEFNNEVQVIEREAITFIDHSFKTLRSSSAAFDLLLKFKNIRCRDAINDQLMKKFSDILAQYCKEMVLINDIFVKFKDNPPLSKNHPPMAGAIIWQRFLLDQMRYPMKRFREDRDLMNNQEGKAVESKFIEVASRMRQYEVDLYNKWKADTNQTLPILMRKSLLVMVNSYGTVCADSTRHRTGSEKVLERDVRFSVNFPPELQEIISEAKCLDRIGIVLPDELQNVALQEEVFLRYINGLKKLVRRYHLLMDNLNDAEFLLMADQVQELRQVLSVGCKRINWNNLGIPQFIQRGNQAASKFESLENQIQKNERDIDDKLKSIESANLFKFPLADQTGYLPGIREFCEFIESERAKTVNLLVNMYAAISPLLTKMESLIMGT-STGKAKGMAQFYAYWERKIFDSLTKMVFQNIQAFNTALMGN---TPLFQIDTILAAPEIALLPKSSEVYKLIRQCVGDCVETTKRFVRWMHGSCIQCPPQHVDGEDESFLFTFYSDICQLPQINEQATAVSQTIQRLLNGISVYLKSWMSYRSLWKLDKAIVMEKFAAKKPSCVMYDEKFQFYVKVSNEVAKQPMVKHEHIIRLNLEPLARAVQENIQVWVTSLGKLLNDSAREELFNLRNELLILSENLKRSPNTLEDLKFVLVTITDIRDMSLSVEMRINDAQERYRTLSMYIVETTEEEMQLSANISILWNDLFMESRQVDRSLVKVKKTFAEITLNQIEEYKQELFIFAESFNMHGPGAVGDDLEKGLQIMSTYETELVRVEARRQELAKAEKLFNLPITMYPELLNVQKEMRGLRQIYEIFKSQKEAKTEWSQTLWVNLDIQLLQEGIDGFIKSLRKLPKDARALPVSFFLEGRMKEFRESLPLLLDLKNKALRERHWKSLMERTGTNFEMNPNTFTLENMFAMELHKYGNVISEIVTSAVKELGIEKGVKEVEETWDSMKFTVHRYFKGTQEHGFILGAVDDILQHLDDDAMNLQSMAGSHFVGPFLATVQQWEKNLSLISETIEVWMLVQQKWMYLESIFIGGDIRSQLPEEAKKFDNIDKTFKKIMTDTVKDPGIKRCCLVPNRLADLQNLSDGLERCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSEPTCVQEHMIKMYDNIAALRFDTGMNGEMVANALVSAEGEVMELKQPVPAEGRVEDWMTAVLLEMRRTNRLITKEAIYFYSHQKSRVDWMLDYQGMVVLATNQVWWTYEVEDVFRRMNEGEKQALKQYAKKMHQQINDLVKRITEPLKKNDRRKINTVLIIDVHARDIVDSFVRDSITDAREFEWESQLRFYWVKEPDELFVRQCSAQFCYGYEYMGLNGRLVITPLTDRIYLTLTQALSMFLGGAPAGPAGTGKTESTKDLAKALGLLCVVTNCGEGMDYMAVGKILSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALMLHLQRFHFEGQEISLDNRIGIFITMNPGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLVAKVLAKKMTVLYKLAREQLSKQSHYDFGLRALKSVLVMAGELKRGSPNLSEDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRVRYPSFNDAVEAILEENRYIMMPSQVDKVVQMYETMMTRHTTMVVGPTGGGKSVVINTLCQSQTRLGLLTKLYSLNPKAMSVIELYGILDPVTRDWTDGILSNIFRDINKPTDKKERRYILFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQSHCALLFEVGDLQYASPATVSRCGMVFVDPKNLRYAPYWEKWVNSRAPK-EKADLCKLFEKYVPSAIDMIVDGVVDGKQTEKLKTVILQTDLNMVMQLTVMVDSLLENEDFLFEELECCFLEALYCSLGASLLDKGRQKFDAFIKKLSSLNSVHDEKVLAGPGEIPVYLPTLYDFHFDGTQKK--WVPWSSMVSKYIHNPEMKFIDILVPTVDTTRANWLLEQMVKVKRPVVLVGESGTSKTATIQNFLSNLNTDTTIMMTINFSSRTTSMDLQRTLEANVEKRTKDTFGPPMGKRLLVFMDDLNMPRVDEYGTQQPIALLKLLLDRGGMYDRGKELNYKLIKDLGFIAAMGKAGGGRNEVDPRFISLFSVFNIPFPEEESLHLIYSSILRGHTKPFEECIRNICDKLTFCTLELYKTIIKDLPPTPSKFHYIFNLRDLSRVYHGLTLTNPERFCTVTQFVRVWRNECLRVFHDRLINETDKIMVQGHVKNLVEEHFKSDLDSAMRDPILFGDYRTALK-SEPRVYEDILDYDASKALFQEILEEYNENKTKMNLVLFDDALEHLTVIHRIIRMDRGHALLVGVGGSGKQSLTKLAAFTAGYEVFEIVLSRGYSETNFRDDLKTLYLKLGIENKKMVFLFTDAHVAEEGFLELINNMLTSGMVPALFADDEKESVLNQLRDEAMKSGCGPSKESIWQYFVNKSANNLHIVLAMSPVGDTLRTRCRNFPGLVNNTSIDWFSPWPLQALYAVAKSFLG-ESPMIPKSHSEAVIDHVCMVHSSVGDYSKLFLQTLRRSNYVTPKNYLDFINTYSNLLEDKDKYILAQYKRLEGGLDKLKEASGQLAELNVKLDEQKVVLAEKTSACEILLEEICANTAVAEEKKTLAEEKAKEIEEQNKVIVVEKKDAESSLAEALPALEAARIALQDLDKSDVTEIRSFTKPPKQVQTVCECILVIRGYKEINWKTAKGMMSEGNFLRSLMEMDCDSINANQVKHVKAYLRNLNTSLEEMQGISKAGSGMLRFVEAVMGYCEVARDIKPKREKVARLERNFHQSKRELERIQNELGAIQKELRALGDKYEGAMTEKQLLQEEAEVMERRLVAADKLISGLASENKRWIKDLEELKQRRVRLLGDCLICAAFLSYEGAFSWDFRNEMVYKVWQADVLERGIPLSQPFRIENLLTDEVEISRWGSEGLPPDELSVQNGILTTRSSRFPLCIDPQQQALNWVKKKEEKNNLKISSFNDPDFLKGLELAIKYGFPFLFQDVDEYIDPVIDNVLEKNIKGAEGRQVVVLGDKEVDYDPNFKLYLNTKLANPKFLPAVFGKAMVINYTVTLKGLEDQLLSVIVGFERKELEEQRERLILETSENKRLLKDLEDSLLRELATSTGNMLDNVELIQTLDETKSKANEVFEKLKLAEKTAVDIDTLRDGYRPAAKRGAVLFFVLAEMALVSSMYQYSLASFLEVFDLSLSKSLPNPILPSRLKNIIDTLTQNVYNYGCTGLFERHKLLFSFNMTIKIEQAEGRAPQDELEFFFKGNLSLEKSKRKKLLDWLPDQGWEDIIRLMELFPNEFGTLADDIEKNPEEWKNWYDLDAPEQASFPMKYKENLSPFQKLLLIRCFRLDRVYRAVSDYVTLTMGEKYVQPPVISFEAIFDQSSPNSPIVFILSPGSEPASDLMKLAKHSGFGVNRLKFLAMGQGQEKVAFQLLDTAVARGQWLMLQNCHLLVKWLRDLEKTLERITKPHPDFRLWLTTEPIKDFPIGILQKSLKVVTEPPNGLKLNMRATYFKISHDKLMNCAHPAFRSLVYVLAFFHAVVQERRKYGKIGWNVPYDFNESDFLVCMEILDTYLTKAQNQGDEIIPWGSLKYLIGEVMYGGRVIDSFDRRILTVYTDEYLGDFIFDTFQPFHFFHNADVDYKIPALGPKQVYVDEIESLPLANTAEVFGLHPNAEIGYYTQAARDMWTHLIELQPQTGDSGGGISRDEYISQVARDIQSKLPEVFDLDVIRKKLGLEISPTSVVLLQELERFNKLTVRMSRSLAELQRALAGEVGMSSELDEVARALFNGQIPVIWRKLAPDTLKSLGNWMIHFKRRHEQYSSWVNEGEPYVMWLSGLHIPESYLTALVQATCRKNGWPLDHSTLYTQVTQYSSEDQVKERPGQGCFVSGLYLEGADWDIDNGCLVRSKPRVLVSQLPILKIIPIEARRLKLQNTLRTPVYTTSMRRNAMGVGLVFEADLYTTKHISHWVLEGVCLCLNSD 4626          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Zebrafish
Match: DNAH10 (si:dkeyp-86b9.1 [Source:ZFIN;Acc:ZDB-GENE-060531-163])

HSP 1 Score: 5065.36 bits (13138), Expect = 0.000e+0
Identity = 2567/4359 (58.89%), Postives = 3243/4359 (74.40%), Query Frame = 1
Query:  970 SEVKLEIPDLDLFENDKENLSDKEIMEMIESTVLKWDQQITGTLESLQKIVPHGPSPLAEIDFWRERNAXXXXXXXXXXXPKVKRILNLYSLAEGPV---FDTQNNELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIAWNLSDRVARLIDVNTIFNLPLEHVLKDTAEAEKMLRVWNDTYFEVRASIEASGRDARWEFDRKRLFEKTNYMADICHDLNEIAMILQEFYNIFGPELKSVTNEAKRIXXXXXXXXXXXXPLKEMPFNPFNLMKHKYDWSNFMEDFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEVESIDQLFKTNMNNPPLYHFKSCVAGGISWERHLFYNIKRPILRFLTMDEMMQSDNGKRIRTKYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILALANSENFVSEN-----VPEETIDKMDDDLRVDFGFEINEIITETRNLELLGYKVPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISDYIEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFKLQSGNK---FLKCKEFFEFMESERTSDFEHLGRKYSTIGPLITKLQGEIIGDRDVNPFEKFQPFYEFWEKRIFDRVYNMVLKNLQDYQNMLRDENFPTCLFEVDLMLAGTDVIGNPQTTEIYKLAIQDLRDAVEATRVFIRWKRNSCIETTGMKIDGQDELFYFTFYLDIGNSVEITYFCEQIANYYRNIIGKLRKYQDKWKKHKRVFIPNKQAQIDKWLTKDPTVMDFYERIRDTIDRKEELLNQPVIRKIGFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDLSLIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSNHPIDQEEIEESDKLRQLFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVG----LVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKK-------------------------IMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTREGMNQDTIEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSENAKSDKDYAMTDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKRKKPYLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLTKPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTGKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGEPNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMGVGLVVEADLATTEHPSHWVLQGVCLILNTD 13926
             E KL +P++DL    +  LS+  +++ +E  V+ W  QIT  +E  ++  P GP PLAEI+FWRER A+ S+L+EQL L  VK+IL + + A+  +    +    EL K++ E+  N +FL+ VERHF+++  GV+F  V ++IP ++  LRMIWI+SR YN DERM  LMERIAW LS+RVAR++DV+ +F            + +++L +W   YFEVRA IE S RD RWEF+R++LFEKT+YMA IC DL  +   L EFY IFGPELK+VT + KRI++VL  V  LV+P++E+ F+PF+  K    W   M++F  +V  IE +AI FI++ F TLRS+  AFD+LL+F++IR R AIN  + +KF+DI++QY KE+  I+ +F    +NPPL      +AG I W+R L   ++ P+ RF    ++M +  GK + +K++ V   MR +E   +N+W+   ++ L  L+RK++L + NS   V  +        E + + D    V+F  E+ EII+E + L+ +G  +P+  +NVALQ+E + + + GL  +V  YH ++ +L   E  ++ D+++E+++ +  G +R+NWN+LGI  +I++ N A   FES    I K   DI++KLK I++A LFK    ++       +EF EF+ESER      L   Y+ I PL+TK++  I+G       +    FY +WE++IFD +  MV +N+Q +   L      T LF++D +LA  ++   P+++E+YKL  Q + D VE T+ F+RW   SCI+     +DG+DE F FTFY DI    +I      ++   + ++  +  Y   W  ++ ++  +K   ++K+  K P+ + + E+ +  +    E+  QP+++    I +NL+ L   V+++ + W       L++SA+  L +++N++     +L   P  LE+LK +L TI  I+ +SL  E RI D QERYR L++      +EE++ S  +  L++ L  ES+ V+  L  VK  F +IT  +I ++ ++L  FA+ F   GPG++G DL+ G    L ++  +  EL  +E RRQEL  AE+LFNLPIT YPEL NVQKEM+ L QIYE++ +QK+A+  W++TLW NLDI++L EGI+GF+K  RK+P++ +A+  +  L  ++KEF+++LPL  DLK++ALRERHWK LM +TG NF++NP+TFTL ++FAMEL+++ +VI+EIVTSA KEL IEKGV+EVEETW ++KF+V  Y KG +E G+ILGA+D++LQ LDD+AMNLQSM+ S F+GPFL +VQ WEKNLSLISE ++VWM+VQ+KWMYLE IFIGGDIRSQLPEEAKKFD IDKTFKK                         IMT+T K P IK+ C VPNRL+DL NLSDGLE+CQKSLNDYLDSKRNAFPRFFFISDDELLSILGSS+  CVQEHMIKM+DNI++LRF  G + EM A A++S+E E+ME + PV  EGRVEDWMT + +EMRRTNR+ITKEA++FY   K RV WM DYQGMV L TNQ+WWT+EVEDVFR++ +G+K ALK YAK +H QI+++V  +  PL KNDR K+ TVLIIDVHARDIVDSFVRDSI DA+EFEWESQLRFYW++E DE+ ++QC+ QF YGYEYMGLNGRLVITPLTDRIYLTLTQALSM+LGGAPAGPAGTGKTE+TKDLAKALGLLCVVTNCGEGMDY +VGKI +GL QCGAWGCFDEFNRI+ SVLSVIS+Q++TI+N L++ L RFHFEGQEI LD+R+GIFITMNPGYAGRTELPESVKA FRPVVVIVPDLQQICEIMLFS+GFL AKVLAKKMT LY+L++EQLSKQ+HYDFGLRALKSVLVMAGEL+R  P+LSED VLMRALRDMNLPKF+FED PLFLGLI DLFPGLDCPRVRYP FND+VE  L E++                                               L L TKL  +NPK  SVIELYGILDP TRDWTDG+LSNIFR+INKPTDK ERRY+LFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQ+HCALLFEVGDLQYASPATVSRCGMV+VDPKNL Y P+W+ W+N +  K E   L  L++KY+P  ID +++G+++G+  EKLKT+I  T+LN+V QL  M+D  L  E    + +E  F++++Y SLG  L++  + KFD FIK L ++   ++E   A  GE+P                                          VPT+DT R  WLL + +K++RPV+LVGE+GTSKTA  Q FL N + D  I + INFSSRTTS+D+QR LE+NVEKRTKD++GPPMGKRLLVF+DD+NMP+VD+YGTQQPIA+LKL+L+R G YDRGK+LN+K ++D+GF+AAMGK GGGRN+VDPRFISLFSVFN  FP + SL  IYSSIL GH + F + I+N    +T  T+ +Y  II  LPPTPSKFHYIFNLRDLSR+Y G+  T  +RF    QF RVWR+E  RV  DRLIN+ DK  VQ  ++  + E+ KSD D AM DPILFGDYR AL+ +E R+YED+++Y+A+K LFQEI+EEY+E  + M LVLFDDAL+HLT IHR IRMD GHALLVGVGGSGKQSLTKLAA+T   ++FEI LSRGYSE + R++LKTLY KLGIENK  VF+F D HV EEGFLELINNML+SG+VPALF DDE+E++++Q+R+EA  +G GPSKESIWQYFVNK A+NLHIVL MSPVG+TLRTRCRNFPG+VNNT+IDWF PWP QALYAVA  F+G E+ +IP      ++ H  MVH SV +YSK F+Q  RR NYVTPKNYLDFINTY  LLEDKDK+  +Q  RL+GGL KL EAS QLAELN KL  QKV + EKT ACE LL+EI + T +A EKK +A+EK++ +E Q+K I  EK +AE++L EALP LE AR+AL DL+K+DV EIRSF KPPK VQ V ECI V + YKEINWK AKGMM++ +FL+SL  MD D+I   Q   V+  L  L  +++EM+ +SKAG G+L+FV AV+GY +VAR+IKPKREKVARLE+ F Q+KRELE+++NE+  ++ EL+ L  +YE A+ E+Q LQEE ++M+RRL AADKLI+GL+SENKRW+ DL+ LK ++VRLLGDCL+C+AFLSY GAFSW+FR EMVY  W+ DV+ER IP+S PFR+E++LT++VEIS+W SEGLPPDELS+QNGILTTR+SRFPLCIDPQQQALNW+ +KEE NNLK ++FNDPDFLK LELAIKYG PFLF+DVDEYIDPVIDNVLEKNIKG +GR+ V+LGDKEVD+DPNF+LYLNTKL+NPK+ P +FGK+MVINYTVTLKGLEDQLLSVIV FERKELEEQRERLI ETS+NKRLLKDLEDSLLRELATSTGNMLDN ELI TL+ETKSKA+EV EKLKL  +T+ +ID  RDGYR AAKRGA+LFFVLAEM+ ++SMYQYSL+++L+VF  SL KSLP+  L  RL+N++ TLT+NVY YGCTG+FE+HKLLF+F +T+K+E  +G   QDEL+FF KGN S+E +KRKK   WL D  W+D+ +L E+ P +F  L +DIE++   WK W + + PE A+ P  Y   L  FQKL L+RCFR+DR+YRA++ YV   MGE+YV PP+++FE I DQS+P SPIVFILSPGS+PASD++KLA+ SGFG  +LKF++MGQGQE  A  LLD A+ARG WL+LQNCHLLVKWLR+LEK LER+TKPHPDFRLWLTTEP + FPIGILQ+SLKVVTEPPNGLKLN+R+TY KI+   L N  H AF SLV+ LAFFHAVVQERRKYGKIGWN+PYDFNESDF VC++IL TYL KA +QGD  IPWGSLKYLIGEVMYGGR ID FDRRIL  Y DEY GDF+FDTFQPFHF+ +    Y IP        +  IESLPL NT EVFGLH NAEIGYYT AA++MW+ LI++QPQTG SG   SRDE I++ A  I+SKLP++FDLD +RKK GL+ISPT VVLLQELERFN L  RM++SL  L RAL GEVGMS+ELD+VA++L+NGQIP IW++LAPDTLKSL NW+ HF  R+ QYS WV  GEP VMWLSGLHIPESYLTALVQATCRKNGWPLD STLYT VTQ+++  +V ER  QGCFV GLYLEGA WD    CLVR KP+ L+  LP++K+IPIEA RLK QNT  TPVY TS RRNAMGVGLV EADL TT+H SHWVL+GVCL LN+D
Sbjct:    1 GEFKLHMPEIDLEGEVELFLSNSVMVDKLEQCVMNWHTQITIVIEEQKRKKPQGPGPLAEIEFWRERVAVFSSLIEQLNLQAVKKILEVMTRADSFIMQELEKTTAELRKYYDESVSNVQFLTTVERHFRNLVTGVDFKVVLETIPELINGLRMIWILSRCYNTDERMEALMERIAWELSERVARVVDVHVLFKEKRVVAKAKVQDGKRVLDIWKACYFEVRARIENSERDPRWEFNRRKLFEKTDYMASICQDLYSVLQTLDEFYIIFGPELKAVTGDPKRIDDVLHCVNSLVKPIEEVTFDPFDNRKMT-SWKMVMQEFNNEVQVIEREAITFIDHSFKTLRSSSAAFDLLLKFKNIRCRDAINDQLMKKFSDILAQYCKEMVLINDIFVKFKDNPPLSKNHPPMAGAIIWQRFLLDQMRYPMKRFREDRDLMNNQEGKAVESKFIEVASRMRQYEVDLYNKWKADTNQTLPILMRKSLLVMVNSYGTVCADSTRHRTGSEKVLERDVRFSVNFPPELQEIISEAKCLDRIGIVLPDELQNVALQEEVFLRYINGLKKLVRRYHLLMDNLNDAEFLLMADQVQELRQVLSVGCKRINWNNLGIPQFIQRGNQAASKFESLENQIQKNERDIDDKLKSIESANLFKFPLADQTGYLPGIREFCEFIESERAKTVNLLVNMYAAISPLLTKMESLIMGT-STGKAKGMAQFYAYWERKIFDSLTKMVFQNIQAFNTALMGN---TPLFQIDTILAAPEIALLPKSSEVYKLIRQCVGDCVETTKRFVRWMHGSCIQCPPQHVDGEDESFLFTFYSDICQLPQINEQATAVSQTIQRLLNGISVYLKSWMSYRSLWKLDKAIVMEKFAAKKPSCVMYDEKFQFYVKVSNEVAKQPMVKHEHIIRLNLEPLARAVQENIQVWVTSLGKLLNDSAREELFNLRNELLILSENLKRSPNTLEDLKFVLVTITDIRDMSLSVEMRINDAQERYRTLSMYIVETTEEEMQLSANISILWNDLFMESRQVDRSLVKVKKTFAEITLNQIEEYKQELFIFAESFNMHGPGAVGDDLEKGKYTSLQIMSTYETELVRVEARRQELAKAEKLFNLPITMYPELLNVQKEMRGLRQIYEIFKSQKEAKTEWSQTLWVNLDIQLLQEGIDGFIKSLRKLPKDARALPVSFFLEGRMKEFRESLPLLLDLKNKALRERHWKSLMERTGTNFEMNPNTFTLENMFAMELHKYGNVISEIVTSAVKELGIEKGVKEVEETWDSMKFTVHRYFKGTQEHGFILGAVDDILQHLDDDAMNLQSMAGSHFVGPFLATVQQWEKNLSLISETIEVWMLVQQKWMYLESIFIGGDIRSQLPEEAKKFDNIDKTFKKVSSAPTMKNMFENNVNPLSSVGFHQIMTDTVKDPGIKRCCLVPNRLADLQNLSDGLERCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSEPTCVQEHMIKMYDNIAALRFDTGMNGEMVANALVSAEGEVMELKQPVPAEGRVEDWMTAVLLEMRRTNRLITKEAIYFYSHQKSRVDWMLDYQGMVVLATNQVWWTYEVEDVFRRMNEGEKQALKQYAKKMHQQINDLVKRITEPLKKNDRRKINTVLIIDVHARDIVDSFVRDSITDAREFEWESQLRFYWVKEPDELFVRQCSAQFCYGYEYMGLNGRLVITPLTDRIYLTLTQALSMFLGGAPAGPAGTGKTESTKDLAKALGLLCVVTNCGEGMDYMAVGKILSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALMLHLQRFHFEGQEISLDNRIGIFITMNPGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLVAKVLAKKMTVLYKLAREQLSKQSHYDFGLRALKSVLVMAGELKRGSPNLSEDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRVRYPSFNDAVEAILEENR-----------------------------------------------LGLLTKLYSLNPKAMSVIELYGILDPVTRDWTDGILSNIFRDINKPTDKKERRYILFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQSHCALLFEVGDLQYASPATVSRCGMVFVDPKNLRYAPYWEKWVNSRAPK-EKADLCKLFEKYVPSAIDMIVDGVVDGKQTEKLKTVILQTDLNMVMQLTVMVDSLLENEDFLFEELECCFLEALYCSLGASLLDKGRQKFDAFIKKLSSLNSVHDEKVLAGPGEIP------------------------------------------VPTVDTTRANWLLEQMVKVKRPVVLVGESGTSKTATIQNFLSNLNTDTTIMMTINFSSRTTSMDLQRTLEANVEKRTKDTFGPPMGKRLLVFMDDLNMPRVDEYGTQQPIALLKLLLDRGGMYDRGKELNYKLIKDLGFIAAMGKAGGGRNEVDPRFISLFSVFNIPFPEEESLHLIYSSILRGHTKPFEECIRNICDKLTFCTLELYKTIIKDLPPTPSKFHYIFNLRDLSRVYHGLTLTNPERFCTVTQFVRVWRNECLRVFHDRLINETDKIMVQGHVKNLVEEHFKSDLDSAMRDPILFGDYRTALK-SEPRVYEDILDYDASKALFQEILEEYNENKTKMNLVLFDDALEHLTVIHRIIRMDRGHALLVGVGGSGKQSLTKLAAFTAGYEVFEIVLSRGYSETNFRDDLKTLYLKLGIENKKMVFLFTDAHVAEEGFLELINNMLTSGMVPALFADDEKESVLNQLRDEAMKSGCGPSKESIWQYFVNKSANNLHIVLAMSPVGDTLRTRCRNFPGLVNNTSIDWFSPWPLQALYAVAKSFLG-ESPMIPKSHSEAVIDHVCMVHSSVGDYSKLFLQTLRRSNYVTPKNYLDFINTYSNLLEDKDKYILAQYKRLEGGLDKLKEASGQLAELNVKLDEQKVVLAEKTSACEILLEEICANTAVAEEKKTLAEEKAKEIEEQNKVIVVEKKDAESSLAEALPALEAARIALQDLDKSDVTEIRSFTKPPKQVQTVCECILVIRGYKEINWKTAKGMMSEGNFLRSLMEMDCDSINANQVKHVKAYLRNLNTSLEEMQGISKAGSGMLRFVEAVMGYCEVARDIKPKREKVARLERNFHQSKRELERIQNELGAIQKELRALGDKYEGAMTEKQLLQEEAEVMERRLVAADKLISGLASENKRWIKDLEELKQRRVRLLGDCLICAAFLSYEGAFSWDFRNEMVYKVWQADVLERGIPLSQPFRIENLLTDEVEISRWGSEGLPPDELSVQNGILTTRSSRFPLCIDPQQQALNWVKKKEEKNNLKISSFNDPDFLKGLELAIKYGFPFLFQDVDEYIDPVIDNVLEKNIKGAEGRQVVVLGDKEVDYDPNFKLYLNTKLANPKFLPAVFGKAMVINYTVTLKGLEDQLLSVIVGFERKELEEQRERLILETSENKRLLKDLEDSLLRELATSTGNMLDNVELIQTLDETKSKANEVFEKLKLAEKTAVDIDTLRDGYRPAAKRGAVLFFVLAEMALVSSMYQYSLASFLEVFDLSLSKSLPNPILPSRLKNIIDTLTQNVYNYGCTGLFERHKLLFSFNMTIKIEQAEGRAPQDELEFFFKGNLSLEKSKRKKLLDWLPDQGWEDIIRLMELFPNEFGTLADDIEKNPEEWKNWYDLDAPEQASFPMKYKENLSPFQKLLLIRCFRLDRVYRAVSDYVTLTMGEKYVQPPVISFEAIFDQSSPNSPIVFILSPGSEPASDLMKLAKHSGFGVNRLKFLAMGQGQEKVAFQLLDTAVARGQWLMLQNCHLLVKWLRDLEKTLERITKPHPDFRLWLTTEPIKDFPIGILQKSLKVVTEPPNGLKLNMRATYFKISHDKLMNCAHPAFRSLVYVLAFFHAVVQERRKYGKIGWNVPYDFNESDFLVCMEILDTYLTKAQNQGDEIIPWGSLKYLIGEVMYGGRVIDSFDRRILTVYTDEYLGDFIFDTFQPFHFFHNADVDYKIPALGPKQVYVDEIESLPLANTAEVFGLHPNAEIGYYTQAARDMWTHLIELQPQTGDSGGGISRDEYISQVARDIQSKLPEVFDLDVIRKKLGLEISPTSVVLLQELERFNKLTVRMSRSLAELQRALAGEVGMSSELDEVARALFNGQIPVIWRKLAPDTLKSLGNWMIHFKRRHEQYSSWVNEGEPYVMWLSGLHIPESYLTALVQATCRKNGWPLDHSTLYTQVTQYSSEDQVKERPGQGCFVSGLYLEGADWDIDNGCLVRSKPRVLVSQLPILKIIPIEARRLKLQNTLRTPVYTTSMRRNAMGVGLVFEADLYTTKHISHWVLEGVCLCLNSD 4262          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Zebrafish
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-130530-910])

HSP 1 Score: 2379.75 bits (6166), Expect = 0.000e+0
Identity = 1473/4436 (33.21%), Postives = 2399/4436 (54.08%), Query Frame = 1
Query:  898 ARDEFLISLKKFTSIVDQTIIQIASEVKLEIPDLDLFENDKENLSDKEIMEMIESTVLKWDQQITGTLESLQKIVPHGPS--PLAEIDFWRERNAXXXXXXXXXXXPKVKRI---LNLYSLAEGPVFDTQNNELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIAWNLSDRVARLIDVNTIFN---LPLEHVLKDTAEAEKMLRVWNDTYFEVRASIEASGRDARWEFDRKRLFEKTNYMADICHDLNEIAMILQEFYNIFGPELKSVTNEAKRIXXXXXXXXXXXXPLKEMPFNPFNLMKHKYD-----WSNFMEDFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEVESIDQLFKTNMNNPPLYHFKSCVAGGISWERHLFYNIKRPILRFLTMDEMMQSDNGKRIRTKYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILALANSENFVSENVPEETIDKMDDDLRVDFGFEINEIITETRNLELLGYKVPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGI-SDYIEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFKLQSGNKFLKCKEFFEFMESERTSDFEHLGRKYSTIGPLITKLQGEIIGDRDVNPFEKFQPFYEFWEK--RIFDRVYNMVLK-NLQDYQNMLRDEN--FPTCLFEVDLML--------AGTDVIGNPQTTE--IYKLAIQDLRDAVEATRVFIRWKRNSCIETTGMKIDGQDELFYFTFYLDIGNSVEITYFCEQIANYYRNIIGKLRKYQDKWKKHKRVFIPNKQAQIDKWLTKDPTVMDF------YERIRDTIDRKEELLNQPVIRKIGFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDLSLIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSNHPIDQEEIEESDKLRQ---LFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWK-----NLDIKVLDEGIEGFLKEWRKMPREVK--AMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSS-DCECVQEHMIKMFDNISSLRFTK-GTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNR-VITKEAVFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKL-------LHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLH-------TKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEK--LKTIIPLTNLNLVTQLCNMLDCQLTREGMNQDT--------IEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQ-YVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDD-KTFVQKAIEEQLSENAKSDKDYAM------TDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEY--SEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKR--KKPYLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERL--TKPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSS-LNNFNHTAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQ---TGKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGEPNVM-WLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMG-VGLVVEADLATTEHP-SHWVLQGVCLILNTD 13926
            +++ +   L +F + +  +  ++     L IP   L    +E + +K +++ +E  V+ W +QI   L S Q +   G +  PL EI FW+ R A L ++  QL+ P V+ I   L LY+    P F     ++ +  ++A+ N  FLSL++   + +A  +    +   +  ++  +R+IW+ S ++N  +R+  L+ +I+  +     R I +N IF    +  + +L D  +       W + Y    + +        W  D+  +F   +     C DL EI    Q+F      E   +   A R+   + +    ++   +        ++   D     W      FR K+  +E    + I + F  +   E    +L  FQH+  R+AI + + +K  D+ + +  E+  I+ +     +  P+   +   AG I W + L   ++R +        +    +   +   Y+ + +T+     + F +W   + K     L + ++     +  +               L ++F   + ++  E    + L +++P     V  + E  + + E +L +V  Y+ +IK L + E+ + ++ I+ + + I+PGL +L+W++ G  S +I  C +  +  +  V       +   +  ++I    L  L  G    +  EF E  ++ + S    L   +  I     K+   + G   ++  E  Q +  + EK  ++ +  + + +K +LQ+    +  +    P  LF V+++L        A  D   +PQ     +  ++ Q ++      R+     R          I  QDE              EI      IA         L+ Y   W KH+ ++   K + I ++   +PTV  F      Y  + + + ++E LL+      + F+ ++   L   +  H   W+  +   L   A + L  + + ++ +   LS  P  L +L   L  ++T+Q    + ES+I  + E+Y +LT     +D   +E  + L      F  +  +S  +  +          ++ EE   F K  + F   F   GP          L  + +   +L  ++   Q + +   +F +      ++  ++K++  L Q++E+    ++  + WAE  WK     +L  +V+D   +   K   K+ R  K        +   ++++FK  +PL +DL++ ALRERHW ++  +  Q FD +   FTL  + A+ L+   + I++I  +ASKELSIE+ +  + +TW  +   + P+   G  +   L   DEV Q L+DN + L  + ASRF+  F   V +WE+ LSL+ EV+++ + VQR+WMYLE IF+  DIR QL  E  +FDA+  ++K IM    K     +    P  L  L+ ++  LE+ QKSL+ YL++KR  FPRF+F+S+D+LL ILG S + E VQ H+ K FDNI SLR  K GT  +  A+ M S++ E ++F  PVL+EG VE W+  +E  MR T +  +   ++   +    R +W+ D+ G + +  +QI WT    DV R +   ++ A K   K        + NQ  E +   R  L+K  R K+  ++ ++VHARD++    +    D   F+W  QLR YW ++ D+  I+Q    F YGYEY+G +GRLVITPLTDR Y+TLT AL ++ GG+P GPAGTGKTET KDL K+LG+  +V NC EG+D++S+G++++GL Q GAWGCFDEFNRI + VLSV++ Q+ +I + L   L+ F FEG++I L    GIFITMNPGYAGRTELP+++K+ FRP+ ++VPD   I EI LF++GF + KVLAKK+ TLY L+ +QLSKQ+HYDFGLRAL S+L  AG+ RR  PD+ ++++L+ +++DMN+ K    D PLF G+IQDLFP ++ P + Y    ++VE  L +    V+     K++QLYET  +RH+TM+VG TG GK+V  + L  + + L  +        +  P+NPK  S+ ELYG  + +T +WTDG+LS++ R +    +K + ++++FDG VD LW+E+MNSVMDDNK+LTL NGERI +    +LLFEV DL  ASPATVSRCGMVY D  +LG+ P+ Q W+ K++ K E D L  L+++YI  T+           A +K   K ++ +T LN V  LC +     T E   +          +E  FI S+ WS+   + E+ + K D F++ +               G  P++  T+++YY D+  + + W  + + +P+ + +     F +I+VPT+DTVR  +L+   +  Q PVLL G  GT KT+V+Q+ L++ D   +  L +N SS+T+S ++Q  +ES VEKR K  Y P  GK+++VF+DD+NMP VD +G+Q P+ +L+L ++    YDR K    K ++D+  L +MG PGGGR  +  R  S F++ N TFP++S +  IY +++S   Q F +E+K    I+T+ T+ +Y+ I  +  PTP+K HY+FNLRD+S+++QG+ +   D         R+W HE  RV  DRL++  D +TFV       LSE   S  D           P LFGD+     + E ++YED+++++A K   +  +E+Y  +  V PM LVLF DA+DH+TR+ R I    G+ LLVG+GGSG+QSLT+LAAY     +F++ +++ Y +++ RE++K LY   G+ENK TVF+F D  +V+E FLE INN+LSSG VP L+  DE + I S + + A    +  + ++++ Y + +  +NLHIVLCMSPVG+  R R R +P +VN TTIDWF  WP  AL  VA   +   +    D  + ++   FV VH SV ++S     + +R NYVTP NYL+ ++ Y KLL +K      Q  +L+ GL K+ +   ++  ++ +L   K  V E    CE  L  I  + + A E+++     S+ +E +  + +     A+  L EALP LE+A  AL+ L K D+ EI+S+ +PP  V+ V + + + +   E  W  AK  + + +F++ L   D DNI+ +    +     +     + +  VS A   L  +V A+  Y  + R ++PKR ++        + +  L + + ++ ++  +L  L ++Y+  + +++ L+ +++ M+ +L+ A KL++GL+ E  RW   +  L+     L+GDCL+ +AFLSY+G F    R E+V   W   V E ++P S  F     L+    + +WN +GLP D  S +NG++ TR +R+PL +DPQ QAL WI   E    LK      PDFL+ LE A+++G P L ++V E +DP +  +L K++    GR  + LGDKE+++ P FR Y+ TKLSNP Y P I  K+ ++N+ V  +GLE QLL ++V+ ER ELEEQ++ L+   +  KR L++LED +LR L  +TG++LD+ +L+NTL+ +K  A+EV+E+L++   T  +ID  R+ YR  A+R +ILFFVL ++  I+ MYQ+SL AY+++F  S++ S     L++R+ N+    T  VY Y C G+FE HKLLF+F +  K+    G L  DE +FF++G   ++  K+       WLSD +W ++T+L ++    F  L+   E+    W  W  +  PE A LP ++ N     QK+ ++R  R DR+   +T +VI  +G ++V PPIL+ + +   ST  +P++F+LSPG DP + +++LAE SG G  +   +S+GQGQ   A  L+   +A GHW+ L NCHL + W+ EL+K ++ L   + HPDFRLWL++ P   FPI ILQ  +K+ TEPP G+K N++  Y++++ +  L       +  L+F+L FFH+V+ ERRK+ ++GWNI Y FN+SDF V   +L  YL +  +     IPW +LK+LI  + YGG   DD+DRR+L TY+++YF   + DT  PF F  S   +Y +P+  +    + YI  LP    PE+FG + NA+I    + A+ ++  L+ +QPQ   T  + +  SR++ + E ++ +  K+P   D +  RK    D+SP  VVLLQE++R+N L+  +  SL  L + + G V MS+ L++    +++ ++P +W++  P +LK LA+W      R  Q+++W E   P V+ WLSG   P  +LTA++Q++ R+N   +D  +   SVT       +      G  + GL+LEGAGWD+   CLV  +P QL+  +P I   P+E+ +   +N +  P Y    R  + G    VV  DL +   P  HW+ +G  L+++ D
Sbjct:  190 SKNNYSAELHRFLTKLTDSRFKLLGSTVLYIPLEALQHRPEEAVKNKNLVQRLEMVVIHWTRQIKAVL-SAQSVSDIGDTLGPLEEISFWKSRCADLDSISTQLQKPGVRHIQEILQLYTSTYIPPFCKLAKQIQESSLQAQSNVTFLSLLKEPCEELAQ-LKPCEIAPKLAHILNLIRVIWVNSSYFNTRDRITALLRKISNEIIRLCCREISLNRIFQGYAVSSKQILNDCIQC---CLAWKELYLHT-SQLHHKHSSQGWSLDQISIFALVDSFMQRCKDLIEICECQQQFARWEDGERVPLPCFAGRLGSEVTQKLLYIEATFDKSLQVLQSVQDILDVRNPSWHEDYSRFRAKLKDLEVMMQNLITSTFEMVNCVEEGVQLLDVFQHLSGREAIKRTIDRKTVDVYNLFHSELVEINLVMCRTSSLIPVQMPR--YAGQIHWTKALHSRVERSMEVLRRAHFLPHVRSADEMHVIYVKLCQTLDEKVRRIFTDWSQSLSKECHSSLDQPLMIRCKGKTGL---------------LDINFNKNLLKLFNEIHYWDRLQFEIPHFVTEVYQRREELHNLRENVLLVVRDYNRIIKDLNADELGLFSERIRFLDKKIQPGLSKLHWSTKGTPSAFINDCRVHANKVQLMVDEYKAANLATSKHCEQISELLLVHL-DGKTVYRDHEFQEDQQTHQHSQMLRLQNAHQDI----IKIMARVYGTFHLDGPEVQQHWTSYMEKIDQMLEEAFRVNIKRSLQELSKAINGDGKISPNPLFRVEVVLTPETARSTAQVDFSPSPQKLAHIVNSISSQLIKTISGFKRLPDLLTRQQSQRKPIHSIIEQDE--------------EICKIQGAIAAGMVTNASYLQTYLKTWDKHREIWEIEKDSFIQRYQRLNPTVTSFDADIARYTEVANNVQKEETLLS------VQFVLLDCSPLKFSLLQHCNEWQSKFTQLLSLMASSKLKELHSFLQENAVRLSQPPQTLTDLGESLKLLETLQADLNKIESQIPPIHEQYAILTKYEVAVDPAVLELLEALNAEWVWFQQVVIDSDIMLKKHKDTMKSGLILSSEE---FQKKTQTFLQSFSSNGPFGSSVTPHSALQQVSELRAQLEALKEEEQNICSGLNIFTIEQPASKDILALEKDVDYLQQVWEI---ARQWEDLWAE--WKGGHLASLQTEVMDNTAQTMFKTLHKLSRAFKDKHWEIVDSSKSRIEQFKKIIPLITDLRNSALRERHWNQIRQEVQQTFDPSSADFTLEKIVALGLDHHAESISDISGAASKELSIEQTLEGIMKTWKEMSLDITPHKDKGHHK---LRGTDEVFQALEDNQVTLSVIKASRFVKAFEKEVDHWERCLSLVLEVIEMILTVQRQWMYLENIFLADDIRKQLVRETAEFDAVTSSWKIIMERLDKDKNALRGTHHPGLLEKLSEMNTKLEEIQKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKSLRINKVGTGNKSEASGMFSADGEFVDFTHPVLLEGPVEAWLCDVERTMRWTLKDSLRNCSMALKKMPGKRGKWVRDWPGQMLITASQIQWT---TDVTRALMTSKERADKSALKSLKKKQVSMLNQYSEAI---RGNLTKILRLKIVALVTVEVHARDVISKLAKGGCCDVNAFDWLCQLRLYWEKDVDDCIIRQTNTHFRYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGMYVIVVNCSEGLDFKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGLNNFSFEGRQINLIWSCGIFITMNPGYAGRTELPDNLKSMFRPISMVVPDSTLIAEITLFAEGFNNCKVLAKKVFTLYSLAVQQLSKQDHYDFGLRALTSLLRYAGKKRRARPDIVDEEILLMSMKDMNIAKLSSIDLPLFNGIIQDLFPAVETPTIDYGKLKEAVEAELRQSGLQVIPFTVTKVIQLYETKNSRHSTMIVGKTGSGKTVTWRTLQNTLSTLHRNGEPGFNLIRECPLNPKAVSLGELYGEYNLSTNEWTDGVLSSLMR-MACADEKPDEKWIVFDGPVDTLWIESMNSVMDDNKVLTLINGERISMPEQVSLLFEVEDLSVASPATVSRCGMVYSDYSDLGWKPYVQSWMEKRQ-KVETDLLWQLFERYIDKTL-----------AFKKTHCKELVAITELNGVASLCRLYQSLATAENGVKPADSENYGRMVELWFIFSLIWSVCASVDEEGRKKIDTFLREI--------------EGSFPNK-DTIYEYYVDT--KNKTWASFEDKLPKGWRYASNAPFYKIMVPTVDTVRYHYLVKALVSTQHPVLLTGPVGTGKTSVAQSVLQSLDNITWATLTVNMSSQTSSNNVQEIIESRVEKRIKGVYVPVGGKKMVVFLDDLNMPAVDNFGSQPPLELLRLWIDYGFWYDRQKQ-TLKYIKDLFLLGSMGPPGGGRTHISGRLQSRFNLINMTFPTESQIKRIYGTMISQKLQEFEEEVKPIGGILTQATLELYHAITSRFLPTPAKIHYLFNLRDISKVFQGLLRAHKDFHDTKQSITRLWIHECFRVFSDRLVDHADMETFVGV-----LSEKLASHFDVPFHTICPNKQPPLFGDF-----LRESQIYEDLLDFKALKVHMENQLEDYNLTPGVVPMSLVLFRDAIDHVTRLVRVISQLRGNMLLVGIGGSGRQSLTRLAAYICRFTVFQVEVTKQYRKQEFREDIKKLYRLTGVENKPTVFLFNDTQIVDESFLEDINNILSSGEVPNLYKADELDEIQSALSDSARKDNILETPDAMFNYLIERVRNNLHIVLCMSPVGDPFRNRIRQYPALVNCTTIDWFSEWPRDALLEVAERCLDGLSLGSDDGIQTKVASIFVTVHQSVAQFSHRMKVELKRHNYVTPTNYLELVSGYKKLLSEKRDELGEQVSKLRNGLFKIDDTRTKVEAMSVELEEAKKKVAEFQKQCEEYLVVIVQQKREADEQQKAVGAHSEKIEAEEIKCKAMAENAQRDLDEALPALEEAMKALESLNKKDMTEIKSYGRPPALVETVMQAVMILRGC-EPTWAEAKRQLGEGNFIKQLVNFDKDNISDRVLKTIGQYCTQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIFRVVEPKRARLHGAMTQLAEKQAALAEAQGKLREVGEKLDHLKRQYDEKLAQKEELRRKSEDMELKLDRAGKLVSGLAGERVRWKETVDGLEKNMSCLVGDCLLAAAFLSYMGPFLSNHRDELVTDIWMKQVRELEVPCSPGFSFAVFLSKPTAVREWNIQGLPSDAFSTENGVIVTRGNRWPLMVDPQGQALKWIKNMEFKQGLKVIDLQMPDFLRILENAVQFGSPVLLQNVQEELDPSLAPILNKSLTRVGGRFLLKLGDKEIEYSPEFRFYMTTKLSNPHYTPEISSKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIASGKRKLQELEDEILRLLNEATGSLLDDVQLVNTLQTSKVTATEVAEQLEISELTESQIDTAREAYRPCAQRASILFFVLNDLGCIDPMYQFSLDAYINLFILSIESSPRSHKLEERINNLNRHHTYAVYRYTCRGLFECHKLLFSFHMCAKILEASGKLNMDEYNFFLRGGLVLDTKKQMDNPCSHWLSDSNWDNITELDKL--TNFHELMASFEQYPRDWHHWYTNPEPEKAPLPGEWENSCNELQKMLIVRSLRQDRVSLCVTAFVINNLGSQFVEPPILDMKAVVADSTTRTPLIFVLSPGVDPTAALLQLAETSGMG-QRFFALSLGQGQAPIATRLIKEGVANGHWVFLANCHLSLSWMCELDKLVDELQVQECHPDFRLWLSSSPHPEFPIAILQTGIKITTEPPRGVKWNMKRLYQRVSETQFLRCSRPLLYRKLLFSLCFFHSVILERRKFLQLGWNIIYSFNDSDFEVSENLLSLYLDEYEE-----IPWDALKFLIAGINYGGHVTDDWDRRLLTTYINQYFCPAVIDT--PF-FKVSSLVSYYVPRDGSQSSYVDYISQLPALEHPELFGQNPNADIASQITEARTLFHTLLSLQPQVTSTDTTSAGASREDKVLELSADVLQKIPAEIDYEGTRKLLKDDLSPLNVVLLQEIQRYNTLLHTIRLSLLELEKGIKGLVVMSSSLEETFNCIHDARVPPLWEKAYP-SLKPLASWTRDLCQRVEQFARWAETARPPVLFWLSGFTFPTGFLTAVLQSSARQNNVSVDTLSWEFSVTTVED-NNLLFPPKDGVLIQGLFLEGAGWDKKASCLVEAEPMQLVCPMPTIHFKPVESRKRLAKNMYSCPCYYYPVRSGSSGRQSFVVAVDLKSGAVPYDHWIKRGTALLMSLD 4505          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Zebrafish
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-130530-910])

HSP 1 Score: 2309.64 bits (5984), Expect = 0.000e+0
Identity = 1402/4097 (34.22%), Postives = 2253/4097 (54.99%), Query Frame = 1
Query: 1900 WSNFMEDFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEVESIDQLFKTNMNNPPLYHFKSCVAGGISWERHLFYNIKRPILRFLTMDEMMQSDNGKRIRTKYLNVGRTMRAFEEKRFNEWRVYVDK-VLSELLRKNILALANSENFVSENVPEETIDKMDDDLRVDFGF----------EINEIITETRNLELLGYKVPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGI-SDYIEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFKLQSGNKFLKCKEFFEFMESERTSDFEHLGRKYSTIGPLITKLQGEIIGDRDVNPFEKFQPFYEFWEK--RIFDRVYNMVLK-NLQDYQNMLRDEN--FPTCLFEVDLML------AGTDVIGNPQTTE--IYKLAIQDLRDAVEATRVFIRWKRNSCIETTGMKIDGQDELFYFTFYLDIGNSVEITYFCEQIANYYRNIIGKLRKYQDKWKKHKRVFIPNKQAQIDKWLTKDPTVMDF------YERIRDTIDRKEELLNQPVIRKIGFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDLSLIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSNHPIDQ--EEIEESDKLRQLFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWK-----NLDIKVLDEGIEGFLKEWRKMPREVK--AMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSS-DCECVQEHMIKMFDNISSLRFTK-GTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNR-VITKEAVFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKL-------LHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLH-------TKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEK--LKTIIPLTNLNLVTQLCNMLDCQLTREGMNQDT--------IEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQ-YVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDD-KTFVQKAIEEQLSENAKSDKDYAM------TDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEY--SEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKR--KKPYLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERL--TKPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSS-LNNFNHTAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQ---TGKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGEPNVM-WLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMG-VGLVVEADLATTEHP-SHWVLQGVCLILNTD 13926
            W      FR K+  +E    + I + F  +   E    +L  FQH+  R+AI + + +K  D+ + +  E+  I+ +     +  P+   +   AG I W + L   ++R +        +    +   +   Y+ + +T+     + F +W   + K   S L +  ++        +  N  + +       L+   GF          E   +  E    + L +++P     V  + E  + + E +L +V  Y+ +IK L + E+ + ++ I+ + + I+PGL +L+W++ G  S +I  C +  +  +  V       +   +  ++I    L  L  G    +  EF E  ++ + S    L   +  I     K+   + G   ++  E  Q +  + EK  ++ +  + + +K +LQ+    +  +    P  LF V+++L      +  D   +PQ     +  ++ Q ++      R+     R          I  QDE              EI      IA         L+ Y   W KH+ ++   K + I ++   +PTV  F      Y  + + + ++E LL+      + F+ ++   L   +  H   W+  +   L   A + L  + + ++ +   LS  P  L +L   L  ++T+Q    + ES+I  + E+Y +LT     +D   E +E  +     F  +  +S  +  +          ++ EE   F K  + F   F   GP          L  + +   +L  ++   Q + +   +F +      ++  ++K++  L Q++E+    ++  + WAE  WK     +L  +V+D   +   K   K+ R  K        +   ++++FK  +PL +DL++ ALRERHW ++  +  Q FD +   FTL  + A+ L+   + I++I  +ASKELSIE+ +  + +TW  +   + P+   G  +   L   DEV Q L+DN + L  + ASRF+  F   V +WE+ LSL+ EV+++ + VQR+WMYLE IF+  DIR QL  E  +FDA+  ++K IM    K     +    P  L  L+ ++  LE+ QKSL+ YL++KR  FPRF+F+S+D+LL ILG S + E VQ H+ K FDNI SLR  K GT  +  A+ M S++ E ++F  PVL+EG VE W+  +E  MR T +  +   ++   +    R +W+ D+ G + +  +QI WT    DV R +   ++ A K   K        + NQ  E +   R  L+K  R K+  ++ ++VHARD++    +    D   F+W  QLR YW ++ D+  I+Q    F YGYEY+G +GRLVITPLTDR Y+TLT AL ++ GG+P GPAGTGKTET KDL K+LG+  +V NC EG+D++S+G++++GL Q GAWGCFDEFNRI + VLSV++ Q+ +I + L   L+ F FEG++I L    GIFITMNPGYAGRTELP+++K+ FRP+ ++VPD   I EI LF++GF + KVLAKK+ TLY L+ +QLSKQ+HYDFGLRAL S+L  AG+ RR  PD+ ++++L+ +++DMN+ K    D PLF G+IQDLFP ++ P + Y    ++VE  L +    V+     K++QLYET  +RH+TM+VG TG GK+V  + L  + + L  +        +  P+NPK  S+ ELYG  + +T +WTDG+LS++ R +    +K + ++++FDG VD LW+E+MNSVMDDNK+LTL NGERI +    +LLFEV DL  ASPATVSRCGMVY D  +LG+ P+ Q W+ K++ K E D L  L+++YI  T+           A +K   K ++ +T LN V  LC +     T E   +          +E  FI S+ WS+   + E+ + K D F++ +               G  P++  T+++YY D+  + + W  + + +P+ + +     F +I+VPT+DTVR  +L+   +  Q PVLL G  GT KT+V+Q+ L++ D   +  L +N SS+T+S ++Q  +ES VEKR K  Y P  GK+++VF+DD+NMP VD +G+Q P+ +L+L ++    YDR K    K ++D+  L +MG PGGGR  +  R  S F++ N TFP++S +  IY +++S   Q F +E+K    I+T+ T+ +Y+ I  +  PTP+K HY+FNLRD+S+++QG+ +   D         R+W HE  RV  DRL++  D +TFV       LSE   S  D           P LFGD+     + E ++YED+++++A K   +  +E+Y  +  V PM LVLF DA+DH+TR+ R I    G+ LLVG+GGSG+QSLT+LAAY     +F++ +++ Y +++ RE++K LY   G+ENK TVF+F D  +V+E FLE INN+LSSG VP L+  DE + I S + + A    +  + ++++ Y + +  +NLHIVLCMSPVG+  R R R +P +VN TTIDWF  WP  AL  VA   +   +    D  + ++   FV VH SV ++S     + +R NYVTP NYL+ ++ Y KLL +K      Q  +L+ GL K+ +   ++  ++ +L   K  V E    CE  L  I  + + A E+++     S+ +E +  + +     A+  L EALP LE+A  AL+ L K D+ EI+S+ +PP  V+ V + + + +   E  W  AK  + + +F++ L   D DNI+ +    +     +     + +  VS A   L  +V A+  Y  + R ++PKR ++        + +  L + + ++ ++  +L  L ++Y+  + +++ L+ +++ M+ +L+ A KL++GL+ E  RW   +  L+     L+GDCL+ +AFLSY+G F    R E+V   W   V E ++P S  F     L+    + +WN +GLP D  S +NG++ TR +R+PL +DPQ QAL WI   E    LK      PDFL+ LE A+++G P L ++V E +DP +  +L K++    GR  + LGDKE+++ P FR Y+ TKLSNP Y P I  K+ ++N+ V  +GLE QLL ++V+ ER ELEEQ++ L+   +  KR L++LED +LR L  +TG++LD+ +L+NTL+ +K  A+EV+E+L++   T  +ID  R+ YR  A+R +ILFFVL ++  I+ MYQ+SL AY+++F  S++ S     L++R+ N+    T  VY Y C G+FE HKLLF+F +  K+    G L  DE +FF++G   ++  K+       WLSD +W ++T+L ++    F  L+   E+    W  W  +  PE A LP ++ N     QK+ ++R  R DR+   +T +VI  +G ++V PPIL+ + +   ST  +P++F+LSPG DP + +++LAE SG G  +   +S+GQGQ   A  L+   +A GHW+ L NCHL + W+ EL+K ++ L   + HPDFRLWL++ P   FPI ILQ  +K+ TEPP G+K N++  Y++++ +  L       +  L+F+L FFH+V+ ERRK+ ++GWNI Y FN+SDF V   +L  YL +  +     IPW +LK+LI  + YGG   DD+DRR+L TY+++YF   + DT  PF F  S   +Y +P+  +    + YI  LP    PE+FG + NA+I    + A+ ++  L+ +QPQ   T  + +  SR++ + E ++ +  K+P   D +  RK    D+SP  VVLLQE++R+N L+  +  SL  L + + G V MS+ L++    +++ ++P +W++  P +LK LA+W      R  Q+++W E   P V+ WLSG   P  +LTA++Q++ R+N   +D  +   SVT       +      G  + GL+LEGAGWD+   CLV  +P QL+  +P I   P+E+ +   +N +  P Y    R  + G    VV  DL +   P  HW+ +G  L+++ D
Sbjct:  388 WHEDYSRFRAKLKDLEVMMQNLITSTFEMVNCVEEGVQLLDVFQHLSGREAIKRTIDRKTVDVYNLFHSELVEINLVMCRTSSLIPVQMPR--YAGQIHWTKALHSRVERSMEVLRRAHFLPHVRSADEMHVIYVKLCQTLDEKVRRIFTDWSQSLSKECHSSLDQPLMIRCKGKTGLLDINFNKYSCIHNTCILQNRLGFFNVTNQHTESECTTLFNEIHYWDRLQFEIPHFVTEVYQRREELHNLRENVLLVVRDYNRIIKDLNADELGLFSERIRFLDKKIQPGLSKLHWSTKGTPSAFINDCRVHANKVQLMVDEYKAANLATSKHCEQISELLLVHL-DGKTVYRDHEFQEDQQTHQHSQMLRLQNAHQDI----IKIMARVYGTFHLDGPEVQQHWTSYMEKIDQMLEEAFRVNIKRSLQELSKAINGDGKISPNPLFRVEVVLTPETARSTVDFSPSPQKLAHIVNSISSQLIKTISGFKRLPDLLTRQQSQRKPIHSIIEQDE--------------EICKIQGAIAAGMVTNASYLQTYLKTWDKHREIWEIEKDSFIQRYQRLNPTVTSFDADIARYTEVANNVQKEETLLS------VQFVLLDCSPLKFSLLQHCNEWQSKFTQLLSLMASSKLKELHSFLQENAVRLSQPPQTLTDLGESLKLLETLQADLNKIESQIPPIHEQYAILTKYEVAVDPVLELLEALNAEWVWFQQVVIDSDIMLKKHKDTMKSGLILSSEE---FQKKTQTFLQSFSSNGPFGSSVTPHSALQQVSELRAQLEALKEEEQNICSGLNIFTIEQPASKDILALEKDVDYLQQVWEI---ARQWEDLWAE--WKGGHLASLQTEVMDNTAQTMFKTLHKLSRAFKDKHWEIVDSSKSRIEQFKKIIPLITDLRNSALRERHWNQIRQEVQQTFDPSSADFTLEKIVALGLDHHAESISDISGAASKELSIEQTLEGIMKTWKEMSLDITPHKDKGHHK---LRGTDEVFQALEDNQVTLSVIKASRFVKAFEKEVDHWERCLSLVLEVIEMILTVQRQWMYLENIFLADDIRKQLVRETAEFDAVTSSWKIIMERLDKDKNALRGTHHPGLLEKLSEMNTKLEEIQKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKSLRINKVGTGNKSEASGMFSADGEFVDFTHPVLLEGPVEAWLCDVERTMRWTLKDSLRNCSMALKKMPGKRGKWVRDWPGQMLITASQIQWT---TDVTRALMTSKERADKSALKSLKKKQVSMLNQYSEAI---RGNLTKILRLKIVALVTVEVHARDVISKLAKGGCCDVNAFDWLCQLRLYWEKDVDDCIIRQTNTHFRYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGMYVIVVNCSEGLDFKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGLNNFSFEGRQINLIWSCGIFITMNPGYAGRTELPDNLKSMFRPISMVVPDSTLIAEITLFAEGFNNCKVLAKKVFTLYSLAVQQLSKQDHYDFGLRALTSLLRYAGKKRRARPDIVDEEILLMSMKDMNIAKLSSIDLPLFNGIIQDLFPAVETPTIDYGKLKEAVEAELRQSGLQVIPFTVTKVIQLYETKNSRHSTMIVGKTGSGKTVTWRTLQNTLSTLHRNGEPGFNLIRECPLNPKAVSLGELYGEYNLSTNEWTDGVLSSLMR-MACADEKPDEKWIVFDGPVDTLWIESMNSVMDDNKVLTLINGERISMPEQVSLLFEVEDLSVASPATVSRCGMVYSDYSDLGWKPYVQSWMEKRQ-KVETDLLWQLFERYIDKTL-----------AFKKTHCKELVAITELNGVASLCRLYQSLATAENGVKPADSENYGRMVELWFIFSLIWSVCASVDEEGRKKIDTFLREI--------------EGSFPNK-DTIYEYYVDT--KNKTWASFEDKLPKGWRYASNAPFYKIMVPTVDTVRYHYLVKALVSTQHPVLLTGPVGTGKTSVAQSVLQSLDNITWATLTVNMSSQTSSNNVQEIIESRVEKRIKGVYVPVGGKKMVVFLDDLNMPAVDNFGSQPPLELLRLWIDYGFWYDRQKQ-TLKYIKDLFLLGSMGPPGGGRTHISGRLQSRFNLINMTFPTESQIKRIYGTMISQKLQEFEEEVKPIGGILTQATLELYHAITSRFLPTPAKIHYLFNLRDISKVFQGLLRAHKDFHDTKQSITRLWIHECFRVFSDRLVDHADMETFVGV-----LSEKLASHFDVPFHTICPNKQPPLFGDF-----LRESQIYEDLLDFKALKVHMENQLEDYNLTPGVVPMSLVLFRDAIDHVTRLVRVISQLRGNMLLVGIGGSGRQSLTRLAAYICRFTVFQVEVTKQYRKQEFREDIKKLYRLTGVENKPTVFLFNDTQIVDESFLEDINNILSSGEVPNLYKADELDEIQSALSDSARKDNILETPDAMFNYLIERVRNNLHIVLCMSPVGDPFRNRIRQYPALVNCTTIDWFSEWPRDALLEVAERCLDGLSLGSDDGIQTKVASIFVTVHQSVAQFSHRMKVELKRHNYVTPTNYLELVSGYKKLLSEKRDELGEQVSKLRNGLFKIDDTRTKVEAMSVELEEAKKKVAEFQKQCEEYLVVIVQQKREADEQQKAVGAHSEKIEAEEIKCKAMAENAQRDLDEALPALEEAMKALESLNKKDMTEIKSYGRPPALVETVMQAVMILRGC-EPTWAEAKRQLGEGNFIKQLVNFDKDNISDRVLKTIGQYCTQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIFRVVEPKRARLHGAMTQLAEKQAALAEAQGKLREVGEKLDHLKRQYDEKLAQKEELRRKSEDMELKLDRAGKLVSGLAGERVRWKETVDGLEKNMSCLVGDCLLAAAFLSYMGPFLSNHRDELVTDIWMKQVRELEVPCSPGFSFAVFLSKPTAVREWNIQGLPSDAFSTENGVIVTRGNRWPLMVDPQGQALKWIKNMEFKQGLKVIDLQMPDFLRILENAVQFGSPVLLQNVQEELDPSLAPILNKSLTRVGGRFLLKLGDKEIEYSPEFRFYMTTKLSNPHYTPEISSKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIASGKRKLQELEDEILRLLNEATGSLLDDVQLVNTLQTSKVTATEVAEQLEISELTESQIDTAREAYRPCAQRASILFFVLNDLGCIDPMYQFSLDAYINLFILSIESSPRSHKLEERINNLNRHHTYAVYRYTCRGLFECHKLLFSFHMCAKILEASGKLNMDEYNFFLRGGLVLDTKKQMDNPCSHWLSDSNWDNITELDKL--TNFHELMASFEQYPRDWHHWYTNPEPEKAPLPGEWENSCNELQKMLIVRSLRQDRVSLCVTAFVINNLGSQFVEPPILDMKAVVADSTTRTPLIFVLSPGVDPTAALLQLAETSGMG-QRFFALSLGQGQAPIATRLIKEGVANGHWVFLANCHLSLSWMCELDKLVDELQVQECHPDFRLWLSSSPHPEFPIAILQTGIKITTEPPRGVKWNMKRLYQRVSETQFLRCSRPLLYRKLLFSLCFFHSVILERRKFLQLGWNIIYSFNDSDFEVSENLLSLYLDEYEE-----IPWDALKFLIAGINYGGHVTDDWDRRLLTTYINQYFCPAVIDT--PF-FKVSSLVSYYVPRDGSQSSYVDYISQLPALEHPELFGQNPNADIASQITEARTLFHTLLSLQPQVTSTDTTSAGASREDKVLELSADVLQKIPAEIDYEGTRKLLKDDLSPLNVVLLQEIQRYNTLLHTIRLSLLELEKGIKGLVVMSSSLEETFNCIHDARVPPLWEKAYP-SLKPLASWTRDLCQRVEQFARWAETARPPVLFWLSGFTFPTGFLTAVLQSSARQNNVSVDTLSWEFSVTTVED-NNLLFPPKDGVLIQGLFLEGAGWDKKASCLVEAEPMQLVCPMPTIHFKPVESRKRLAKNMYSCPCYYYPVRSGSSGRQSFVVAVDLKSGAVPYDHWIKRGTALLMSLD 4385          

HSP 2 Score: 69.707 bits (169), Expect = 1.290e-10
Identity = 51/202 (25.25%), Postives = 102/202 (50.50%), Query Frame = 1
Query:  898 ARDEFLISLKKFTSIVDQTIIQIASEVKLEIPDLDLFENDKENLSDKEIMEMIESTVLKWDQQITGTLESLQKIVPHGPS--PLAEIDFWRERNAXXXXXXXXXXXPKVKRI---LNLYSLAEGPVFDTQNNELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIA 1488
            +++ +   L +F + +  +  ++     L IP   L    +E + +K +++ +E  V+ W +QI   L S Q +   G +  PL EI FW+ R A L ++  QL+ P V+ I   L LY+    P F     ++ +  ++A+ N  FLSL++   + +A  +    +   +  ++  +R+IW+ S ++N  +R+  L+ +I 
Sbjct:  129 SKNNYSAELHRFLTKLTDSRFKLLGSTVLYIPLEALQHRPEEAVKNKNLVQRLEMVVIHWTRQIKAVL-SAQSVSDIGDTLGPLEEISFWKSRCADLDSISTQLQKPGVRHIQEILQLYTSTYIPPFCKLAKQIQESSLQAQSNVTFLSLLKEPCEELAQ-LKPCEIAPKLAHILNLIRVIWVNSSYFNTRDRITALLRKIC 328          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Xenopus
Match: DNAH10 (dynein axonemal heavy chain 10 [Source:NCBI gene;Acc:100492440])

HSP 1 Score: 5559.19 bits (14420), Expect = 0.000e+0
Identity = 2770/4459 (62.12%), Postives = 3467/4459 (77.75%), Query Frame = 1
Query:  574 DTLCFFLVRTTDDMVVLPSNINEANSELPSYFESGTLKGDMLLLLSQLIHSVYDYMLSYHQHRVTSDLGMSRASTPASQGRIPKKSQSDGDKIESIDEKVHETRAAVQARDEFLISLKKFTSIVDQTIIQIASEVKLEIPDLDLFENDKENLSDKEIMEMIESTVLKWDQQITGTLESLQKIVPHGPSPLAEIDFWRERNAXXXXXXXXXXXPKVKRILNLYSLAEGPV---FDTQNNELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIAWNLSDRVARLIDVNTIFNLPLEHVLKDTAEAEKMLRVWNDTYFEVRASIEASGRDARWEFDRKRLFEKTNYMADICHDLNEIAMILQEFYNIFGPELKSVTNEAKRIXXXXXXXXXXXXPLKEMPFNPFNLMKHKYDWSNFMEDFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEVESIDQLFKTNMNNPPLYHFKSCVAGGISWERHLFYNIKRPILRFLTMDEMMQSDNGKRIRTKYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILALANSENFVSENVPEETIDKMDDDLR--VDFGFEINEIITETRNLELLGYKVPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISDYIEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFKLQS---GNKFLKCKEFFEFMESERTSDFEHLGRKYSTIGPLITKLQGEIIGDRDVNPFEKFQPFYEFWEKRIFDRVYNMVLKNLQDYQNMLRDENFPTCLFEVDLMLAGTDVIGNPQTTEIYKLAIQDLRDAVEATRVFIRWKRNSCIETTGMKIDGQDELFYFTFYLDIGNSVEITYFCEQIANYYRNIIGKLRKYQDKWKKHKRVFIPNKQAQIDKWLTKDPTVMDFYERIRDTIDRKEELLNQPVIRKIGFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDLSLIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSNHPIDQEEIEESDKLRQLFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTREGMNQDTIEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSENAKSDKDYAMTDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKRKKPYLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLTKPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTGKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGEPNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMGVGLVVEADLATTEHPSHWVLQGVCLILNTD 13926
            D++  + +R T + +  P+++ EAN  LP + E G L G+ LL+L Q+   V+  +LSY+ H+  +D G  +       G     ++S+G +     E   E R+    RDEFL++++KF + + QTI Q+  E++LE+PDL L     +   D+ I+E +E  V+ W  QI+  LE   +  P G  PLAEIDFWRERNA LSAL EQLKLP VK+IL++ S+A+  V    +   NEL K+H+EA DN +FLS +ERHFK++A+G  F  V D++P MM ALRM+WIISRHYNKDERMVPLMERIAW +++RV R++++ ++F    E     + +A+  L +W  +YFEVRA IEASGRD RWEFDRKRLFEKT+Y++ IC DL  I  +L+EF NIFGPELK+VT + KRI++VL++V+ LV+P++ + F+PFN+ K+   W   MEDF+ +V +IE +AI+FI+  F TLRSAE AFDMLL+F+HIRSR+AINK M  KFNDI+ QY KEV+ ++ LF  +++NPPLY     VAG I WER LFY IK  I+RFL M+EM+  + GK + TKYL V R M+ +E+K++  W+   D+ L  LL++++L           N  +   D  D D    V+F  E+ EIITET+++E +G+ V EL RNVALQ++ + +  + +  M+  Y  ++ SL   E+++L + I++V +  R G RRLNWNSLGI DYI +CN A+  FES V  I K   DI+ KL  I++A LFK  +   G      KEFFE+++ ER  D + L RKYSTIG L+TK++G ++ + +     K   +Y  WEKRI++ +  MVL+N Q +   +  +     LF+V+ +L+  ++I  P   EIYKL  Q  +  +E T+ F+RW   +CI+    K +  DE+   +FY DI  + +IT     I      I+  L KY ++WK+++ ++  +K   ++K+  + P+ + + E+++       E+  QP+I+ +  I + L  L   V+++ + W +   + L+ESA+  L  +K+++E     L   P  LE+LK +L TI  I+ +SL  E R  D+QERYR L++ N         E +++ Q+++ L  ESK V++ L  VK  FT ITK++I D+ K L NFA+ F+ EGPG++G +LD GL VL  F  EL   E  RQEL  AE+LF+LPIT YPEL  +QKEMK L QIYE+Y+AQK+A+E W++TLW NL++++L +GI+GFLK +RK+ ++++++  A  L  K+KEFK+++PL  DLK+EALR+RHWKELMTKTG +F++NP+TFTL ++FAMEL+++ D I++IV SA KELSIEKGV+E+ +TW  +KF+VQ Y+KG ++RG ILG +DE+LQILDDNAMNLQS+S SRF+GPFL +VQ WEK LSLI EV++VWMVVQRKWMYLE IFIGGDIRSQLP+EAKKFD ID+ FK+IM+ET K P+IK+ CQ  NRLSDL NLS+GLE+CQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSD  CVQEH+IKM+DNI+SL+F +G + EM ATAM+S+E E+M FR  V  EGRVEDWMT +  EMRRTNR+ITKEA+F Y E K RV WM  YQGMV L  NQ+WWTWEVEDVFRK+KKG+K ALK+YAK +H QIDE+V  +  PLSKNDR K  TVLIIDVHARDIVD FVRDSIMDA+EFEWESQLRFYW RE DE+ ++QCTG F YGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDY++VGKIF+GL QCGAWGCFDEFNRI+ SVLSVIS+Q++TI+N LI  L RF FEGQEI LD+R+GIFITMNPGYAGRTELPESVKA FRPVVVIVPDLQQICEIMLFS+GFL AK LAKKMT LY+L++EQLSKQ+HYDFGLRALKSVLVMAGEL+R  PDL+ED VLMRALRDMNLPKF+FED PLFLGLI DLFPGLDCPRVRYPDFND+VEE L E+ YI+L  Q DK+VQ+YETM TRHTTMVVGPTGGGKSVVI  LC +QTKL L TKL  +NPK  SVIELYGILDP TRDWTDG+LSNIFREINKPT+K ERRY+LFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQ HCALLFEVGDLQYASPATVSRCGMV+VDPKNL Y P+WQ W+N +++K E   L+ L++KY+P  I+ ++EG+ +G+  EKLKTI+P T+LN+VTQL  MLD  L +E  + D +E  FI+++YWSLG  L+E  ++KFD++IK L +M  + +E   A  GELP + PT++D++FD   EK++WIPW+ LVP+Y+H PE+KF +ILVPT+DT R TWLL + +KI+RPV+LVGE+GTSKTA +   LRN + D  + L+INFSSRTTS+DIQRNLE+NVEKRTKD+YGPPMGKRLLVF+DDMNMP+VD+YGTQQPIA+LKL+LE+ G YDRGK+LN K ++D+GF+AAMGK GGGRN+VD RFISLFSVFN  FPS+ SL  IYSSIL GH  +F++E++     +T  T+ +Y  I+  LPPTPSKFHYIFNLRDLSR+Y G+  TT +RF    Q  RVWR+E  RV  DRL+N++DK  VQ  I+  + E+ ++  ++A  DPILFGDYR A+   E R+YED+ +YEAAK LFQEI+EEY+E+ + M LVLFDDAL+HLTRIHR IRMD GHALLVGVGGSGKQSL +LAAY    ++FEI LSRGY E   RE+L+ LY KLG+ENK  +F+F D HV EEGFLELINNML+SG+VPALFPDDE+E+++SQ+R+EA+  G+GP+KESIWQ+FVNK A+NLHIVL MSPVG+TLRTRCRNFPG+VNNT IDWF PWP QALYAVA+ F+G +NSLIP      +  H VMVH SV ++SK+F QK RR NYVTPKNYLDFINTY +LLE+K+++  +QC RL+GGL KL EA+VQLAELN KLA QKV + EK+ ACE LL EI++ T IA EK+++A+EK+  +E Q+K I  EK EAE+AL EALP+LE A+L L  L+K+DV EIRSFAKPP+ VQVV ECI V + YKEI+WK AKGMM+DPSFL+SL  +D D IT  Q   VR  L  L  T +EM ++SKAG G+LKFV AV+GY DVA+EIKPKREKVA+LE+ +  +KR+LEK++ E+  +++ELK L ++YE AI E+Q+LQEE ++M+RRL AADKLI+GL SENKRW  DL+ LK ++V+LLGDCL+CSAFLSY GAF+W+FRKEMVY+ W+ D++ R+IP+S PFR+E +LT+DVEIS+W SEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWI +KEE NNLK ++FNDPDFLKQLE+AIKYG PFLF+DVDEYIDPVIDNVLEKNIKG QGR+F+ILGDKEVD+DPNF+LYLNTKLSNPKY P++FGK+MVINYTVTLKGLEDQLLSVIV FER+ELEEQRE LIQETS+NK+LLKDLEDSLLRELATSTGNMLDN EL++TLEETK+KA+EVSEKLKL  +T+ +IDK RDGYR AAKRGAILFFVL+EM+ +NSMYQYSLS++L VF  SL+KSLPDG L KRL+N+M TLT NVY YGCTG+FEKHKLLF+F +T+K+E   G + Q+ELDFF+KGN S+E +KRKKP  W+ D  W+D+ +L+E+ P  F  L  D+ER E  WK W + +T E    P  Y++KL  FQKL LLRCFR+DR+YRA++ YV   MGE+YV PP+++FE I +QS P SPIVFILSPGSDPASD++KLAERSGFG  +LKF++MGQGQE  A  LL+ A+ RG WL+LQNCHLLVKWL++LEK LE + KPHPDFRLWLTT+PT+ FPIGILQ+SLKVVTEPPNGLKLN+R+TY KI+  +L++  H+AF SLV+ LAFFHAVVQERRK+GKIGWN+PYDFNESDF+VC++IL TYL KA  Q D+KIPWGSLKYLIGEVMYGGRAID FDRRIL TYMDEY GDF+FDTFQ FHFY ++   Y IP+  T D  ++ IESLPL NTPEVFGLHSNAEIGYYT AA++MW+ L+++QPQTG+S +  SRDE I + A  I++KLP++FDLD++RK  GL+ISPT VVLLQELERFN L+ RM++SL  L RAL GEVGMS+ELD+VA++L+NGQIP IW+RLAPDTLKSL NW+ HF  R+ QY+ WV   EPNVMWLSGLHIPESYLTALVQATCRKNGWPLD+STLYT VT F T  EVTER  QGCF+ GLYLEGA WD +  CL++ KPK L+  LPV+KVIPIEAHRLK QNTF TPVY TS RRNAMGVGLV EADL TT+H SHWVLQGVCL LN+D
Sbjct:  118 DSIALYFLRNTQETIPEPNDLQEANDVLPMFLEYGILNGNSLLMLKQIFSQVFMPLLSYNHHK--NDNGSLQLEQVRQSGL---DTESNGPEANRHAETGLEFRSIQMIRDEFLMNMQKFLNHIQQTIQQLEGEIRLEMPDLTLDIESTQLALDQVIVEKLEQCVMNWQTQISVALEEQLQKKPQGNGPLAEIDFWRERNATLSALSEQLKLPLVKKILSVLSIADPGVVQNLELTVNELAKYHVEAADNVRFLSTLERHFKNLAHGTGFSVVLDTVPSMMNALRMVWIISRHYNKDERMVPLMERIAWEIAERVCRVLNIRSLFRENKEAAKNKSQDAKHTLELWKSSYFEVRAKIEASGRDQRWEFDRKRLFEKTDYLSSICQDLYNILQVLEEFCNIFGPELKAVTGDPKRIDDVLRRVDGLVRPMENLSFDPFNI-KNSQQWKMVMEDFKNEVHAIEGEAINFIDESFKTLRSAEAAFDMLLKFKHIRSREAINKQMMMKFNDILEQYAKEVDIVNSLFLKHLDNPPLYKNHPPVAGSIYWERSLFYRIKHTIVRFLEMEEMLSCERGKAV-TKYLEVARKMKEYEDKKYEMWKENTDQNLPSLLKRSLL-----------NADQNEADNGDTDFHFSVNFAPELWEIITETKHMEQMGFSVGELPRNVALQEDKFLRYTDDMKHMIAAYEKLMGSLSEAEIQLLDEHIRDVWKVFRSGYRRLNWNSLGIGDYITRCNQAISKFESLVNKIQKNAKDIDLKLSAIESANLFKFMAKTTGTDLSGVKEFFEYIDIERAKDVDILERKYSTIGQLLTKIEGLVV-NTNTGKHPKMSQYYAHWEKRIYNSLTKMVLRNFQVFNTAILGD---VPLFQVETILSAPEIILQPNGNEIYKLTAQCYKGCMETTKRFVRWMNGTCIQCPPQKTE-DDEVVIISFYNDIYLNHQITEQARIINQNMHRILTSLTKYLNRWKRYRPLWKLDKAIVMEKFAARRPSCVAYDEKLQFYSKISLEVTQQPLIKDVQCIRLYLGPLAYTVQENARAWVNSLGHLLNESAREELYKLKDELESLSAQLKTTPETLEDLKFVLGTIANIRDISLTVEMRYRDIQERYRTLSMYNI--------EVNRIPQIWEELFQESKLVDHSLGKVKNSFTQITKDQIEDYKKKLSNFAELFQTEGPGAVGDNLDKGLQVLSAFEKELAKYEKDRQELANAEKLFDLPITMYPELIQIQKEMKGLQQIYEIYNAQKQAKEEWSQTLWANLNVQILLDGIDGFLKAFRKLSKDIRSLPVAFYLESKMKEFKESIPLLLDLKNEALRDRHWKELMTKTGTDFEMNPETFTLENMFAMELHKYADAISDIVASAVKELSIEKGVKEILDTWENMKFTVQRYIKGTQDRGSILGTVDEILQILDDNAMNLQSISGSRFVGPFLNTVQQWEKTLSLIGEVIEVWMVVQRKWMYLESIFIGGDIRSQLPDEAKKFDNIDRIFKRIMSETVKDPVIKRCCQASNRLSDLQNLSEGLERCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDPTCVQEHIIKMYDNIASLKFQEGDNGEMKATAMVSAEGEVMPFRQVVAAEGRVEDWMTTVLQEMRRTNRLITKEAIFRYCEDKSRVDWMLLYQGMVVLAGNQVWWTWEVEDVFRKVKKGEKQALKNYAKKMHQQIDELVTRITKPLSKNDRKKYNTVLIIDVHARDIVDIFVRDSIMDAREFEWESQLRFYWDREPDELNVRQCTGTFAYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDYKAVGKIFSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALIHHLKRFQFEGQEIALDARMGIFITMNPGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLQAKNLAKKMTVLYKLAREQLSKQHHYDFGLRALKSVLVMAGELKRGSPDLNEDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRVRYPDFNDAVEEALQENNYILLPTQVDKVVQMYETMLTRHTTMVVGPTGGGKSVVINTLCLAQTKLGLVTKLYTLNPKAMSVIELYGILDPATRDWTDGVLSNIFREINKPTEKKERRYILFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQPHCALLFEVGDLQYASPATVSRCGMVFVDPKNLKYMPYWQKWVNNRQSKQEQSVLSKLFEKYVPHCIEMIVEGITDGKQGEKLKTIVPQTDLNMVTQLSTMLDALLEKEVDDADVLECYFIEAMYWSLGATLLETGRIKFDEYIKRLASMSAAYDESILAGPGELPYQQPTIYDFHFDG--EKKKWIPWSKLVPKYIHKPEEKFIDILVPTVDTTRTTWLLEQMVKIKRPVVLVGESGTSKTATTLNLLRNLNTD--MLLSINFSSRTTSMDIQRNLEANVEKRTKDNYGPPMGKRLLVFMDDMNMPKVDEYGTQQPIALLKLLLEKGGMYDRGKELNCKYLRDLGFIAAMGKAGGGRNEVDTRFISLFSVFNVLFPSEESLSLIYSSILKGHTALFNEEVQAICDKLTFCTLELYKMIVRDLPPTPSKFHYIFNLRDLSRVYNGLVLTTPERFQTVAQMVRVWRNENLRVFHDRLVNEEDK-LVQGHIKHLIEEHFQASLEHATRDPILFGDYRTAMSEGEPRVYEDIQDYEAAKALFQEILEEYNESKTKMNLVLFDDALEHLTRIHRIIRMDRGHALLVGVGGSGKQSLARLAAYAAGYEVFEIVLSRGYGENSFREDLRNLYIKLGLENKKMIFLFTDAHVAEEGFLELINNMLTSGMVPALFPDDEKESVLSQIRDEATKHGVGPAKESIWQFFVNKSANNLHIVLGMSPVGDTLRTRCRNFPGLVNNTGIDWFLPWPPQALYAVANSFLG-DNSLIPSQHSEPVTGHVVMVHDSVGKFSKKFQQKLRRSNYVTPKNYLDFINTYSRLLEEKNQYNLAQCKRLEGGLDKLKEATVQLAELNVKLAEQKVVLAEKSSACEALLDEISTNTTIAEEKRKLAEEKAAEIEEQNKVIAVEKQEAESALAEALPILEAAKLELQKLDKSDVTEIRSFAKPPRAVQVVCECILVMRGYKEISWKSAKGMMSDPSFLKSLMEIDFDAITQHQVKAVRGFLKTLNTTFEEMEAISKAGLGMLKFVEAVMGYCDVAKEIKPKREKVAKLERNYYMSKRDLEKIQAELSTIQNELKALGEKYEAAITEKQKLQEEAEVMERRLIAADKLISGLGSENKRWTNDLEELKVRRVKLLGDCLLCSAFLSYEGAFNWDFRKEMVYTEWQQDILAREIPLSQPFRIESLLTDDVEISRWGSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIKRKEEKNNLKISSFNDPDFLKQLEMAIKYGFPFLFQDVDEYIDPVIDNVLEKNIKGAQGRQFIILGDKEVDYDPNFKLYLNTKLSNPKYSPSVFGKAMVINYTVTLKGLEDQLLSVIVGFERRELEEQRENLIQETSENKKLLKDLEDSLLRELATSTGNMLDNVELVHTLEETKAKATEVSEKLKLAEKTAVDIDKLRDGYRPAAKRGAILFFVLSEMALVNSMYQYSLSSFLAVFDHSLRKSLPDGILMKRLKNIMDTLTYNVYNYGCTGLFEKHKLLFSFNMTVKIEQADGRVPQEELDFFLKGNISLEKSKRKKPCSWIPDQGWEDIIRLSELFPSMFGSLPSDVERCEAEWKAWYDLDTLEQYPYPLGYNDKLSDFQKLLLLRCFRVDRVYRAVSDYVTVTMGEKYVQPPVISFEAIFEQSVPTSPIVFILSPGSDPASDLMKLAERSGFGGNRLKFLAMGQGQEKVALQLLETAVFRGQWLMLQNCHLLVKWLKDLEKALEMIKKPHPDFRLWLTTDPTKEFPIGILQKSLKVVTEPPNGLKLNMRATYFKISHEALDSCQHSAFKSLVYVLAFFHAVVQERRKFGKIGWNVPYDFNESDFQVCMEILNTYLTKAFQQHDTKIPWGSLKYLIGEVMYGGRAIDSFDRRILTTYMDEYLGDFIFDTFQLFHFYKNEEVDYRIPEGTTKDAFVEAIESLPLANTPEVFGLHSNAEIGYYTQAARDMWTHLLELQPQTGESSTGISRDEYIGQVAKDIENKLPQIFDLDQIRKNLGLEISPTTVVLLQELERFNKLIIRMSRSLVELQRALAGEVGMSSELDEVARALFNGQIPNIWRRLAPDTLKSLGNWMIHFRRRFNQYTSWVNESEPNVMWLSGLHIPESYLTALVQATCRKNGWPLDRSTLYTQVTSFRTPEEVTERPGQGCFISGLYLEGADWDIANSCLIKSKPKVLVVELPVLKVIPIEAHRLKLQNTFRTPVYTTSMRRNAMGVGLVFEADLYTTKHNSHWVLQGVCLTLNSD 4539          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Xenopus
Match: DNAH10 (dynein axonemal heavy chain 10 [Source:NCBI gene;Acc:100492440])

HSP 1 Score: 5423.6 bits (14068), Expect = 0.000e+0
Identity = 2722/4461 (61.02%), Postives = 3407/4461 (76.37%), Query Frame = 1
Query:  574 DTLCFFLVRTTDDMVVLPSNINEANSELPSYFESGTLKGDMLLLLSQLIHSVYDYMLSYHQHRVTSDLGMSRASTPASQGRIPKKSQSDGDKIESIDEKVHETRAAVQARDEFLISLKKFTSIVDQTIIQIASEVKLEIPDLDLFENDKENLSDKEIMEMIESTVLKWDQQITGTLESLQKIVPHGPSPLAEIDFWRERNAXXXXXXXXXXXPKVKRILNLYSLAEGPV---FDTQNNELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIAWNLSDRVARLIDVNTIFNLPLEHVLKDTAEAEKMLRVWNDTYFEVRASIEASGRDARWEFDRKRLFEKTNYMADICHDLNEIAMILQEFYNIFGPELKSVTNEAKRIXXXXXXXXXXXXPLKEMPFNPFNLMKHKYDWSNFMEDFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEV--ESIDQLFKTNMNNPPLYHFKSCVAGGISWERHLFYNIKRPILRFLTMDEMMQSDNGKRIRTKYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILALANSENFVSENVPEETIDKMDDDLR--VDFGFEINEIITETRNLELLGYKVPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISDYIEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFKLQS---GNKFLKCKEFFEFMESERTSDFEHLGRKYSTIGPLITKLQGEIIGDRDVNPFEKFQPFYEFWEKRIFDRVYNMVLKNLQDYQNMLRDENFPTCLFEVDLMLAGTDVIGNPQTTEIYKLAIQDLRDAVEATRVFIRWKRNSCIETTGMKIDGQDELFYFTFYLDIGNSVEITYFCEQIANYYRNIIGKLRKYQDKWKKHKRVFIPNKQAQIDKWLTKDPTVMDFYERIRDTIDRKEELLNQPVIRKIGFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDLSLIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSNHPIDQEEIEESDKLRQLFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTREGMNQDTIEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSENAKSDKDYAMTDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKRKKPYLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLTKPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTGKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGEPNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMGVGLVVEADLATTEHPSHWVLQGVCLILNTD 13926
            D++  + +R T + +  P+++ EAN  LP + E G L G+ LL+L Q+   V+  +LSY+ H+  +D G  +       G     ++S+G +     E   E R+    RDEFL++++KF + + QTI Q+  E++LE+PDL L     +   D+ I+E +E  V+ W  QI+  LE   +  P G  PLAEIDFWRERNA LSAL EQLKLP VK+IL++ S+A+  V    +   NEL K+H+EA DN +FLS +ERHFK++A+G  F  V D++P MM ALRM+WIISRHYNKDERMVPLMERIAW +++RV R++++ ++F    E     + +A+  L +W  +YFEVRA IEASGRD RWEFDRKRLFEKT+Y++ IC DL  I  +L+EF NIFGPEL                                                  K V+ + + ID +      LR  +G    L+R     S    N   +Q++  +M  ++ EV  + ++ LF  +++NPPLY     VAG I WER LFY IK  I+RFL M+EM+  + GK + TKYL V R M+ +E+K++  W+   D+ L  LL++++L           N  +   D  D D    V+F  E+ EIITET+++E +G+ V EL RNVALQ++ + +  + +  M+  Y  ++ SL   E+++L + I++V +  R G RRLNWNSLGI DYI +CN A+  FES V  I K   DI+ KL  I++A LFK  +   G      KEFFE+++ ER  D + L RKYSTIG L+TK++G ++ + +     K   +Y  WEKRI++ +  MVL+N Q +   +  +     LF+V+ +L+  ++I  P   EIYKL  Q  +  +E T+ F+RW   +CI+    K +  DE+   +FY DI  + +IT     I      I+  L KY ++WK+++ ++  +K   ++K+  + P+ + + E+++       E+  QP+I+ +  I + L  L   V+++ + W +   + L+ESA+  L  +K+++E     L   P  LE+LK +L TI  I+ +SL  E R  D+QERYR L++ N         E +++ Q+++ L  ESK V++ L  VK  FT ITK++I D+ K L NFA+ F+ EGPG++G +LD GL VL  F  EL   E  RQEL  AE+LF+LPIT YPEL  +QKEMK L QIYE+Y+AQK+A+E W++TLW NL++++L +GI+GFLK +RK+ ++++++  A  L  K+KEFK+++PL  DLK+EALR+RHWKELMTKTG +F++NP+TFTL ++FAMEL+++ D I++IV SA KELSIEKGV+E+ +TW  +KF+VQ Y+KG ++RG ILG +DE+LQILDDNAMNLQS+S SRF+GPFL +VQ WEK LSLI EV++VWMVVQRKWMYLE IFIGGDIRSQLP+EAKKFD ID+ FK+IM+ET K P+IK+ CQ  NRLSDL NLS+GLE+CQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSD  CVQEH+IKM+DNI+SL+F +G + EM ATAM+S+E E+M FR  V  EGRVEDWMT +  EMRRTNR+ITKEA+F Y E K RV WM  YQGMV L  NQ+WWTWEVEDVFRK+KKG+K ALK+YAK +H QIDE+V  +  PLSKNDR K  TVLIIDVHARDIVD FVRDSIMDA+EFEWESQLRFYW RE DE+ ++QCTG F YGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDY++VGKIF+GL QCGAWGCFDEFNRI+ SVLSVIS+Q++TI+N LI  L RF FEGQEI LD+R+GIFITMNPGYAGRTELPESVKA FRPVVVIVPDLQQICEIMLFS+GFL AK LAKKMT LY+L++EQLSKQ+HYDFGLRALKSVLVMAGEL+R  PDL+ED VLMRALRDMNLPKF+FED PLFLGLI DLFPGLDCPRVRYPDFND+VEE L E+ YI+L  Q DK+VQ+YETM TRHTTMVVGPTGGGKSVVI  LC +QTKL L TKL  +NPK  SVIELYGILDP TRDWTDG+LSNIFREINKPT+K ERRY+LFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQ HCALLFEVGDLQYASPATVSRCGMV+VDPKNL Y P+WQ W+N +++K E   L+ L++KY+P  I+ ++EG+ +G+  EKLKTI+P T+LN+VTQL  MLD  L +E  + D +E  FI+++YWSLG  L+E  ++KFD++IK L +M  + +E   A  GELP + PT++D++FD   EK++WIPW+ LVP+Y+H PE+KF +ILVPT+DT R TWLL + +KI+RPV+LVGE+GTSKTA +   LRN + D  + L+INFSSRTTS+DIQRNLE+NVEKRTKD+YGPPMGKRLLVF+DDMNMP+VD+YGTQQPIA+LKL+LE+ G YDRGK+LN K ++D+GF+AAMGK GGGRN+VD RFISLFSVFN  FPS+ SL  IYSSIL GH  +F++E++     +T  T+ +Y  I+  LPPTPSKFHYIFNLRDLSR+Y G+  TT +RF    Q  RVWR+E  RV  DRL+N++DK  VQ  I+  + E+ ++  ++A  DPILFGDYR A+   E R+YED+ +YEAAK LFQEI+EEY+E+ + M LVLFDDAL+HLTRIHR IRMD GHALLVGVGGSGKQSL +LAAY    ++FEI LSRGY E   RE+L+ LY KLG+ENK  +F+F D HV EEGFLELINNML+SG+VPALFPDDE+E+++SQ+R+EA+  G+GP+KESIWQ+FVNK A+NLHIVL MSPVG+TLRTRCRNFPG+VNNT IDWF PWP QALYAVA+ F+G +NSLIP      +  H VMVH SV ++SK+F QK RR NYVTPKNYLDFINTY +LLE+K+++  +QC RL+GGL KL EA+VQLAELN KLA QKV + EK+ ACE LL EI++ T IA EK+++A+EK+  +E Q+K I  EK EAE+AL EALP+LE A+L L  L+K+DV EIRSFAKPP+ VQVV ECI V + YKEI+WK AKGMM+DPSFL+SL  +D D IT  Q   VR  L  L  T +EM ++SKAG G+LKFV AV+GY DVA+EIKPKREKVA+LE+ +  +KR+LEK++ E+  +++ELK L ++YE AI E+Q+LQEE ++M+RRL AADKLI+GL SENKRW  DL+ LK ++V+LLGDCL+CSAFLSY GAF+W+FRKEMVY+ W+ D++ R+IP+S PFR+E +LT+DVEIS+W SEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWI +KEE NNLK ++FNDPDFLKQLE+AIKYG PFLF+DVDEYIDPVIDNVLEKNIKG QGR+F+ILGDKEVD+DPNF+LYLNTKLSNPKY P++FGK+MVINYTVTLKGLEDQLLSVIV FER+ELEEQRE LIQETS+NK+LLKDLEDSLLRELATSTGNMLDN EL++TLEETK+KA+EVSEKLKL  +T+ +IDK RDGYR AAKRGAILFFVL+EM+ +NSMYQYSLS++L VF  SL+KSLPDG L KRL+N+M TLT NVY YGCTG+FEKHKLLF+F +T+K+E   G + Q+ELDFF+KGN S+E +KRKKP  W+ D  W+D+ +L+E+ P  F  L  D+ER E  WK W + +T E    P  Y++KL  FQKL LLRCFR+DR+YRA++ YV   MGE+YV PP+++FE I +QS P SPIVFILSPGSDPASD++KLAERSGFG  +LKF++MGQGQE  A  LL+ A+ RG WL+LQNCHLLVKWL++LEK LE + KPHPDFRLWLTT+PT+ FPIGILQ+SLKVVTEPPNGLKLN+R+TY KI+  +L++  H+AF SLV+ LAFFHAVVQERRK+GKIGWN+PYDFNESDF+VC++IL TYL KA  Q D+KIPWGSLKYLIGEVMYGGRAID FDRRIL TYMDEY GDF+FDTFQ FHFY ++   Y IP+  T D  ++ IESLPL NTPEVFGLHSNAEIGYYT AA++MW+ L+++QPQTG+S +  SRDE I + A  I++KLP++FDLD++RK  GL+ISPT VVLLQELERFN L+ RM++SL  L RAL GEVGMS+ELD+VA++L+NGQIP IW+RLAPDTLKSL NW+ HF  R+ QY+ WV   EPNVMWLSGLHIPESYLTALVQATCRKNGWPLD+STLYT VT F T  EVTER  QGCF+ GLYLEGA WD +  CL++ KPK L+  LPV+KVIPIEAHRLK QNTF TPVY TS RRNAMGVGLV EADL TT+H SHWVLQGVCL LN+D
Sbjct:  118 DSIALYFLRNTQETIPEPNDLQEANDVLPMFLEYGILNGNSLLMLKQIFSQVFMPLLSYNHHK--NDNGSLQLEQVRQSGL---DTESNGPEANRHAETGLEFRSIQMIRDEFLMNMQKFLNHIQQTIQQLEGEIRLEMPDLTLDIESTQLALDQVIVEKLEQCVMNWQTQISVALEEQLQKKPQGNGPLAEIDFWRERNATLSALSEQLKLPLVKKILSVLSIADPGVVQNLELTVNELAKYHVEAADNVRFLSTLERHFKNLAHGTGFSVVLDTVPSMMNALRMVWIISRHYNKDERMVPLMERIAWEIAERVCRVLNIRSLFRENKEAAKNKSQDAKHTLELWKSSYFEVRAKIEASGRDQRWEFDRKRLFEKTDYLSSICQDLYNILQVLEEFCNIFGPEL--------------------------------------------------KAVTGDPKRIDDV------LRRVDG----LVRPMENLSFDPFNIKNSQQWKMVMEDFKNEVHVDIVNSLFLKHLDNPPLYKNHPPVAGSIYWERSLFYRIKHTIVRFLEMEEMLSCERGKAV-TKYLEVARKMKEYEDKKYEMWKENTDQNLPSLLKRSLL-----------NADQNEADNGDTDFHFSVNFAPELWEIITETKHMEQMGFSVGELPRNVALQEDKFLRYTDDMKHMIAAYEKLMGSLSEAEIQLLDEHIRDVWKVFRSGYRRLNWNSLGIGDYITRCNQAISKFESLVNKIQKNAKDIDLKLSAIESANLFKFMAKTTGTDLSGVKEFFEYIDIERAKDVDILERKYSTIGQLLTKIEGLVV-NTNTGKHPKMSQYYAHWEKRIYNSLTKMVLRNFQVFNTAILGD---VPLFQVETILSAPEIILQPNGNEIYKLTAQCYKGCMETTKRFVRWMNGTCIQCPPQKTE-DDEVVIISFYNDIYLNHQITEQARIINQNMHRILTSLTKYLNRWKRYRPLWKLDKAIVMEKFAARRPSCVAYDEKLQFYSKISLEVTQQPLIKDVQCIRLYLGPLAYTVQENARAWVNSLGHLLNESAREELYKLKDELESLSAQLKTTPETLEDLKFVLGTIANIRDISLTVEMRYRDIQERYRTLSMYNI--------EVNRIPQIWEELFQESKLVDHSLGKVKNSFTQITKDQIEDYKKKLSNFAELFQTEGPGAVGDNLDKGLQVLSAFEKELAKYEKDRQELANAEKLFDLPITMYPELIQIQKEMKGLQQIYEIYNAQKQAKEEWSQTLWANLNVQILLDGIDGFLKAFRKLSKDIRSLPVAFYLESKMKEFKESIPLLLDLKNEALRDRHWKELMTKTGTDFEMNPETFTLENMFAMELHKYADAISDIVASAVKELSIEKGVKEILDTWENMKFTVQRYIKGTQDRGSILGTVDEILQILDDNAMNLQSISGSRFVGPFLNTVQQWEKTLSLIGEVIEVWMVVQRKWMYLESIFIGGDIRSQLPDEAKKFDNIDRIFKRIMSETVKDPVIKRCCQASNRLSDLQNLSEGLERCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDPTCVQEHIIKMYDNIASLKFQEGDNGEMKATAMVSAEGEVMPFRQVVAAEGRVEDWMTTVLQEMRRTNRLITKEAIFRYCEDKSRVDWMLLYQGMVVLAGNQVWWTWEVEDVFRKVKKGEKQALKNYAKKMHQQIDELVTRITKPLSKNDRKKYNTVLIIDVHARDIVDIFVRDSIMDAREFEWESQLRFYWDREPDELNVRQCTGTFAYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDYKAVGKIFSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALIHHLKRFQFEGQEIALDARMGIFITMNPGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLQAKNLAKKMTVLYKLAREQLSKQHHYDFGLRALKSVLVMAGELKRGSPDLNEDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRVRYPDFNDAVEEALQENNYILLPTQVDKVVQMYETMLTRHTTMVVGPTGGGKSVVINTLCLAQTKLGLVTKLYTLNPKAMSVIELYGILDPATRDWTDGVLSNIFREINKPTEKKERRYILFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQPHCALLFEVGDLQYASPATVSRCGMVFVDPKNLKYMPYWQKWVNNRQSKQEQSVLSKLFEKYVPHCIEMIVEGITDGKQGEKLKTIVPQTDLNMVTQLSTMLDALLEKEVDDADVLECYFIEAMYWSLGATLLETGRIKFDEYIKRLASMSAAYDESILAGPGELPYQQPTIYDFHFDG--EKKKWIPWSKLVPKYIHKPEEKFIDILVPTVDTTRTTWLLEQMVKIKRPVVLVGESGTSKTATTLNLLRNLNTD--MLLSINFSSRTTSMDIQRNLEANVEKRTKDNYGPPMGKRLLVFMDDMNMPKVDEYGTQQPIALLKLLLEKGGMYDRGKELNCKYLRDLGFIAAMGKAGGGRNEVDTRFISLFSVFNVLFPSEESLSLIYSSILKGHTALFNEEVQAICDKLTFCTLELYKMIVRDLPPTPSKFHYIFNLRDLSRVYNGLVLTTPERFQTVAQMVRVWRNENLRVFHDRLVNEEDK-LVQGHIKHLIEEHFQASLEHATRDPILFGDYRTAMSEGEPRVYEDIQDYEAAKALFQEILEEYNESKTKMNLVLFDDALEHLTRIHRIIRMDRGHALLVGVGGSGKQSLARLAAYAAGYEVFEIVLSRGYGENSFREDLRNLYIKLGLENKKMIFLFTDAHVAEEGFLELINNMLTSGMVPALFPDDEKESVLSQIRDEATKHGVGPAKESIWQFFVNKSANNLHIVLGMSPVGDTLRTRCRNFPGLVNNTGIDWFLPWPPQALYAVANSFLG-DNSLIPSQHSEPVTGHVVMVHDSVGKFSKKFQQKLRRSNYVTPKNYLDFINTYSRLLEEKNQYNLAQCKRLEGGLDKLKEATVQLAELNVKLAEQKVVLAEKSSACEALLDEISTNTTIAEEKRKLAEEKAAEIEEQNKVIAVEKQEAESALAEALPILEAAKLELQKLDKSDVTEIRSFAKPPRAVQVVCECILVMRGYKEISWKSAKGMMSDPSFLKSLMEIDFDAITQHQVKAVRGFLKTLNTTFEEMEAISKAGLGMLKFVEAVMGYCDVAKEIKPKREKVAKLERNYYMSKRDLEKIQAELSTIQNELKALGEKYEAAITEKQKLQEEAEVMERRLIAADKLISGLGSENKRWTNDLEELKVRRVKLLGDCLLCSAFLSYEGAFNWDFRKEMVYTEWQQDILAREIPLSQPFRIESLLTDDVEISRWGSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIKRKEEKNNLKISSFNDPDFLKQLEMAIKYGFPFLFQDVDEYIDPVIDNVLEKNIKGAQGRQFIILGDKEVDYDPNFKLYLNTKLSNPKYSPSVFGKAMVINYTVTLKGLEDQLLSVIVGFERRELEEQRENLIQETSENKKLLKDLEDSLLRELATSTGNMLDNVELVHTLEETKAKATEVSEKLKLAEKTAVDIDKLRDGYRPAAKRGAILFFVLSEMALVNSMYQYSLSSFLAVFDHSLRKSLPDGILMKRLKNIMDTLTYNVYNYGCTGLFEKHKLLFSFNMTVKIEQADGRVPQEELDFFLKGNISLEKSKRKKPCSWIPDQGWEDIIRLSELFPSMFGSLPSDVERCEAEWKAWYDLDTLEQYPYPLGYNDKLSDFQKLLLLRCFRVDRVYRAVSDYVTVTMGEKYVQPPVISFEAIFEQSVPTSPIVFILSPGSDPASDLMKLAERSGFGGNRLKFLAMGQGQEKVALQLLETAVFRGQWLMLQNCHLLVKWLKDLEKALEMIKKPHPDFRLWLTTDPTKEFPIGILQKSLKVVTEPPNGLKLNMRATYFKISHEALDSCQHSAFKSLVYVLAFFHAVVQERRKFGKIGWNVPYDFNESDFQVCMEILNTYLTKAFQQHDTKIPWGSLKYLIGEVMYGGRAIDSFDRRILTTYMDEYLGDFIFDTFQLFHFYKNEEVDYRIPEGTTKDAFVEAIESLPLANTPEVFGLHSNAEIGYYTQAARDMWTHLLELQPQTGESSTGISRDEYIGQVAKDIENKLPQIFDLDQIRKNLGLEISPTTVVLLQELERFNKLIIRMSRSLVELQRALAGEVGMSSELDEVARALFNGQIPNIWRRLAPDTLKSLGNWMIHFRRRFNQYTSWVNESEPNVMWLSGLHIPESYLTALVQATCRKNGWPLDRSTLYTQVTSFRTPEEVTERPGQGCFISGLYLEGADWDIANSCLIKSKPKVLVVELPVLKVIPIEAHRLKLQNTFRTPVYTTSMRRNAMGVGLVFEADLYTTKHNSHWVLQGVCLTLNSD 4482          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Xenopus
Match: DNAH10 (dynein axonemal heavy chain 10 [Source:NCBI gene;Acc:100492440])

HSP 1 Score: 5351.95 bits (13882), Expect = 0.000e+0
Identity = 2696/4442 (60.69%), Postives = 3372/4442 (75.91%), Query Frame = 1
Query:  616 VVLPSNINEANSELPSYFESGTLKGDMLLLLSQLIHSVYDYMLSYHQHRVTSDLGMSRASTPASQGRIPKKSQSDGDKIESIDEKVHETRAAVQARDEFLISLKKFTSIVDQTIIQIASEVKLEIPDLDLFENDKENLSDKEIMEMIESTVLKWDQQITGTLESLQKIVPHGPSPLAEIDFWRERNAXXXXXXXXXXXPKVKRILNLYSLAEGPV---FDTQNNELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIAWNLSDRVARLIDVNTIFNLPLEHVLKDTAEAEKMLRVWNDTYFEVRASIEASGRDARWEFDRKRLFEKTNYMADICHDLNEIAMILQEFYNIFGPELKSVTNEAKRIXXXXXXXXXXXXPLKEMPFNPFNLMKHKYDWSNFMEDFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEV--ESIDQLFKTNMNNPPLYHFKSCVAGGISWERHLFYNIKRPILRFLTMDEMMQSDNGKRIRTKYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILALANSENFVSENVPEETIDKMDDDLRVDFGFEINEIITETRNLELLGYKVPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISDYIEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFKLQSGNKFLKCKEFFEFMESERTSDFEHLGRKYSTIGPLITKLQGEIIGDRDVNPFEKFQPFYEFWEKRIFDRVYNMVLKNLQDYQNMLRDENFPTCLFEVDLMLAGTDVIGNPQTTEIYKLAIQDLRDAVEATRVFIRWKRNSCIETTGMKIDGQDELFYFTFYLDIGNSVEITYFCEQIANYYRNIIGKLRKYQDKWKKHKRVFIPNKQAQIDKWLTKDPTVMDFYERIRDTIDRKEELLNQPVIRKIGFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDLSLIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSNHPIDQEEIEESDKLRQLFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTREGMNQDTIEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSENAKSDKDYAMTDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKRKKPYLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLTKPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTGKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGEPNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMGVGLVVEADLATTEHPSHWVLQGVCLILNTD 13926
            V LP+++ EAN  LP + E G L G+ LL+L Q+   V+  +LSY+ H+  +D G  +       G     ++S+G +     E   E R+    RDEFL++++KF + + QTI Q+  E++LE+PDL L     +   D+ I+E +E  V+ W  QI+  LE   +  P G  PLAEIDFWRERNA LSAL EQLKLP VK+IL++ S+A+  V    +   NEL K+H+EA DN +FLS +ERHFK++A+G  F  V D++P MM ALRM+WIISRHYNKDERMVPLMERIAW +++RV R++++ ++F    E     + +A+  L +W  +YFEVRA IEASGRD RWEFDRKRLFEKT+Y++ IC DL  I  +L+EF NIFGPEL                                                  K V+ + + ID +      LR  +G    L+R     S    N   +Q++  +M  ++ EV  + ++ LF  +++NPPLY     VAG I WER LFY IK  I+RFL M+EM+  + GK  + KYL V R M+ +E+K++  W+   D+ L  LL++++L    S +              D    V+F  E+ EIITET+++E +G+ V EL RNVALQ++ + +  + +  M+  Y  ++ SL   E+++L + I++V +  R G RRLNWNSLG               ES V+  ++  +             LF   S  +F + KEFFE+++ ER  D + L RKYSTIG L+TK++G ++ + +     K   +Y  WEKRI++ +  MVL+N Q +   +  +     LF+V+ +L+  ++I  P   EIYKL  Q  +  +E T+ F+RW   +CI+    K +  DE+   +FY DI  + +IT     I      I+  L KY ++WK+++ ++  +K   ++K+  + P+ + + E+++       E+  QP+I+ +  I + L  L   V+++ + W +   + L+ESA+  L  +K+++E     L   P  LE+LK +L TI  I+ +SL  E R  D+QERYR L++ N       IE S     L+ +  F + N+         +  DITK++I D+ K L NFA+ F+ EGPG++G +LD GL VL  F  EL   E  RQEL  AE+LF+LPIT YPEL  +QKEMK L QIYE+Y+AQK ++E W++TLW NL++++L +GI+GFLK +RK+ ++++++  A  L  K+KEFK+++PL  DLK+EALR+RHWKELMTKTG +F++NP+TFTL ++FAMEL+++ D I++IV SA KELSIEKGV+E+ +TW  +KF+VQ Y+KG ++RG ILG +DE+LQILDDNAMNLQS+S SRF+GPFL +VQ WEK LSLI EV++VWMVVQRKWMYLE IFIGGDIRSQLP+EAKKFD ID+ FK+IM+ET K P+IK+ CQ  NRLSDL NLS+GLE+CQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSD  CVQEH+IKM+DNI+SL+F +G + EM ATAM+S+E E+M FR  V  EGRVEDWMT +  EMRRTNR+ITKEA+F Y E K RV WM  YQGMV L  NQ+WWTWEVEDVFRK+KKG+K ALK+YAK +H QIDE+V  +  PLSKNDR K  TVLIIDVHARDIVD FVRDSIMDA+EFEWESQLRFYW RE DE+ ++QCTG F YGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDY++VGKIF+GL QCGAWGCFDEFNRI+ SVLSVIS+Q++TI+N LI  L RF FEGQEI LD+R+GIFITMNPGYAGRTELPESVKA FRPVVVIVPDLQQICEIMLFS+GFL AK LAKKMT LY+L++EQLSKQ+HYDFGLRALKSVLVMAGEL+R  PDL+ED VLMRALRDMNLPKF+FED PLFLGLI DLFPGLDCPRVRYPDFND+VEE L E+ YI+L  Q DK+VQ+YETM TRHTTMVVGPTGGGKSVVI  LC +QTKL L TKL  +NPK  SVIELYGILDP TRDWTDG+LSNIFREINKPT+K ERRY+LFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQ HCALLFEVGDLQYASPATVSRCGMV+VDPKNL Y P+WQ W+N +++K E   L+ L++KY+P  I+ ++EG+ +G+  EKLKTI+P T+LN+VTQL  MLD  L +E  + D +E  FI+++YWSLG  L+E  ++KFD++IK L +M  + +E   A  GELP + PT++D++FD   EK++WIPW+ LVP+Y+H PE+KF +ILVPT+DT R TWLL + +KI+RPV+LVGE+GTSKTA +   LRN + D  + L+INFSSRTTS+DIQRNLE+NVEKRTKD+YGPPMGKRLLVF+DDMNMP+VD+YGTQQPIA+LKL+LE+ G YDRGK+LN K ++D+GF+AAMGK GGGRN+VD RFISLFSVFN  FPS+ SL  IYSSIL GH  +F++E++     +T  T+ +Y  I+  LPPTPSKFHYIFNLRDLSR+Y G+  TT +RF    Q  RVWR+E  RV  DRL+N++DK  VQ  I+  + E+ ++  ++A  DPILFGDYR A+   E R+YED+ +YEAAK LFQEI+EEY+E+ + M LVLFDDAL+HLTRIHR IRMD GHALLVGVGGSGKQSL +LAAY    ++FEI LSRGY E   RE+L+ LY KLG+ENK  +F+F D HV EEGFLELINNML+SG+VPALFPDDE+E+++SQ+R+EA+  G+GP+KESIWQ+FVNK A+NLHIVL MSPVG+TLRTRCRNFPG+VNNT IDWF PWP QALYAVA+ F+G +NSLIP      +  H VMVH SV ++SK+F QK RR NYVTPKNYLDFINTY +LLE+K+++  +QC RL+GGL KL EA+VQLAELN KLA QKV + EK+ ACE LL EI++ T IA EK+++A+EK+  +E Q+K I  EK EAE+AL EALP+LE A+L L  L+K+DV EIRSFAKPP+ VQVV ECI V + YKEI+WK AKGMM+DPSFL+SL  +D D IT  Q   VR  L  L  T +EM ++SKAG G+LKFV AV+GY DVA+EIKPKREKVA+LE+ +  +KR+LEK++ E+  +++ELK L ++YE AI E+Q+LQEE ++M+RRL AADKLI+GL SENKRW  DL+ LK ++V+LLGDCL+CSAFLSY GAF+W+FRKEMVY+ W+ D++ R+IP+S PFR+E +LT+DVEIS+W SEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWI +KEE NNLK ++FNDPDFLKQLE+AIKYG PFLF+DVDEYIDPVIDNVLEKNIKG QGR+F+ILGDKEVD+DPNF+LYLNTKLSNPKY P++FGK+MVINYTVTLKGLEDQLLSVIV FER+ELEEQRE LIQETS+NK+LLKDLEDSLLRELATSTGNMLDN EL++TLEETK+KA+EVSEKLKL  +T+ +IDK RDGYR AAKRGAILFFVL+EM+ +NSMYQYSLS++L VF  SL+KSLPDG L KRL+N+M TLT NVY YGCTG+FEKHKLLF+F +T+K+E   G + Q+ELDFF+KGN S+E +KRKKP  W+ D  W+D+ +L+E+ P  F  L  D+ER E  WK W + +T E    P  Y++KL  FQKL LLRCFR+DR+YRA++ YV   MGE+YV PP+++FE I +QS P SPIVFILSPGSDPASD++KLAERSGFG  +LKF++MGQGQE  A  LL+ A+ RG WL+LQNCHLLVKWL++LEK LE + KPHPDFRLWLTT+PT+ FPIGILQ+SLKVVTEPPNGLKLN+R+TY KI+  +L++  H+AF SLV+ LAFFHAVVQERRK+GKIGWN+PYDFNESDF+VC++IL TYL KA  Q D+KIPWGSLKYLIGEVMYGGRAID FDRRIL TYMDEY GDF+FDTFQ FHFY ++   Y IP+  T D  ++ IESLPL NTPEVFGLHSNAEIGYYT AA++MW+ L+++QPQTG+S +  SRDE I + A  I++KLP++FDLD++RK  GL+ISPT VVLLQELERFN L+ RM++SL  L RAL GEVGMS+ELD+VA++L+NGQIP IW+RLAPDTLKSL NW+ HF  R+ QY+ WV   EPNVMWLSGLHIPESYLTALVQATCRKNGWPLD+STLYT VT F T  EVTER  QGCF+ GLYLEGA WD +  CL++ KPK L+  LPV+KVIPIEAHRLK QNTF TPVY TS RRNAMGVGLV EADL TT+H SHWVLQGVCL LN+D
Sbjct:   99 VRLPNDLQEANDVLPMFLEYGILNGNSLLMLKQIFSQVFMPLLSYNHHK--NDNGSLQLEQVRQSGL---DTESNGPEANRHAETGLEFRSIQMIRDEFLMNMQKFLNHIQQTIQQLEGEIRLEMPDLTLDIESTQLALDQVIVEKLEQCVMNWQTQISVALEEQLQKKPQGNGPLAEIDFWRERNATLSALSEQLKLPLVKKILSVLSIADPGVVQNLELTVNELAKYHVEAADNVRFLSTLERHFKNLAHGTGFSVVLDTVPSMMNALRMVWIISRHYNKDERMVPLMERIAWEIAERVCRVLNIRSLFRENKEAAKNKSQDAKHTLELWKSSYFEVRAKIEASGRDQRWEFDRKRLFEKTDYLSSICQDLYNILQVLEEFCNIFGPEL--------------------------------------------------KAVTGDPKRIDDV------LRRVDG----LVRPMENLSFDPFNIKNSQQWKMVMEDFKNEVHVDIVNSLFLKHLDNPPLYKNHPPVAGSIYWERSLFYRIKHTIVRFLEMEEMLSCERGKAAKAKYLEVARKMKEYEDKKYEMWKENTDQNLPSLLKRSLLVKMYSSD-------------TDFHFSVNFAPELWEIITETKHMEQMGFSVGELPRNVALQEDKFLRYTDDMKHMIAAYEKLMGSLSEAEIQLLDEHIRDVWKVFRSGYRRLNWNSLGT-------------MESFVSAFYQFYI------------VLFFHPS--QFSRVKEFFEYIDIERAKDVDILERKYSTIGQLLTKIEGLVV-NTNTGKHPKMSQYYAHWEKRIYNSLTKMVLRNFQVFNTAILGD---VPLFQVETILSAPEIILQPNGNEIYKLTAQCYKGCMETTKRFVRWMNGTCIQCPPQKTE-DDEVVIISFYNDIYLNHQITEQARIINQNMHRILTSLTKYLNRWKRYRPLWKLDKAIVMEKFAARRPSCVAYDEKLQFYSKISLEVTQQPLIKDVQCIRLYLGPLAYTVQENARAWVNSLGHLLNESAREELYKLKDELESLSAQLKTTPETLEDLKFVLGTIANIRDISLTVEMRYRDIQERYRTLSMYN-------IEVSTADAYLY-TRAFPASNIR------GEEGLDITKDQIEDYKKKLSNFAELFQTEGPGAVGDNLDKGLQVLSAFEKELAKYEKDRQELANAEKLFDLPITMYPELIQIQKEMKGLQQIYEIYNAQKVSKEEWSQTLWANLNVQILLDGIDGFLKAFRKLSKDIRSLPVAFYLESKMKEFKESIPLLLDLKNEALRDRHWKELMTKTGTDFEMNPETFTLENMFAMELHKYADAISDIVASAVKELSIEKGVKEILDTWENMKFTVQRYIKGTQDRGSILGTVDEILQILDDNAMNLQSISGSRFVGPFLNTVQQWEKTLSLIGEVIEVWMVVQRKWMYLESIFIGGDIRSQLPDEAKKFDNIDRIFKRIMSETVKDPVIKRCCQASNRLSDLQNLSEGLERCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDPTCVQEHIIKMYDNIASLKFQEGDNGEMKATAMVSAEGEVMPFRQVVAAEGRVEDWMTTVLQEMRRTNRLITKEAIFRYCEDKSRVDWMLLYQGMVVLAGNQVWWTWEVEDVFRKVKKGEKQALKNYAKKMHQQIDELVTRITKPLSKNDRKKYNTVLIIDVHARDIVDIFVRDSIMDAREFEWESQLRFYWDREPDELNVRQCTGTFAYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDYKAVGKIFSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALIHHLKRFQFEGQEIALDARMGIFITMNPGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLQAKNLAKKMTVLYKLAREQLSKQHHYDFGLRALKSVLVMAGELKRGSPDLNEDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRVRYPDFNDAVEEALQENNYILLPTQVDKVVQMYETMLTRHTTMVVGPTGGGKSVVINTLCLAQTKLGLVTKLYTLNPKAMSVIELYGILDPATRDWTDGVLSNIFREINKPTEKKERRYILFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQPHCALLFEVGDLQYASPATVSRCGMVFVDPKNLKYMPYWQKWVNNRQSKQEQSVLSKLFEKYVPHCIEMIVEGITDGKQGEKLKTIVPQTDLNMVTQLSTMLDALLEKEVDDADVLECYFIEAMYWSLGATLLETGRIKFDEYIKRLASMSAAYDESILAGPGELPYQQPTIYDFHFDG--EKKKWIPWSKLVPKYIHKPEEKFIDILVPTVDTTRTTWLLEQMVKIKRPVVLVGESGTSKTATTLNLLRNLNTD--MLLSINFSSRTTSMDIQRNLEANVEKRTKDNYGPPMGKRLLVFMDDMNMPKVDEYGTQQPIALLKLLLEKGGMYDRGKELNCKYLRDLGFIAAMGKAGGGRNEVDTRFISLFSVFNVLFPSEESLSLIYSSILKGHTALFNEEVQAICDKLTFCTLELYKMIVRDLPPTPSKFHYIFNLRDLSRVYNGLVLTTPERFQTVAQMVRVWRNENLRVFHDRLVNEEDK-LVQGHIKHLIEEHFQASLEHATRDPILFGDYRTAMSEGEPRVYEDIQDYEAAKALFQEILEEYNESKTKMNLVLFDDALEHLTRIHRIIRMDRGHALLVGVGGSGKQSLARLAAYAAGYEVFEIVLSRGYGENSFREDLRNLYIKLGLENKKMIFLFTDAHVAEEGFLELINNMLTSGMVPALFPDDEKESVLSQIRDEATKHGVGPAKESIWQFFVNKSANNLHIVLGMSPVGDTLRTRCRNFPGLVNNTGIDWFLPWPPQALYAVANSFLG-DNSLIPSQHSEPVTGHVVMVHDSVGKFSKKFQQKLRRSNYVTPKNYLDFINTYSRLLEEKNQYNLAQCKRLEGGLDKLKEATVQLAELNVKLAEQKVVLAEKSSACEALLDEISTNTTIAEEKRKLAEEKAAEIEEQNKVIAVEKQEAESALAEALPILEAAKLELQKLDKSDVTEIRSFAKPPRAVQVVCECILVMRGYKEISWKSAKGMMSDPSFLKSLMEIDFDAITQHQVKAVRGFLKTLNTTFEEMEAISKAGLGMLKFVEAVMGYCDVAKEIKPKREKVAKLERNYYMSKRDLEKIQAELSTIQNELKALGEKYEAAITEKQKLQEEAEVMERRLIAADKLISGLGSENKRWTNDLEELKVRRVKLLGDCLLCSAFLSYEGAFNWDFRKEMVYTEWQQDILAREIPLSQPFRIESLLTDDVEISRWGSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIKRKEEKNNLKISSFNDPDFLKQLEMAIKYGFPFLFQDVDEYIDPVIDNVLEKNIKGAQGRQFIILGDKEVDYDPNFKLYLNTKLSNPKYSPSVFGKAMVINYTVTLKGLEDQLLSVIVGFERRELEEQRENLIQETSENKKLLKDLEDSLLRELATSTGNMLDNVELVHTLEETKAKATEVSEKLKLAEKTAVDIDKLRDGYRPAAKRGAILFFVLSEMALVNSMYQYSLSSFLAVFDHSLRKSLPDGILMKRLKNIMDTLTYNVYNYGCTGLFEKHKLLFSFNMTVKIEQADGRVPQEELDFFLKGNISLEKSKRKKPCSWIPDQGWEDIIRLSELFPSMFGSLPSDVERCEAEWKAWYDLDTLEQYPYPLGYNDKLSDFQKLLLLRCFRVDRVYRAVSDYVTVTMGEKYVQPPVISFEAIFEQSVPTSPIVFILSPGSDPASDLMKLAERSGFGGNRLKFLAMGQGQEKVALQLLETAVFRGQWLMLQNCHLLVKWLKDLEKALEMIKKPHPDFRLWLTTDPTKEFPIGILQKSLKVVTEPPNGLKLNMRATYFKISHEALDSCQHSAFKSLVYVLAFFHAVVQERRKFGKIGWNVPYDFNESDFQVCMEILNTYLTKAFQQHDTKIPWGSLKYLIGEVMYGGRAIDSFDRRILTTYMDEYLGDFIFDTFQLFHFYKNEEVDYRIPEGTTKDAFVEAIESLPLANTPEVFGLHSNAEIGYYTQAARDMWTHLLELQPQTGESSTGISRDEYIGQVAKDIENKLPQIFDLDQIRKNLGLEISPTTVVLLQELERFNKLIIRMSRSLVELQRALAGEVGMSSELDEVARALFNGQIPNIWRRLAPDTLKSLGNWMIHFRRRFNQYTSWVNESEPNVMWLSGLHIPESYLTALVQATCRKNGWPLDRSTLYTQVTSFRTPEEVTERPGQGCFISGLYLEGADWDIANSCLIKSKPKVLVVELPVLKVIPIEAHRLKLQNTFRTPVYTTSMRRNAMGVGLVFEADLYTTKHNSHWVLQGVCLTLNSD 4410          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Xenopus
Match: DNAH11 (dynein axonemal heavy chain 11 [Source:NCBI gene;Acc:100494270])

HSP 1 Score: 2186.76 bits (5665), Expect = 0.000e+0
Identity = 1446/4408 (32.80%), Postives = 2360/4408 (53.54%), Query Frame = 1
Query: 1012 NDKENLSDKEIMEMIESTVLKWDQQITGTLE--SLQKIVPH-GPSPLAEIDFWRERNAXXXXXXXXXXXPKVKRILNLYSLAEGPVFDTQNN---ELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIAWNLSDRVARLIDVNTIFNLPLEHVLKDTAEAEKMLRVWNDTYFEVRASIEASGRD----ARWEFDRKRLFEKTNYMADICHDLNEIAMILQEFYNI----FGPELKSVTNEAKRIXXXXXXXXXXXXPLKEMPFNPFNLMKHKYDWSNFMEDFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEVESIDQLFKTN---MNNPPLYHFKSCVAGGISWERHLFYNIKRPILRFLTMDEMMQSDNGKRIRTKYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILALANSENFVSENVPEETIDKMDDDLRVDFGFEINEIITETRNLELLGYK-VPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISDYIEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFKLQSGNKFLKCKEFFEFMESERTSDFEHLGRKYSTIGPLITKLQGEIIGDRDV---NP-FEKFQPFYEFWEKRIFDRVYNMVLKNLQDYQNMLRDENFPTCLFEVDLMLAGTDVIGNPQTTE-----IYKLAIQDLRDAVEATRVFIRWKRNSCIETTGMKIDGQDELFYFTFYLDIGNSVEITYFCEQIANYYRNIIGKLRKYQDKWKKHKRVFIPNKQ-------------------AQIDKWLTKDPTVMDFYERIRDTIDRKEELLNQPVIRKI--GFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDI-EGHFTDLSLIP-CDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSNHPIDQEEIEESDKLRQLFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLK----EWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVL-QILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIG-GDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILG-SSDCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLIP----MNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTREGMNQDTI----EAIFIQSIYWSLGGCL----IEDSQVKFDQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQM--FSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSENAKSDKDYAMTDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVF-----KNYKEINWKVAKGMMAD-PSFLQSLQTMDVDNITLKQSNVVRDS-LDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERK--IPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKN-IKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKRKKPYLWLSDISWQDVTKLTEMIPI--KFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKF--ISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERL-TKPHPDFRLWLTTEPTEA-----FPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTA---------FPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYI-ESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTG--KSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVEN-GEPNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMGVGLVVEADLATTEHPSHWVLQGVCLILNT 13923
            ++KEN   +  +   ES ++KW  QI   LE  S Q ++    P P AE+ FW+ER   L+ + EQL+ P V+++ ++    E   + T  N   E+ K  IEA+D    LS +  H K +    +F  +   +PP++  + +IW  S+ YN   R++ L++     L ++    +    +F    E  L+    A K+L+ +   +F  RAS++    D      W+F  + +F K +   +    + +I +I+ EF  +    FG +     NE  +I  + ++ ++  +  KE   +P +  ++  ++     DF+ KV+  + +    ++  F      E AF +L        R  I  + +  +  ++  Y+KE++    L+  +   + N  ++     VAG + + R +   I+     F  +  + ++ +   +  KY+ +   +  +E+  + +W   VD+     L + +L   N +  +S                V+F  ++  ++ E R L+      +P+ A  +  + E  +K +  L  +V  Y+ + +++  +E  ++ D++K +   +R    R  W      DYI K    +   E +V T     + +++ +K      LF  +   K     E    ++ +     E + +KY TI     K+Q   + + ++    P  + ++ + E+ +  + D +YN +L +L  +         P  LFE  ++LA T++I  P   +     +Y L  + L D  + +    R  ++  +ET   + D  D               ++    ++I      +I K+  Y+  +  +  ++  ++Q                   A  D  + + P  +D ++   D  +    L++     K+   +  V++K   + +    K+W  ++   L      +LA ++  I E +   L  +P  D   L A++  +  ++   +  +     +++   +L      +  +   + ++L + ++     + +V + + P++     + ++  + F     +F ++F  + P S        L  L K +  L  +E  +  L  +  LF++ +  Y +L    KE+K L ++++L    + +  +W +T W+ ++++ +D  +  F K    +   + +  ++      L   +K    +L   +DL++ A+R+RHW +LM  T   F +   T TLS + A++L++ +D +  IV  A KE+  EK + E+ +TW +++FS + + + G      L   DE+L + LD+N + LQ +  S+++  F+  V +W+K L+L   V+ +WM VQR W +LE IFIG  DIR+QLP +AK+F  +D  FK +M ET K   +  A   P+    L +L   L  C+K+L++YL++KR AFPRF+F+S  +LL IL   +  + V  H+ K+FDNI+ L+F    S E  A  M S E E + F       G+VE W+ K+E  M  T      E+V  Y E K R QW+FDY   VAL ++QIWWT +V   F ++++G +TALKDY K    Q++ ++  +   LS  DR K+ T+  IDVHARD+V   +   + +A++F W SQLR  W  +     +  C  QF Y YEY+G   RLVITPLTDR Y+TLTQ+L + + GAPAGPAGTGKTETTKDL +ALG++  V NC E MDY+SVG I+ GL Q GAWGCFDEFNRI V VLSV++ Q+K+IQ+ +  K  RF F G+ I L   VGIFITMNPGYAGRTELPE++KA FRP  ++VPD++ ICEIML ++GF+ A+ LA+K  TLY L KE LSKQ+HYD+GLRA+KSVLV+AG L+R D    ED+VLMRALRD NLPK + +D P+F+GLI DLFP LD PR R   F   V++   E           K+VQL E +  RH+  VVG  G GKS V++ L     K  L+ K  P    +NPK  S  EL+G + P TR+W DGLLS++ RE    T +   ++++ DGD+D +W+E++N+VMDDNK++TLA+ ERI L     LLFE+  L+ A+PATVSR G++Y++P++LG+NP+   W+  + N+ E   L  L+ KY+PP +D+   G         LKT+ P+   ++V  LC++LDC L  + +  D+     E  F+ +  W+ GG L    + D +V+F ++              K  K+ + P++  T+FDY+ DS  + + +I WA  VP +  + +     + V T +T  L +     I+  +PV+LVG  G  KT      L +  PD Y+   + F+  TTS  +QR LE  +EK+   +YGP   K+L+ FIDDMNMP+VD++GT QP  +++  ++    Y+R K ++ K++ +  ++A M  P  G   ++ R    F+VF   FPS  ++  I+S ILS H +   FS  +      I + T+ + ++++    PT  KFHYIFN+R+++ I+QG+   T +   +      +W HE +RV  D+++   D    ++ +++ +    +         P++F  + N L+      Y  +  +E  +    E +  Y+E  + M LVLF+DA+ H+ RI R + M  G+ALL+GVGGSGKQSL+KLAAY GS ++F+I L  GYS +DL+ +L  LY + G +N  TVF+  D  V +E FL LIN++L+SG +P LF ++E ++I+S +R+E    G+  SKE+ W +F+ +    L +VLC SPVG TLR R R FP +VN T+IDWF  WP++AL +V+  FI     + P   +  I +    VH SV + S +++Q  +R NY TPK++L+ I  Y  LLE K +    + + L  GLQKL   + Q+ +L  KLA Q+  + ++    E L+ +I  +T+  +++K  A  + Q V    +E+  ++ + E  L +A P L  A  ALD L K ++ E+++F  PP  V  V+  + V      +  K+ +WK AK  M     FLQ+L   D ++I      V ++  L+    + D +R+ S A  GL  +V  ++ Y +V  +++PKR+ + +  +       +L  ++ ++  L++ LK L   +E A  E+ R QEE +     +  A++L+ GL  +N RW   ++  K Q+  L GD L+ +AF+SYVG+FS  +R+E++ + W   +  +K  IP+S+      +LT+D  ++ WN+EGLP D +S +N  +   A R+PL IDPQQQ + WI  K     LK        +L+ +E A+  G   L +++ E +DPV+D +L +N IK  +GR ++ +GDKE +++ +FRL L+TKL+NP Y P +  ++ +IN+TVT  GLEDQLL+ +V  ER +LEE +  L ++ +D K  LK LED LL  L+ + G+ L + EL+  LE TK  A+E+  K+        +I++ R+ YR AA R ++L+F+++++S IN +YQ+SL A+  VF  ++ ++    ++ +R+  +   +T + + Y   G+FEK KL F  Q   ++ + +  +   ELD  ++    IE +  K P  +LS  SW  +    +MI +  +F  L  DIE     WK+++  E PE   LP+D+ NK  S QKL LLR  R DR+  AI  ++ E++G +YV     +F + +++++P +P+ FILSPG +P  DV  L ++ GF     KF  IS+GQGQE  A+  ++ A  +GHW+ILQN HL+ KWL  LEK L +  T  H D+R++++ EP  +      P GIL+ S+K+  EPP G+  NL         ++L+NF+            F  ++F+L +FHA V  R K+G  GWN  Y FN  D  +C+ +L  YL     + ++K+PW  L+YL GE+MYGG   DD+DR++ RTY++E+    L +  +P    A  FA    P         +YI E LP EN P ++GLH NAEI + T  +  ++  ++++QP+      GS  S +E +      I  KLP+ F++  L  K   + SP I+V  QE ER NIL   + +SL  L   L GE+ +S++++ +  SL+   +P  W +LA  +  SL  WI     R  +   W ++   P V+WLSGL  P+S+LTA++Q+  RKN WPLDK  L   VT+  T  +      +G ++ GL++EGA WD     +   + K L   +PVI V  I   + + +NT+  P+Y T  R    G   V   +L T E P+ WVL GV L+L+ 
Sbjct:  220 SNKENHVQRAALHAFESILIKWSYQIVEVLERDSSQPLLQGLDPGPHAELKFWKERRDNLTCIYEQLQAPAVQKMASILQDTESAYYPTFTNIVCEVKKALIEAEDIDLHLSTLRNHIKLLE-ETDFPQIYILLPPLLHTICLIWAHSKCYNIPARVIVLLQEFCNLLIEQAKTYLSPEDLFKAEPEESLEHVQAALKVLQSFKHAFFTHRASLQTYYTDRTQFKAWDFRSEMVFAKFDRFLERLLKIEDIFVIMLEFQKLEKLEFGGKKGKALNE--KIFNLNEEFQDNSKVFKESTLDPTD--RNNKEFEQEYSDFKAKVLDCDTRIASLLSEAFNDSSGLESAFKLLAICGLFLERSVILDIFSPNYFTLLQMYDKELDRCKLLYDAHVKQLENYAVHRNMPAVAGTLKFTREIKDRIQISWSNFRFIHHLPEASS---VYQKYMEMMTLLDQYEDSVYEKWTSKVDEECEFNLDRPLLVRNNDDGLLS----------------VNFDPKLIAVLREVRYLQKQSQADIPKEALAIFDKREMLHKYIASLDQLVFWYNKLKRTVLEVEYPLIKDDLKNIDEQLRESEERYTWKDDNCWDYIVKVKSVVQDLEKRVQTSKDNIITMQQIMKVWAEQWLFSRKDNRK-----ETLINLDDKN----EIVNKKYQTIQEDSVKIQSLAMENMELLKATPGLDSWKMYVEYIDTIVTDGLYNTILHSLTFFMENTDVRLKPAPLFEAQMILASTEIIFKPSLQKEDGDGLYDLVEEMLSDIFKMSGQVKRIAKH--LETDNYQNDMDD-------------MTDLAAIRQEIMERVTGVIIKVTDYRSTYDSYSYLWTDDRQEFMRQFLLYGHVLTSDEIEAHADDGVPETPPTIDQFKEQIDIFENLYVLMSSSDDTKVFERWFRVDIKPFKTSLLVIIKKWSWMFKEHLVRFVIDSLAELEEFIKEANAILLKKVPEGDYSALVAVMELLLAVRDRQMATDELFEPLKQTISLLESYGQKLPDQIYVQLEELPEKWNHTKKLAVSVKHDVAPLQISEVTLIRKRCTAFDMKQIHFRERFSLDAPFSFNAQNPYSL--LDKANRALQAMEEEKLHLQQSADLFDVAVPDYKQLKKSSKEIKLLKELWDLIHTVRSSIVDWVKTPWRQINVEQMDMELRRFAKASSTDLLSLDKHTRSWDAYSGLDLSIKNLITSLRAITDLQNPAIRDRHWHQLMNATKVQFTMTEQT-TLSDLLALQLHKVEDEVRNIVDKAVKEMGTEKILIEISQTWTSMEFSYEHHHRTGTP----LIQTDELLFETLDNNQVQLQVIMQSKYVEYFIEQVTSWQKRLNLADSVIYIWMEVQRTWSHLESIFIGSADIRNQLPGDAKRFKGVDADFKDLMFETEKIRNVLDATNRPDLYKTLEDLQLRLSLCEKALSEYLETKRLAFPRFYFVSAADLLDILSKGTQPKQVTRHLAKLFDNIADLQFQD--SGENEAQGMYSKENEFVPFSVNCKCIGQVEHWLKKVEETMCETICCHITESVAAY-EDKPRDQWLFDYPAQVALTSSQIWWTIDVGIAFERLEEGFETALKDYIKKQIAQLNALINMLLGELSAGDRQKIMTMCTIDVHARDVVAKLIAHKVTNAQDFAWLSQLRHRWDEKQKHCFVNICDAQFQYSYEYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGVMVYVFNCSEQMDYKSVGNIYKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKSIQDAIRNKRERFLFLGENITLKHSVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDIELICEIMLVAEGFIDARPLARKFITLYTLCKELLSKQDHYDWGLRAVKSVLVVAGSLKRGDSSRPEDQVLMRALRDFNLPKIVTDDVPIFMGLISDLFPALDVPRKRDFSFEQMVKQSTLELHLQPEESFILKVVQLEELLAVRHSVFVVGNAGTGKSKVLRTL----NKTYLNRKQKPVWNDLNPKAVSTDELFGFIHPATREWKDGLLSSLMREQANLTHEGP-KWIVLDGDIDPMWIESLNTVMDDNKVMTLASNERIPLTPTMRLLFEIHHLRTATPATVSRAGILYMNPQDLGWNPYVTSWIETRSNQTEKANLTILFDKYVPPCLDQFRTGF--------LKTVTPILENSMVQTLCSLLDCLLNTDNVPPDSARELYELYFVFACIWAFGGALQRDQLTDYRVEFSRWWT------------KEMKSVKFPAQ-GTIFDYFLDS--KARRFISWAERVPSFEMDIDSTMQAVFVHTAETTCLGYFTDLLIQKSKPVMLVGNAGVGKTVFLSDRLASL-PDHYMIAKVPFNYYTTSSALQRVLEKPLEKKAGRNYGPIGNKKLVYFIDDMNMPEVDKFGTVQPHTLIRQHIDYGHWYERQK-MSLKEIHNCQYVACMN-PTAGSFTINQRLQRHFTVFAVNFPSNDAVEVIFSKILSFHFKQHAFSPSVLKAGTSIIQATIWLSHKMVQNFLPTAIKFHYIFNIREITNIFQGILFATSECLKQPSDLIHLWFHESSRVYGDKMVESKDSDLFKRILQDTVQRYFEV---IFSQQPLIFCHFANGLDTQS---YMPVKGWEVLRKTLAEALNSYNELSAAMNLVLFEDAMQHVCRISRILEMPRGYALLIGVGGSGKQSLSKLAAYIGSLEVFQITLKNGYSVQDLKVDLANLYIRTGAKNMPTVFLLTDAQVPDERFLVLINDLLASGEIPDLFTEEETDSIVSGIRSEVRGLGLNDSKENCWNFFLERVRHQLKVVLCFSPVGCTLRVRARKFPAIVNCTSIDWFHEWPQEALQSVSRRFIQDIEGIEP-GVKDSISQFMAYVHTSVNDMSIKYLQYEKRYNYTTPKSFLEQITLYKNLLEKKRRELSQRMEHLMNGLQKLTTTASQVEDLKVKLASQEAELQQRNQDAEALITKIGRQTEKVSQEKATADAEEQKVASIQEEVSVKQKDCEEDLSKAEPALIAATAALDTLNKTNLTELKTFPNPPIAVTNVTAAVMVLLAPKGRVPKDRSWKAAKVFMGKVDDFLQALIKYDKEHIHENCLKVAKEQYLNDPGFSPDLVRTKSFAAAGLCAWVINIVKYYEVYCDVEPKRKALGQANEDLKGATEKLTAIRKKLHDLDNNLKKLTHSFEKATAEKVRCQEEVNRTNTTIEMANRLVKGLEVKNIRWSESIKSFKAQEKTLCGDVLLTAAFVSYVGSFSKRYRQELMENIWIPFLTSQKVVIPVSEGLDPIAMLTDDATVAGWNNEGLPSDRMSTENATILINAERWPLMIDPQQQGIKWIKNK-YGTVLKVINLGQKGYLQTIETALASGDTVLIENLAENVDPVLDPLLGRNTIK--RGR-YIKIGDKECEYNQHFRLILHTKLANPHYKPELQAQTTLINFTVTTDGLEDQLLADVVSIERPDLEELKSMLTKQQNDFKIELKRLEDELLIRLSAAEGSFLGDMELVEKLESTKVTAAEIEHKVVEAKENEIKINEAREHYRAAAARASLLYFIMSDLSKINPIYQFSLKAFNVVFHKAIGRAEQSEDVTERVAKLTECITYSAFLYTSQGLFEKDKLTFLSQTAFQILLKQKEIDSLELDVLLR--FPIENS-YKSPVDFLSVQSWSAI----KMISLLDEFKGLDRDIEGSAKRWKKFVESENPENERLPQDWKNK-TSLQKLILLRALRPDRMTYAIRNFIEEKLGSKYVEEARPDFAKSYEETSPATPVFFILSPGVNPLKDVEALGKKLGFTIDSGKFHNISLGQGQEKVAEEAMEKAAQQGHWVILQNVHLVAKWLGTLEKLLAQYSTGSHEDYRIFISAEPAPSPEEHIIPQGILENSIKITNEPPTGMLANLH--------AALDNFDQDTLEMCAREQEFKCILFSLCYFHACVAGRLKFGPQGWNRRYPFNSGDLTICVNVLYNYL-----EANNKVPWEDLRYLFGEIMYGGHITDDWDRKLCRTYLEEFMNPAL-EGEKPL---APGFAA---PPNQDYSGYHEYIDEILPAEN-PVLYGLHLNAEIDFLTVTSDNLFKTILEMQPKNTLHGEGSGMSVEEKVKNILDEILEKLPEEFNMLELMHK-TTERSPYILVCFQECERMNILTQEIRRSLKELNLGLKGELTISSDMEALQSSLFYDSVPDTWAKLAYPSSFSLGQWINDLLLRCRELDTWTQDLVLPAVVWLSGLFNPQSFLTAIMQSMARKNEWPLDKMCLTVDVTK-KTKEDYGHPPREGAYICGLFMEGARWDIQTNVIAEARLKDLTPLMPVIYVRAIPVDKKELRNTYDCPLYRTKTR----GPTYVWTFNLKTKEPPAKWVLAGVALLLSV 4492          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Xenopus
Match: DNAH11 (dynein axonemal heavy chain 11 [Source:NCBI gene;Acc:100494270])

HSP 1 Score: 2178.29 bits (5643), Expect = 0.000e+0
Identity = 1448/4416 (32.79%), Postives = 2348/4416 (53.17%), Query Frame = 1
Query:  964 IASEVKLEIPDLDLFENDKENLSD-----KEIMEMIESTVLKWDQQITGTLE--SLQKIVPH-GPSPLAEIDFWRERNAXXXXXXXXXXXPKVKRILNLYSLAEGPVFDTQNN---ELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIAWNLSDRVARLIDVNTIFNLPLEHVLKDTAEAEKMLRVWNDTYFEVRASIEASGRD----ARWEFDRKRLFEKTNYMADICHDLNEIAMILQEFYNI----FGPELKSVTNEAKRIXXXXXXXXXXXXPLKEMPFNPFNLMKHKYDWSNFME-DFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEVESIDQLFKTNMNNPPLYHFKSCVAGGISWERHLFYNIKRPILRFLTMDEMMQSDNGKRIRTKYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILALANSENFVSENVPEETIDKMDDDLRVDFGFEINEIITETRNLELLGYK-VPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISDYIEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFKLQSGNKFLKCKEFFEFMESERTSDFEHLGRKYSTIGPLITKLQGEIIGDRDV---NP-FEKFQPFYEFWEKRIFDRVYNMVLKNLQDYQNMLRDENFPTCLFEVDLMLAGTDVIGNPQTTE-----IYKLAIQDLRDAVEATRVFIRWKRNSCIETTGMKIDGQDELFYFTFYLDIGNSVEITYFCEQIANYYRNIIGKLRKYQDKWKKHKRVFIPNKQ-------------------AQIDKWLTKDPTVMDFYERIRDTIDRKEELLNQPVIRKI--GFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDI-EGHFTDLSLIP-CDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSNHPIDQEEIEESDKLRQLFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVL-QILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIG-GDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILG-SSDCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLIP----MNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTREGMNQDTI----EAIFIQSIYWSLGGCL----IEDSQVKFDQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQM--FSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSENAKSDKDYAMT-DPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVF-----KNYKEINWKVAKGMMAD-PSFLQSLQTMDVDNITLKQSNVVRDS-LDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERK--IPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKN-IKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKRKKPYLWLSDISWQDVTKLTEMIPI--KFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKF--ISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERL-TKPHPDFRLWLTTEPTEA-----FPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNF-NHTAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYI-ESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTG--KSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVEN-GEPNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMGVGLVVEADLATTEHPSHWVLQGVCLILNT 13923
            I+ +  L IP +        N++      K  +   ES ++KW  QI   LE  S Q ++    P P AE+ FW+ER   L+ + EQL+ P V+++ ++    E   + T  N   E+ K  IEA+D    LS +  H K +    +F  +   +PP++  + +IW  S+ YN   R++ L++     L ++    +    +F    E  L+    A K+L+ +   +F  RAS++    D      W+F  + +F K +   +    + +I +I+ EF  +    FG +     NE  +I  + ++ ++  +  KE   +P        D S F+   F   V+  +  AI       C L                  R  I  + +  +  ++  Y+KE++    L+          H K  +   ISW    F       +  L+M    +S     +  KY+ +   +  +E+  + +W   VD+     L + +L   N +  +S                V+F  ++  ++ E R L+      +P+ A  +  + E  +K +  L  +V  Y+ + +++  +E  ++ D++K +   +R    R  W      DYI K    +   E +V T     + +++ +K      LF  +   K     E    ++ +     E + +KY TI     K+Q   + + ++    P  + ++ + E+ +  + D +YN +L +L  +         P  LFE  ++LA T++I  P   +     +Y L  + L D  + +    R    S ++                   D+ +  ++    ++I      +I K+  Y+  +  +  ++  ++Q                   A  D  + + P  +D ++   D  +    L++     K+   +  V++K   + +    K+W  ++   L      +LA ++  I E +   L  +P  D   L A++  +  ++   +  +     +++   +L      +  +   + ++L + ++     + +V + + P++     + ++  + F     +F ++F  + P S        L  L K +  L  +E  +  L  +  LF++ +  Y +L    KE+K L ++++L    + +  +W +T W+ ++++ +D  +  F K+   + +  ++      L   +K    +L   +DL++ A+R+RHW +LM  T   F +   T TLS + A++L++ +D +  IV  A KE+  EK + E+ +TW +++FS + + + G      L   DE+L + LD+N + LQ +  S+++  F+  V +W+K L+L   V+ +WM VQR W +LE IFIG  DIR+QLP +AK+F  +D  FK +M ET K   +  A   P+    L +L   L  C+K+L++YL++KR AFPRF+F+S  +LL IL   +  + V  H+ K+FDNI+ L+F    S E  A  M S E E + F       G+VE W+ K+E  M  T      E+V  Y E K R QW+FDY   VAL ++QIWWT +V   F ++++G +TALKDY K    Q++ ++  +   LS  DR K+ T+  IDVHARD+V   +   + +A++F W SQLR  W  +     +  C  QF Y YEY+G   RLVITPLTDR Y+TLTQ+L + + GAPAGPAGTGKTETTKDL +ALG++  V NC E MDY+SVG I+ GL Q GAWGCFDEFNRI V VLSV++ Q+K+IQ+ +  K  RF F G+ I L   VGIFITMNPGYAGRTELPE++KA FRP  ++VPD++ ICEIML ++GF+ A+ LA+K  TLY L KE LSKQ+HYD+GLRA+KSVLV+AG L+R D    ED+VLMRALRD NLPK + +D P+F+GLI DLFP LD PR R   F   V++   E           K+VQL E +  RH+  VVG  G GKS V++ L     K  L+ K  P    +NPK  S  EL+G + P TR+W DGLLS++ RE    T +   ++++ DGD+D +W+E++N+VMDDNK++TLA+ ERI L     LLFE+  L+ A+PATVSR G++Y++P++LG+NP+   W+  + N+ E   L  L+ KY+PP +D+   G         LKT+ P+   ++V  LC++LDC L  + +  D+     E  F+ +  W+ GG L    + D +V+F ++              K  K+ + P++  T+FDY+ DS  + + +I WA  VP +  + +     + V T +T  L +     I+  +PV+LVG  G  KT      L +  PD Y+   + F+  TTS  +QR LE  +EK+   +YGP   K+L+ FIDDMNMP+VD++GT QP  +++  ++    Y+R K ++ K++ +  ++A M  P  G   ++ R    F+VF   FPS  ++  I+S ILS H +   FS  +      I + T+ + ++++    PT  KFHYIFN+R+++ I+QG+   T +   +      +W HE +RV  D+++   D    ++ +++ +    +  +    +  P++F  + N L+      Y  +  +E  +    E +  Y+E  + M LVLF+DA+ H+ RI R + M  G+ALL+GVGGSGKQSL+KLAAY GS ++F+I L  GYS +DL+ +L  LY + G +N  TVF+  D  V +E FL LIN++L+SG +P LF ++E ++I+S +R+E    G+  SKE+ W +F+ +    L +VLC SPVG TLR R R FP +VN T+IDWF  WP++AL +V+  FI     + P   +  I +    VH SV + S +++Q  +R NY TPK++L+ I  Y  LLE K +    + + L  GLQKL   + Q+ +L  KLA Q+  + ++    E L+ +I  +T+  +++K  A  + Q V +  +E+  ++ + E  L +A P L  A  ALD L K ++ E+++F  PP  V  V+  + V      +  K+ +WK AK  M     FLQ+L   D ++I      V ++  L+    + D +R+ S A  GL  +V  ++ Y +V  +++PKR+ + +  +       +L  ++ ++  L++ LK L   +E A  E+ R QEE +     +  A++L+ GL SEN RW   ++  K Q+  L GD L+ +AF+SYVG+FS  +R+E++ + W   +  +K  IP+S+      +LT+D  ++ WN+EGLP D +S +N  +   A R+PL IDPQQQ + WI  K     LK        +L+ +E A+  G   L +++ E +DPV+D +L +N IK  +GR ++ +GDKE +++ +FRL L+TKL+NP Y P +  ++ +IN+TVT  GLEDQLL+ +V  ER +LEE +  L ++ +D K  LK LED LL  L+ + G+ L + EL+  LE TK  A+E+  K+        +I++ R+ YR AA R ++L+F+++++S IN +YQ+SL A+  VF  ++ ++    ++ +R+  +   +T + + Y   G+FEK KL F  Q   ++ + +  +   ELD  ++    IE +  K P  +LS  SW  +    +MI +  +F  L  DIE     WK+++  E PE   LP+D+ NK  S QKL LLR  R DR+  AI  ++ E++G +YV     +F + +++++P +P+ FILSPG +P  DV  L ++ GF     KF  IS+GQGQE  A+  ++ A  +GHW+ILQN HL+ KWL  LEK L +  T  H D+R++++ EP  +      P GIL+ S+K+  EPP G+  NL +  +     +L        F  ++F+L +FHA V  R K+G  GWN  Y FN  D  +C+ +L  YL     + ++K+PW  L+YL GE+MYGG   DD+DR++ RTY++E+    + +  +P    A  FA    P         +YI E LP EN P ++GLH NAEI + T  +  ++  ++++QP+      GS  S +E +      I  KLP+ F++  L  K   + SP I+V  QE ER NIL   + +SL  L   L GE+ +S++++ +  SL+   +P  W +LA  +  SL  WI     R  +   W ++   P V+WLSGL  P+S+LTA++Q+  RKN WPLDK  L   VT+  T  +      +G ++ GL++EGA WD     +   + K L   +PVI V  I   + + +NT+  P+Y T  R    G   V   +L T E P+ WVL GV L+L+ 
Sbjct:   26 ISGKTHLPIPTVATITEQNLNVTSNKYDPKAALHAFESILIKWSYQIVEVLERDSSQPLLQGLDPGPHAELKFWKERRDNLTCIYEQLQAPAVQKMASILQDTESAYYPTFTNIVCEVKKALIEAEDIDLHLSTLRNHIKLLE-ETDFPQIYILLPPLLHTICLIWAHSKCYNIPARVIVLLQEFCNLLIEQAKTYLSPEDLFKAEPEESLEHVQAALKVLQSFKHAFFTHRASLQTYYTDRTQFKAWDFRSEMVFAKFDRFLERLLKIEDIFVIMLEFQKLEKLEFGGKKGKALNE--KIFNLNEEFQDNSKVFKESTLDP-------TDPSYFVALQFSYSVILFQLLAI-------CGL---------------FLERSVILDIFSPNYFTLLQMYDKELDRCKLLYDA--------HVKQTLKT-ISWSNFRF-------IHHLSM----ESPEASSVYQKYMEMMTLLDQYEDSVYEKWTSKVDEECEFNLDRPLLVRNNDDGLLS----------------VNFDPKLIAVLREVRYLQKQSQADIPKEALAIFDKREMLHKYIASLDQLVFWYNKLKRTVLEVEYPLIKDDLKNIDEQLRESEERYTWKDDNCWDYIVKVKSVVQDLEKRVQTSKDNIITMQQIMKVWAEQWLFSRKDNRK-----ETLINLDDKN----EIVNKKYQTIQEDSVKIQSLAMENMELLKATPGLDSWKMYVEYIDTIVTDGLYNTILHSLTFFMENTDVRLKPAPLFEAQMILASTEIIFKPSLQKEDGDGLYDLVEEMLSDIFKMSGQVKRIANCSVLQN------------------DMDDMTDLAAIRQEIMERVTGVIIKVTDYRSTYDSYSYLWTDDRQEFMRQFLLYGHVLTSDEIEAHADDGVPETPPTIDQFKEQIDIFENLYVLMSSSDDTKVFERWFRVDIKPFKTSLLVIIKKWSWMFKEHLVRFVIDSLAELEEFIKEANAILLKKVPEGDYSALVAVMELLLAVRDRQMATDELFEPLKQTISLLESYGQKLPDQIYVQLEELPEKWNHTKKLAVSVKHDVAPLQISEVTLIRKRCTAFDMKQIHFRERFSLDAPFSFNAQNPYSL--LDKANRALQAMEEEKLHLQQSADLFDVAVPDYKQLKKSSKEIKLLKELWDLIHTVRSSIVDWVKTPWRQINVEQMDMELRRFAKDLLSLDKHTRSWDAYSGLDLSIKNLITSLRAITDLQNPAIRDRHWHQLMNATKVQFTMTEQT-TLSDLLALQLHKVEDEVRNIVDKAVKEMGTEKILIEISQTWTSMEFSYEHHHRTGTP----LIQTDELLFETLDNNQVQLQVIMQSKYVEYFIEQVTSWQKRLNLADSVIYIWMEVQRTWSHLESIFIGSADIRNQLPGDAKRFKGVDADFKDLMFETEKIRNVLDATNRPDLYKTLEDLQLRLSLCEKALSEYLETKRLAFPRFYFVSAADLLDILSKGTQPKQVTRHLAKLFDNIADLQFQD--SGENEAQGMYSKENEFVPFSVNCKCIGQVEHWLKKVEETMCETICCHITESVAAY-EDKPRDQWLFDYPAQVALTSSQIWWTIDVGIAFERLEEGFETALKDYIKKQIAQLNALINMLLGELSAGDRQKIMTMCTIDVHARDVVAKLIAHKVTNAQDFAWLSQLRHRWDEKQKHCFVNICDAQFQYSYEYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGVMVYVFNCSEQMDYKSVGNIYKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKSIQDAIRNKRERFLFLGENITLKHSVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDIELICEIMLVAEGFIDARPLARKFITLYTLCKELLSKQDHYDWGLRAVKSVLVVAGSLKRGDSSRPEDQVLMRALRDFNLPKIVTDDVPIFMGLISDLFPALDVPRKRDFSFEQMVKQSTLELHLQPEESFILKVVQLEELLAVRHSVFVVGNAGTGKSKVLRTL----NKTYLNRKQKPVWNDLNPKAVSTDELFGFIHPATREWKDGLLSSLMREQANLTHEGP-KWIVLDGDIDPMWIESLNTVMDDNKVMTLASNERIPLTPTMRLLFEIHHLRTATPATVSRAGILYMNPQDLGWNPYVTSWIETRSNQTEKANLTILFDKYVPPCLDQFRTGF--------LKTVTPILENSMVQTLCSLLDCLLNTDNVPPDSARELYELYFVFACIWAFGGALQRDQLTDYRVEFSRWWT------------KEMKSVKFPAQ-GTIFDYFLDS--KARRFISWAERVPSFEMDIDSTMQAVFVHTAETTCLGYFTDLLIQKSKPVMLVGNAGVGKTVFLSDRLASL-PDHYMIAKVPFNYYTTSSALQRVLEKPLEKKAGRNYGPIGNKKLVYFIDDMNMPEVDKFGTVQPHTLIRQHIDYGHWYERQK-MSLKEIHNCQYVACMN-PTAGSFTINQRLQRHFTVFAVNFPSNDAVEVIFSKILSFHFKQHAFSPSVLKAGTSIIQATIWLSHKMVQNFLPTAIKFHYIFNIREITNIFQGILFATSECLKQPSDLIHLWFHESSRVYGDKMVESKDSDLFKRILQDTVQRYFEGVEHQVFSQQPLIFCHFANGLDTQS---YMPVKGWEVLRKTLAEALNSYNELSAAMNLVLFEDAMQHVCRISRILEMPRGYALLIGVGGSGKQSLSKLAAYIGSLEVFQITLKNGYSVQDLKVDLANLYIRTGAKNMPTVFLLTDAQVPDERFLVLINDLLASGEIPDLFTEEETDSIVSGIRSEVRGLGLNDSKENCWNFFLERVRHQLKVVLCFSPVGCTLRVRARKFPAIVNCTSIDWFHEWPQEALQSVSRRFIQDIEGIEP-GVKDSISQFMAYVHTSVNDMSIKYLQYEKRYNYTTPKSFLEQITLYKNLLEKKRRELSQRMEHLMNGLQKLTTTASQVEDLKVKLASQEAELQQRNQDAEALITKIGRQTEKVSQEKATADAEEQKVSLICEEVSVKQKDCEEDLSKAEPALIAATAALDTLNKTNLTELKTFPNPPIAVTNVTAAVMVLLAPKGRVPKDRSWKAAKVFMGKVDDFLQALIKYDKEHIHENCLKVAKEQYLNDPGFSPDLVRTKSFAAAGLCAWVINIVKYYEVYCDVEPKRKALGQANEDLKGATEKLTAIRKKLHDLDNNLKKLTHSFEKATAEKVRCQEEVNRTNTTIEMANRLVKGLESENIRWSESIKSFKAQEKTLCGDVLLTAAFVSYVGSFSKRYRQELMENIWIPFLTSQKVVIPVSEGLDPIAMLTDDATVAGWNNEGLPSDRMSTENATILINAERWPLMIDPQQQGIKWIKNK-YGTVLKVINLGQKGYLQTIETALASGDTVLIENLAENVDPVLDPLLGRNTIK--RGR-YIKIGDKECEYNQHFRLILHTKLANPHYKPELQAQTTLINFTVTTDGLEDQLLADVVSIERPDLEELKSMLTKQQNDFKIELKRLEDELLIRLSAAEGSFLGDMELVEKLESTKVTAAEIEHKVVEAKENEIKINEAREHYRAAAARASLLYFIMSDLSKINPIYQFSLKAFNVVFHKAIGRAEQSEDVTERVAKLTECITYSAFLYTSQGLFEKDKLTFLSQTAFQILLKQKEIDSLELDVLLR--FPIENS-YKSPVDFLSVQSWSAI----KMISLLDEFKGLDRDIEGSAKRWKKFVESENPENERLPQDWKNK-TSLQKLILLRALRPDRMTYAIRNFIEEKLGSKYVEEARPDFAKSYEETSPATPVFFILSPGVNPLKDVEALGKKLGFTIDSGKFHNISLGQGQEKVAEEAMEKAAQQGHWVILQNVHLVAKWLGTLEKLLAQYSTGSHEDYRIFISAEPAPSPEEHIIPQGILENSIKITNEPPTGMLANLHAALDNFDQDTLEMCAREQEFKCILFSLCYFHACVAGRLKFGPQGWNRRYPFNSGDLTICVNVLYNYL-----EANNKVPWEDLRYLFGEIMYGGHITDDWDRKLCRTYLEEFMNPAVLEGEKPL---APGFAA---PPNQDYSGYHEYIDEILPAEN-PVLYGLHLNAEIDFLTVTSDNLFKTILEMQPKNTLHGEGSGMSVEEKVKNILDEILEKLPEEFNMLELMHK-TTERSPYILVCFQECERMNILTQEIRRSLKELNLGLKGELTISSDMEALQSSLFYDSVPDTWAKLAYPSSFSLGQWINDLLLRCRELDTWTQDLVLPAVVWLSGLFNPQSFLTAIMQSMARKNEWPLDKMCLTVDVTK-KTKEDYGHPPREGAYICGLFMEGARWDIQTNVIAEARLKDLTPLMPVIYVRAIPVDKKELRNTYDCPLYRTKTR----GPTYVWTFNLKTKEPPAKWVLAGVALLLSV 4271          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Mouse
Match: Dnah10 (dynein, axonemal, heavy chain 10 [Source:MGI Symbol;Acc:MGI:1860299])

HSP 1 Score: 5361.58 bits (13907), Expect = 0.000e+0
Identity = 2687/4476 (60.03%), Postives = 3405/4476 (76.07%), Query Frame = 1
Query:  538 LQMARTPLVNAEDTLCFFLVRTTDDMVVLPSNINEANSELPSYFESGTLKGDMLLLLSQLIHSVYDYMLSYHQHRVTSDLGMSRASTPASQGRIPKKSQ--SDGDKIES--IDEKVHETRAAVQARDEFLISLKKFTSIVDQTIIQIASEVKLEIPDLDLFENDKENLSDKEIMEMIESTVLKWDQQITGTLESLQKIVPHGPSPLAEIDFWRERNAXXXXXXXXXXXPKVKRILNLYSLAEGPVFDTQN-----NELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIAWNLSDRVARLIDVNTIFNLPLEHVLKDTAEAEKMLRVWNDTYFEVRASIEASGRDARWEFDRKRLFEKTNYMADICHDLNEIAMILQEFYNIFGPELKSVTNEAKRIXXXXXXXXXXXXPLKEMPFNPFNLMKHKYDWSNFMEDFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEVESIDQLFKTNMNNPPLYHFKSCVAGGISWERHLFYNIKRPILRFLTMDEMMQSDNGKRIRTKYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILALANSENFVSENVPEETIDKMDDDLRVDFGFEINEIITETRNLELLGYKVPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISDYIEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFKL---QSGNKFLKCKEFFEFMESERTSDFEHLGRKYSTIGPLITKLQGEIIGDRDVNPFEKFQPFYEFWEKRIFDRVYNMVLKNLQDYQNMLRDENFPTCLFEVDLMLAGTDVIGNPQTTEIYKLAIQDLRDAVEATRVFIRWKRNSCIETTGMKIDGQDELFYFTFYLDIGNSVEITYFCEQIANYYRNIIGKLRKYQDKWKKHKRVFIPNKQAQIDKWLTKDPTVMDFYERIRDTIDRKEELLNQPVIRKIGFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDLSLIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSN-HPIDQEEIEESDKLRQLFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTREGMNQDTIEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSENAKSDKDYAMTDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKRKKPYLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLTKPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTGKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGEPNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMGVGLVVEADLATTEHPSHWVLQGVCLILNTD 13926
            + +A  P    +  + FFL R++ D +   +++ EA   +P   E G +   +L LL  +I  V+   LS++QH+           + + QG +  ++Q  S  D  ES  I  +  E  +    RDEFL++L+KF + + +TI Q+  E+KLE+P + +  +  E +S+ E++E +E  V+ W  QI+  L+S  K  P G  PLAEI+FWRERNA LSAL EQ KLP V+++L +   AE  +  T N      EL K H+EA DN +FLS VERHFK+I +G +F  V D+IP MM ALRM+WIISRHYN+DERM+PLMERIAW +++RV R+I++ T+F     +    T EA   L++W  +YF++RA IEASGR+ARWEFDRKRLFE+T+YMA+IC DL+++  +L+EFYNIFGPELK+VT + KRI++VL +V+ LV P++ + F+PF++    Y W   MEDF+ +V+ IE +A +FI+  F TLRSAE AFDMLL+F+HIRSR+AIN+ M  KFNDI++QY KE++ ++++F  N +NPPLY     VAG I WER LFY IK  ILRF+ ++E++ S+ G++++ +YL VGR M+ +E+ ++  W+   ++ L  L++K++L    ++N ++    +  I        ++F   + EII ET+ LE LG+ +PELARNVALQ++ + +  EG+  M+  YH +I +L   E  +L D  +E+ R  R G +RLNWNSLGISDYI +C  A+  FE+ V  IHK   DI  +L  I++  LF+    ++ +     KEFFE++E ER  D +H+ R Y  IGPL+TK++G ++   +     K   +YE+WE +I+D +  ++ KNLQ + +++   N P  LF+ + +L+  +++ +P   EI K+ +  +R  VE T+ F+RW   SCIE    K + ++E+   +FY DI  + +I      I      ++  + KY  +WK+++ ++  +K   ++K+  K P  + + E+++       +++  P+I+    I + L+ L S V+++ K W       L+ESA+  L S++++IE    +L   P  LE+LK +L+TI  I+  SL  E R  D+QERYR + +    P D E+ E  + +  +++SL  ES NV + L  +K  FT+IT+ EI ++   L  FA +F  +GPG++G DLD G  +L  F  EL   E  RQEL  AE+LF+LPIT YPEL  VQKEM  L  IYELY++ K A+E W++TLW NL+++ L EGIEGFLK  RK+PR+V+ +  A +L  K+K FKD++PL  DLKHEALRERHWKELM KTG  F++  +TFTL ++FAMEL++  +V+ EIVT+A KE++IEK V+E+ +TW  +KF+V  Y KG +ERGYILG++D+++Q LDDN +NLQS+S SRF+GPFL +V  WEK LSLI EV+++WM+VQRKWMYLE IFIGGDIRSQLPEEAKKFD ID+ FK+IM ET K P+IK+ C+ PNRL DL  +S+GLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILG+SD  CVQEHMIKM+DNI+ LRF  G S E   +AMIS+E E+M FR  +  +GRVEDWMT +  EMRRTNR+ITKEA+F Y E + RV WM  YQGMV L  +Q+WWTWEVEDVF K+K+G K A+K+Y K +H+QID++V  +   LSKNDR K  TVLIIDVHARDIVDSF+R SI++A+EFEWESQLRFYW RE DE+ I+QCTG F YGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDY++VGKIF+GL QCGAWGCFDEFNRI+ SVLSVIS+Q++TI+N LI +L+ F FEGQEI LDSR+GIFITMNPGYAGRTELPESVKA FRPVVVIVPDLQQICEIMLFS+GFL AK LAKKMT LY+L++EQLSKQ+HYDFGLRALKSVLVMAGEL+R   DL ED VLMRALRDMNLPKF+FED PLFLGLI DLFPGLDCPRVRYPDFND+VE+ L E+ Y++L  Q DK+VQ++ETM TRHTTMVVGPTGGGKSVVI  LC +QTKL + TKL  +NPK  SVIELYGILDP TRDWTDG+LSNIFREIN+PTDK ER+Y+LFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQ HCALLFEVGDLQYASPATVSRCGMVYVDPKNL Y P+W+ WL + +NK E   L  L++KY+P  ID +IEG+++G+  EKLK ++P T+LN+VTQL  MLD  L  E  + D +E  F++++Y SLG  L+E+ +VKFD+ IK L +MP  + E   A+ GELP   P+L+D++FD+  ++  WIPW  LVP+YVH+ EKKF +ILV T+DT R TW+L + +KI+ PVL VGE+GTSKTA +Q FL+N + +  I L +NFSSRTTSLDIQRNLE+NVEKRTKD+YGPPMGKRLLVF+DDMNMP+VD+YGTQQPIA+LKL+LE+   YDRGK+LN K ++D+GF+AAMGK GGGRN+VDPRF+SLFSVFN  FPS+ SL  IY SIL GH   F++ I      +T  T+T+Y  I+  LPPTPSKFHYIFNLRDLSR++ G+  T  DRF    Q  RVWR+E  RV  DRLIN+ DK  VQ  I   ++E+   D +  M DPILFGD+R AL+  E R+YED+ +YEAAK LF+EI+EEY+E  + M LVLFDDAL+HLTR+HR IRMD GHALLVGVGGSGKQSL +LAA+T  C++FEI LSRGYSE + R++LK LY KLG+ENK  +F+F D HV EEGFLELINNML+SG+VPALF ++E++ I+ Q+  EA   GMGP+KES+WQ+FVNK A+NLHIVL MSPVG+TLRTRCRNFPG+VNNT IDWF PWP QAL+AVA  F+G +NS+IPD++  E+V+H VMVH SV E+SK+F QK RR NYVTPKNYLDFINTY KLL++K ++  +QC RL+GGL KL EA++QL ELN KLA QK+ + EK+ ACE LL+EI + T IA EKK++A+EK+  +E Q+K I  EK EAE AL E +P+LE A+L L  L+K+DV EIRSFAKPPK VQ V ECI + K YKE+NWK AKGMM+DP+FL+SL  +D D+IT  Q   ++  L  L  TI+EM +VSKAG G+LKFV AV+GY DV REIKPKREKVARLE+ F   KRELE+++NE+  ++ EL+ L  +YE AI E+Q+LQEE +IM+RRL AADKLI+GL SEN RWL DL  L  ++V+LLGDCL+C+AFLSY GAF+WEFR EMV   W++D+++R IP+S PFRLE++LT+DVEIS+W S+GLPPDELS+QNGILTTRASRFPLCIDPQQQALNWI +KEE NNL+ A+FNDPDFLKQLE++IKYG PFLF DVDEYIDPVID+VLEKNIK  QGR+F+ILGDKEVD+D NFRLYLNTKL+NP+Y P++FGK+MVINYTVTLKGLEDQLLSV+V +ER+ELEEQRE LIQETS+NK LLKDLEDSLLRELATSTGNMLDN EL+ TLEETKSKA+EVSEKLKL  +T+ +ID+ RDGYR AA+RGAILFFVL+EM+ +NSMYQYSL A+L+VF  SLKKSLPD  L KRL+N+M TLT N+Y YGCTG+FE+HKLLF+F +T+K+E  +G + Q+ELDFF+KGN S+E +K KKP  WLSD  W+D+  L++     F  L  DIE     W++W + ++ E    P  Y + + +FQKL +LRCFR+DR+YRA+T YV   MGE+YV PP+++FE I +QSTP SPIVFILSPGSDPASD++KLAERSGFG T+LKF++MGQGQE  A  LL+ A+ARG WL+LQNCHLLVKWL++LEK LER+TKPHPDFRLWLTT+PT+ FPIGILQ+SLKVVTEPPNGLKLN+R+TY KI+   L    HTAF  LV+ LAFFHAVVQERRK+GKIGWN+ YDFNESDF+VC++IL TYL KA  Q D +IPWGSLKYLIGEVMYGGRAID FDRRIL TYMDEY GDF+FDTFQPFHF+ +K   Y IP  D  D  ++ IE+LPL NTPEVFGLHSNAEIGYYT AA++MW  L+++QPQTG+S S  SRD+ I + A  I++K+PK+FDLD++RK  GL I+PT VVLLQEL RFN LV RMT+SL  L RAL GEVGMS ELDDVA+SL+ G IP IW++LAPDTLK+L NW+ +F  R++QY+ WV  GEP+VMWLSGLHIPESYLTALVQATCR+NGWPLD+STL+T VT+F  A EV ERA QGCFV GLYLEGA WD  + CLV+ KPK L+  LP++K+IP E HRLK QNTF TPVY TS RRNAMG+GLV EADL T +H SHWVLQGVCL LN+D
Sbjct:  147 VNLASLPEEFLQQNVVFFL-RSSKDAIPEATDMKEAMEIMPETMEYGVINSQVLQLLKDVICQVFMPALSFNQHK-----------SESGQGTLSGENQEFSVYDLAESVVIPGEPMEYHSVQLIRDEFLMNLQKFENNIQRTIQQLEGEIKLEMPSISVEGDMSELVSNPELVENLEQCVIHWLGQISYALDSQMKKKPQGNGPLAEIEFWRERNATLSALYEQTKLPFVRKVLEVIKEAESML--TANVQPILTELFKLHMEASDNVRFLSTVERHFKNITHGSSFHVVLDTIPSMMSALRMVWIISRHYNRDERMIPLMERIAWEIAERVCRVINLRTLFKENRANAQFKTQEARNTLKLWKKSYFDIRAKIEASGREARWEFDRKRLFERTDYMANICQDLSDVLQVLEEFYNIFGPELKAVTGDPKRIDDVLGRVDSLVAPMESLSFDPFSIRSSPY-WKYVMEDFKLEVLVIEKEAKNFIDESFKTLRSAEAAFDMLLKFKHIRSREAINRQMMMKFNDILAQYYKEIDIVNKIFVQNQDNPPLYKNHPPVAGAICWERSLFYRIKHTILRFMEVEELLDSERGQQVKQRYLEVGRKMKEYEDGKYEHWKETTEQSLPTLMKKSLL----TKNIIT--AEDSAIIDRGTTFIINFSPVLKEIINETKYLEQLGFTIPELARNVALQEDKFLRYTEGIQRMLDHYHLLINTLNEAETALLDDHSQELLRVFRSGYKRLNWNSLGISDYITRCKQAIGKFETLVHQIHKNADDINSRLTLIESVSLFRFPVAKTADGVPGVKEFFEYIERERARDVDHMVRWYMAIGPLLTKVEGLVV-HTNTGRAPKLASYYEYWEGKIYDVLVKLIQKNLQAFNSLIL-RNVP--LFQAETILSAPEIVLHPNANEIDKMCVHCVRSCVEVTKHFVRWMNGSCIECPPQKGE-EEEVVIISFYNDISQNTQIMDQALMIPQNIHRLLVNIMKYLQRWKRYRPLWKLDKSIVMEKFAAKKPACVAYDEKLQFYSKIATDVMRHPLIKDEHCIRLQLEPLASTVQENAKSWVISLGKLLNESAREELYSLRDEIEHLAKNLKKSPSTLEDLKFVLATISEIRSKSLVMELRYKDIQERYRTMAIYKIFPTDTEQ-ELVNNIENMWESLFTESMNVEHALGGIKRTFTEITRSEIMNYRSQLDEFARRFYSQGPGAVGEDLDKGSELLGSFEKELAKHEKNRQELANAEKLFDLPITMYPELIKVQKEMTGLRMIYELYNSLKLAKEEWSQTLWINLNVQYLQEGIEGFLKNLRKLPRQVRGLSVAFHLEVKMKAFKDSIPLLLDLKHEALRERHWKELMEKTGVFFEMT-ETFTLENMFAMELHKHTEVLNEIVTAAVKEVAIEKAVKEILDTWENMKFTVVKYYKGTQERGYILGSVDDIIQCLDDNTVNLQSISGSRFVGPFLQTVHKWEKTLSLIGEVIEIWMLVQRKWMYLESIFIGGDIRSQLPEEAKKFDNIDRIFKRIMGETLKDPVIKRCCEAPNRLHDLQTISEGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGNSDPLCVQEHMIKMYDNIAMLRFHDGDSGEKLVSAMISAEGEVMTFRKIIRADGRVEDWMTAVLHEMRRTNRLITKEAIFRYCEDRSRVDWMLLYQGMVVLAASQVWWTWEVEDVFNKVKQGDKQAMKNYGKKMHSQIDDLVTRITMELSKNDRKKYNTVLIIDVHARDIVDSFIRGSILEAREFEWESQLRFYWDREPDELNIRQCTGTFSYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDYKAVGKIFSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALIHQLTTFQFEGQEISLDSRMGIFITMNPGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLGAKTLAKKMTVLYKLAREQLSKQHHYDFGLRALKSVLVMAGELKRGSADLQEDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRVRYPDFNDAVEQVLEENGYVLLPVQVDKVVQMFETMLTRHTTMVVGPTGGGKSVVINTLCQAQTKLGIMTKLYILNPKAVSVIELYGILDPTTRDWTDGVLSNIFREINRPTDKKERKYILFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQAHCALLFEVGDLQYASPATVSRCGMVYVDPKNLKYQPYWKKWLQQIQNKVEQKYLNDLFEKYVPTLIDMIIEGIVDGRQGEKLKMVVPQTDLNMVTQLTRMLDSLLEGEIEDLDLLECFFLEALYCSLGSSLLEEGRVKFDECIKRLSSMPTVDSEGNWARPGELPGHLPSLYDFHFDA--KRNHWIPWNKLVPEYVHSHEKKFVDILVHTVDTTRTTWILEQMVKIKHPVLFVGESGTSKTATTQNFLKNLNEETNIVLIVNFSSRTTSLDIQRNLEANVEKRTKDTYGPPMGKRLLVFMDDMNMPKVDEYGTQQPIALLKLLLEKGYLYDRGKELNCKSIRDLGFIAAMGKAGGGRNEVDPRFLSLFSVFNVPFPSEESLNLIYYSILKGHTSTFNESIGGVSRKLTFCTLTLYKNIVQDLPPTPSKFHYIFNLRDLSRVFNGLVLTNPDRFQTVSQMVRVWRNECLRVFHDRLINEVDKELVQNHIGNLVTEHFNDDFEMVMRDPILFGDFRLALQEGEPRIYEDIQDYEAAKALFEEILEEYNEVNTKMNLVLFDDALEHLTRVHRIIRMDRGHALLVGVGGSGKQSLARLAAFTAGCEVFEILLSRGYSENNFRDDLKNLYMKLGLENKMMIFLFTDAHVAEEGFLELINNMLTSGMVPALFAEEEKDNILGQIGQEALKFGMGPAKESVWQFFVNKSANNLHIVLGMSPVGDTLRTRCRNFPGLVNNTGIDWFMPWPPQALHAVAKSFLG-DNSMIPDEKLEELVEHVVMVHQSVGEFSKQFQQKLRRSNYVTPKNYLDFINTYSKLLDEKTQYNIAQCKRLEGGLDKLKEATIQLDELNLKLAEQKIVLAEKSAACEALLEEIATNTAIAEEKKKLAEEKAIEIEEQNKIIAVEKAEAETALAEVMPILEAAKLELQKLDKSDVTEIRSFAKPPKQVQTVCECILIMKGYKELNWKTAKGMMSDPNFLRSLMEIDFDSITQGQVKNIKGLLKTLNTTIEEMEAVSKAGLGMLKFVEAVMGYCDVFREIKPKREKVARLERNFFLTKRELERIQNELAAIQKELEALGAKYEAAILEKQKLQEEAEIMERRLIAADKLISGLGSENVRWLNDLDELMHRRVKLLGDCLLCAAFLSYEGAFTWEFRDEMVNQVWQNDILDRDIPLSQPFRLENLLTDDVEISRWGSQGLPPDELSVQNGILTTRASRFPLCIDPQQQALNWIKRKEEKNNLRVASFNDPDFLKQLEMSIKYGTPFLFHDVDEYIDPVIDSVLEKNIKTSQGRQFIILGDKEVDYDSNFRLYLNTKLANPRYSPSVFGKAMVINYTVTLKGLEDQLLSVLVAYERRELEEQREHLIQETSENKNLLKDLEDSLLRELATSTGNMLDNVELVQTLEETKSKATEVSEKLKLAEKTALDIDRLRDGYRPAARRGAILFFVLSEMALVNSMYQYSLIAFLEVFGLSLKKSLPDSILLKRLKNIMDTLTFNIYNYGCTGLFERHKLLFSFNMTIKIEQAEGRVPQEELDFFLKGNISLEKSKWKKPCTWLSDQGWEDIILLSQKFSDIFGNLPLDIEHHLPMWQEWYDQDSLEQFPFPLGYDDNITAFQKLLILRCFRVDRVYRAVTDYVTLTMGEKYVQPPMISFEAIFEQSTPNSPIVFILSPGSDPASDLMKLAERSGFGGTRLKFLAMGQGQEKVALQLLETAVARGQWLMLQNCHLLVKWLKDLEKSLERITKPHPDFRLWLTTDPTKGFPIGILQKSLKVVTEPPNGLKLNMRATYFKISNDMLEQCPHTAFKPLVYVLAFFHAVVQERRKFGKIGWNVYYDFNESDFQVCMEILNTYLTKAFQQRDPRIPWGSLKYLIGEVMYGGRAIDSFDRRILTTYMDEYLGDFIFDTFQPFHFFRNKDVDYKIPVGDIKDKFVEAIEALPLANTPEVFGLHSNAEIGYYTQAARDMWGHLLELQPQTGESSSGVSRDDYIGQVAKDIENKMPKIFDLDQVRKHLGLSITPTSVVLLQELGRFNKLVIRMTRSLAELQRALAGEVGMSNELDDVARSLFLGHIPHIWRKLAPDTLKTLGNWMVYFLRRFSQYTLWVTEGEPSVMWLSGLHIPESYLTALVQATCRRNGWPLDRSTLFTQVTKFQDADEVNERAGQGCFVSGLYLEGADWDIERGCLVKSKPKVLVVDLPILKIIPTEGHRLKLQNTFRTPVYTTSMRRNAMGIGLVFEADLFTAKHISHWVLQGVCLTLNSD 4591          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Mouse
Match: Dnah10 (dynein, axonemal, heavy chain 10 [Source:MGI Symbol;Acc:MGI:1860299])

HSP 1 Score: 5260.27 bits (13644), Expect = 0.000e+0
Identity = 2653/4476 (59.27%), Postives = 3357/4476 (75.00%), Query Frame = 1
Query:  538 LQMARTPLVNAEDTLCFFLVRTTDDMVVLPSNINEANSELPSYFESGTLKGDMLLLLSQLIHSVYDYMLSYHQHRVTSDLGMSRASTPASQGRIPKKSQ--SDGDKIES--IDEKVHETRAAVQARDEFLISLKKFTSIVDQTIIQIASEVKLEIPDLDLFENDKENLSDKEIMEMIESTVLKWDQQITGTLESLQKIVPHGPSPLAEIDFWRERNAXXXXXXXXXXXPKVKRILNLYSLAEGPVFDTQN-----NELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIAWNLSDRVARLIDVNTIFNLPLEHVLKDTAEAEKMLRVWNDTYFEVRASIEASGRDARWEFDRKRLFEKTNYMADICHDLNEIAMILQEFYNIFGPELKSVTNEAKRIXXXXXXXXXXXXPLKEMPFNPFNLMKHKYDWSNFMEDFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEVESIDQLFKTNMNNPPLYHFKSCVAGGISWERHLFYNIKRPILRFLTMDEMMQSDNGKRIRTKYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILALANSENFVSENVPEETIDKMDDDLRVDFGFEINEIITETRNLELLGYKVPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISDYIEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFKL---QSGNKFLKCKEFFEFMESERTSDFEHLGRKYSTIGPLITKLQGEIIGDRDVNPFEKFQPFYEFWEKRIFDRVYNMVLKNLQDYQNMLRDENFPTCLFEVDLMLAGTDVIGNPQTTEIYKLAIQDLRDAVEATRVFIRWKRNSCIETTGMKIDGQDELFYFTFYLDIGNSVEITYFCEQIANYYRNIIGKLRKYQDKWKKHKRVFIPNKQAQIDKWLTKDPTVMDFYERIRDTIDRKEELLNQPVIRKIGFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDLSLIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSN-HPIDQEEIEESDKLRQLFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTREGMNQDTIEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSENAKSDKDYAMTDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKRKKPYLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLTKPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTGKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGEPNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMGVGLVVEADLATTEHPSHWVLQGVCLILNTD 13926
            + +A  P    +  + FFL R++ D +   +++ EA   +P   E G +   +L LL  +I  V+   LS++QH+           + + QG +  ++Q  S  D  ES  I  +  E  +    RDEFL++L+KF + + +TI Q+  E+KLE+P + +  +  E +S+ E++E +E  V+ W  QI+  L+S  K  P G  PLAEI+FWRERNA LSAL EQ KLP V+++L +   AE  +  T N      EL K H+EA DN +FLS VERHFK+I +G +F  V D+IP MM ALRM+WIISRHYN+DERM+PLMERIAW +++RV R+I++ T+F     +    T EA   L++W  +YF++RA IEASGR+ARWEFDRKRLFE+T+YMA+IC DL+++  +L+EFYNIFGPELK+VT + KRI++VL +V+ LV P++ + F+PF++    Y W   MEDF+ +V+      ID +N  F                                                     N +NPPLY     VAG I WER LFY IK  ILRF+ ++E++ S+ G++++ +YL VGR M+ +E+ ++  W+   ++ L  L++K++L    ++N ++    +  I        ++F   + EII ET+ LE LG+ +PELARNVALQ++ + +  EG+  M+  YH +I +L   E  +L D  +E+ R  R G +RLNWNSLGISDYI +C  A+  FE+ V  IHK   DI  +L  I++  LF+    ++ +     KEFFE++E ER  D +H+ R Y  IGPL+TK++G ++   +     K   +YE+WE +I+D +  ++ KNLQ + +++   N P  LF+ + +L+  +++ +P   EI K+ +  +R  VE T+ F+RW   SCIE    K + ++E+   +FY DI  + +I      I      ++  + KY  +WK+++ ++  +K   ++K+  K P  + + E+++       +++  P+I+    I + L+ L S V+++ K W       L+ESA+  L S++++IE    +L   P  LE+LK +L+TI  I+  SL  E R  D+QERYR + +    P D E+ E  + +  +++SL  ES NV + L  +K  FT+IT+ EI ++   L  FA +F  +GPG++G DLD G  +L  F  EL   E  RQEL  AE+LF+LPIT YPEL  VQKEM  L  IYELY++ K A+E W++TLW NL+++ L EGIEGFLK  RK+PR+V+ +  A +L  K+K FKD++PL  DLKHEALRERHWKELM KTG  F++  +TFTL ++FAMEL++  +V+ EIVT+A KE++IEK V+E+ +TW  +KF+V  Y KG +ERGYILG++D+++Q LDDN +NLQS+S SRF+GPFL +V  WEK LSLI EV+++WM+VQRKWMYLE IFIGGDIRSQLPEEAKKFD ID+ FK+IM ET K P+IK+ C+ PNRL DL  +S+GLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILG+SD  CVQEHMIKM+DNI+ LRF  G S E   +AMIS+E E+M FR  +  +GRVEDWMT +  EMRRTNR+ITKEA+F Y E + RV WM  YQGMV L  +Q+WWTWEVEDVF K+K+G K A+K+Y K +H+QID++V  +   LSKNDR K  TVLIIDVHARDIVDSF+R SI++A+EFEWESQLRFYW RE DE+ I+QCTG F YGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDY++VGKIF+GL QCGAWGCFDEFNRI+ SVLSVIS+Q++TI+N LI +L+ F FEGQEI LDSR+GIFITMNPGYAGRTELPESVKA FRPVVVIVPDLQQICEIMLFS+GFL AK LAKKMT LY+L++EQLSKQ+HYDFGLRALKSVLVMAGEL+R   DL ED VLMRALRDMNLPKF+FED PLFLGLI DLFPGLDCPRVRYPDFND+VE+ L E+ Y++L  Q DK+VQ++ETM TRHTTMVVGPTGGGKSVVI  LC +QTKL + TKL  +NPK  SVIELYGILDP TRDWTDG+LSNIFREIN+PTDK ER+Y+LFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQ HCALLFEVGDLQYASPATVSRCGMVYVDPKNL Y P+W+ WL + +NK E   L  L++KY+P  ID +IEG+++G+  EKLK ++P T+LN+VTQL  MLD  L  E  + D +E  F++++Y SLG  L+E+ +VKFD+ IK L +MP  + E   A+ GELP   P+L+D++FD+  ++  WIPW  LVP+YVH+ EKKF +ILV T+DT R TW+L + +KI+ PVL VGE+GTSKTA +Q FL+N + +  I L +NFSSRTTSLDIQRNLE+NVEKRTKD+YGPPMGKRLLVF+DDMNMP+VD+YGTQQPIA+LKL+LE+   YDRGK+LN K ++D+GF+AAMGK GGGRN+VDPRF+SLFSVFN  FPS+ SL  IY SIL GH   F++ I      +T  T+T+Y  I+  LPPTPSKFHYIFNLRDLSR++ G+  T  DRF    Q  RVWR+E  RV  DRLIN+ DK  VQ  I   ++E+   D +  M DPILFGD+R AL+  E R+YED+ +YEAAK LF+EI+EEY+E  + M LVLFDDAL+HLTR+HR IRMD GHALLVGVGGSGKQSL +LAA+T  C++FEI LSRGYSE + R++LK LY KLG+ENK  +F+F D HV EEGFLELINNML+SG+VPALF ++E++ I+ Q+  EA   GMGP+KES+WQ+FVNK A+NLHIVL MSPVG+TLRTRCRNFPG+VNNT IDWF PWP QAL+AVA  F+G +NS+IPD++  E+V+H VMVH SV E+SK+F QK RR NYVTPKNYLDFINTY KLL++K ++  +QC RL+GGL KL EA++QL ELN KLA QK+ + EK+ ACE LL+EI + T IA EKK++A+EK+  +E Q+K I  EK EAE AL E +P+LE A+L L  L+K+DV EIRSFAKPPK VQ V ECI + K YKE+NWK AKGMM+DP+FL+SL  +D D+IT  Q   ++  L  L  TI+EM +VSKAG G+LKFV AV+GY DV REIKPKREKVARLE+ F   KRELE+++NE+  ++ EL+ L  +YE AI E+Q+LQEE +IM+RRL AADKLI+GL SEN RWL DL  L  ++V+LLGDCL+C+AFLSY GAF+WEFR EMV   W++D+++R IP+S PFRLE++LT+DVEIS+W S+GLPPDELS+QNGILTTRASRFPLCIDPQQQALNWI +KEE NNL+ A+FNDPDFLKQLE++IKYG PFLF DVDEYIDPVID+VLEKNIK  QGR+F+ILGDKEVD+D NFRLYLNTKL+NP+Y P++FGK+MVINYTVTLKGLEDQLLSV+V +ER+ELEEQRE LIQETS+NK LLKDLEDSLLRELATSTGNMLDN EL+ TLEETKSKA+EVSEKLKL  +T+ +ID+ RDGYR AA+RGAILFFVL+EM+ +NSMYQYSL A+L+VF  SLKKSLPD  L KRL+N+M TLT N+Y YGCTG+FE+HKLLF+F +T+K+E  +G + Q+ELDFF+KGN S+E +K KKP  WLSD  W+D+  L++     F  L  DIE     W++W + ++ E    P  Y + + +FQKL +LRCFR+DR+YRA+T YV   MGE+YV PP+++FE I +QSTP SPIVFILSPGSDPASD++KLAERSGFG T+LKF++MGQGQE  A  LL+ A+ARG WL+LQNCHLLVKWL++LEK LER+TKPHPDFRLWLTT+PT+ FPIGILQ+SLKVVTEPPNGLKLN+R+TY KI+   L    HTAF  LV+ LAFFHAVVQERRK+GKIGWN+ YDFNESDF+VC++IL TYL KA  Q D +IPWGSLKYLIGEVMYGGRAID FDRRIL TYMDEY GDF+FDTFQPFHF+ +K   Y IP  D  D  ++ IE+LPL NTPEVFGLHSNAEIGYYT AA++MW  L+++QPQTG+S S  SRD+ I + A  I++K+PK+FDLD++RK  GL I+PT VVLLQEL RFN LV RMT+SL  L RAL GEVGMS ELDDVA+SL+ G IP IW++LAPDTLK+L NW+ +F  R++QY+ WV  GEP+VMWLSGLHIPESYLTALVQATCR+NGWPLD+STL+T VT+F  A EV ERA QGCFV GLYLEGA WD  + CLV+ KPK L+  LP++K+IP E HRLK QNTF TPVY TS RRNAMG+GLV EADL T +H SHWVLQGVCL LN+D
Sbjct:  147 VNLASLPEEFLQQNVVFFL-RSSKDAIPEATDMKEAMEIMPETMEYGVINSQVLQLLKDVICQVFMPALSFNQHK-----------SESGQGTLSGENQEFSVYDLAESVVIPGEPMEYHSVQLIRDEFLMNLQKFENNIQRTIQQLEGEIKLEMPSISVEGDMSELVSNPELVENLEQCVIHWLGQISYALDSQMKKKPQGNGPLAEIEFWRERNATLSALYEQTKLPFVRKVLEVIKEAESML--TANVQPILTELFKLHMEASDNVRFLSTVERHFKNITHGSSFHVVLDTIPSMMSALRMVWIISRHYNRDERMIPLMERIAWEIAERVCRVINLRTLFKENRANAQFKTQEARNTLKLWKKSYFDIRAKIEASGREARWEFDRKRLFERTDYMANICQDLSDVLQVLEEFYNIFGPELKAVTGDPKRIDDVLGRVDSLVAPMESLSFDPFSIRSSPY-WKYVMEDFKLEVL------IDIVNKIFV---------------------------------------------------QNQDNPPLYKNHPPVAGAICWERSLFYRIKHTILRFMEVEELLDSERGQQVKQRYLEVGRKMKEYEDGKYEHWKETTEQSLPTLMKKSLL----TKNIIT--AEDSAIIDRGTTFIINFSPVLKEIINETKYLEQLGFTIPELARNVALQEDKFLRYTEGIQRMLDHYHLLINTLNEAETALLDDHSQELLRVFRSGYKRLNWNSLGISDYITRCKQAIGKFETLVHQIHKNADDINSRLTLIESVSLFRFPVAKTADGVPGVKEFFEYIERERARDVDHMVRWYMAIGPLLTKVEGLVV-HTNTGRAPKLASYYEYWEGKIYDVLVKLIQKNLQAFNSLIL-RNVP--LFQAETILSAPEIVLHPNANEIDKMCVHCVRSCVEVTKHFVRWMNGSCIECPPQKGE-EEEVVIISFYNDISQNTQIMDQALMIPQNIHRLLVNIMKYLQRWKRYRPLWKLDKSIVMEKFAAKKPACVAYDEKLQFYSKIATDVMRHPLIKDEHCIRLQLEPLASTVQENAKSWVISLGKLLNESAREELYSLRDEIEHLAKNLKKSPSTLEDLKFVLATISEIRSKSLVMELRYKDIQERYRTMAIYKIFPTDTEQ-ELVNNIENMWESLFTESMNVEHALGGIKRTFTEITRSEIMNYRSQLDEFARRFYSQGPGAVGEDLDKGSELLGSFEKELAKHEKNRQELANAEKLFDLPITMYPELIKVQKEMTGLRMIYELYNSLKLAKEEWSQTLWINLNVQYLQEGIEGFLKNLRKLPRQVRGLSVAFHLEVKMKAFKDSIPLLLDLKHEALRERHWKELMEKTGVFFEMT-ETFTLENMFAMELHKHTEVLNEIVTAAVKEVAIEKAVKEILDTWENMKFTVVKYYKGTQERGYILGSVDDIIQCLDDNTVNLQSISGSRFVGPFLQTVHKWEKTLSLIGEVIEIWMLVQRKWMYLESIFIGGDIRSQLPEEAKKFDNIDRIFKRIMGETLKDPVIKRCCEAPNRLHDLQTISEGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGNSDPLCVQEHMIKMYDNIAMLRFHDGDSGEKLVSAMISAEGEVMTFRKIIRADGRVEDWMTAVLHEMRRTNRLITKEAIFRYCEDRSRVDWMLLYQGMVVLAASQVWWTWEVEDVFNKVKQGDKQAMKNYGKKMHSQIDDLVTRITMELSKNDRKKYNTVLIIDVHARDIVDSFIRGSILEAREFEWESQLRFYWDREPDELNIRQCTGTFSYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDYKAVGKIFSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALIHQLTTFQFEGQEISLDSRMGIFITMNPGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLGAKTLAKKMTVLYKLAREQLSKQHHYDFGLRALKSVLVMAGELKRGSADLQEDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRVRYPDFNDAVEQVLEENGYVLLPVQVDKVVQMFETMLTRHTTMVVGPTGGGKSVVINTLCQAQTKLGIMTKLYILNPKAVSVIELYGILDPTTRDWTDGVLSNIFREINRPTDKKERKYILFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQAHCALLFEVGDLQYASPATVSRCGMVYVDPKNLKYQPYWKKWLQQIQNKVEQKYLNDLFEKYVPTLIDMIIEGIVDGRQGEKLKMVVPQTDLNMVTQLTRMLDSLLEGEIEDLDLLECFFLEALYCSLGSSLLEEGRVKFDECIKRLSSMPTVDSEGNWARPGELPGHLPSLYDFHFDA--KRNHWIPWNKLVPEYVHSHEKKFVDILVHTVDTTRTTWILEQMVKIKHPVLFVGESGTSKTATTQNFLKNLNEETNIVLIVNFSSRTTSLDIQRNLEANVEKRTKDTYGPPMGKRLLVFMDDMNMPKVDEYGTQQPIALLKLLLEKGYLYDRGKELNCKSIRDLGFIAAMGKAGGGRNEVDPRFLSLFSVFNVPFPSEESLNLIYYSILKGHTSTFNESIGGVSRKLTFCTLTLYKNIVQDLPPTPSKFHYIFNLRDLSRVFNGLVLTNPDRFQTVSQMVRVWRNECLRVFHDRLINEVDKELVQNHIGNLVTEHFNDDFEMVMRDPILFGDFRLALQEGEPRIYEDIQDYEAAKALFEEILEEYNEVNTKMNLVLFDDALEHLTRVHRIIRMDRGHALLVGVGGSGKQSLARLAAFTAGCEVFEILLSRGYSENNFRDDLKNLYMKLGLENKMMIFLFTDAHVAEEGFLELINNMLTSGMVPALFAEEEKDNILGQIGQEALKFGMGPAKESVWQFFVNKSANNLHIVLGMSPVGDTLRTRCRNFPGLVNNTGIDWFMPWPPQALHAVAKSFLG-DNSMIPDEKLEELVEHVVMVHQSVGEFSKQFQQKLRRSNYVTPKNYLDFINTYSKLLDEKTQYNIAQCKRLEGGLDKLKEATIQLDELNLKLAEQKIVLAEKSAACEALLEEIATNTAIAEEKKKLAEEKAIEIEEQNKIIAVEKAEAETALAEVMPILEAAKLELQKLDKSDVTEIRSFAKPPKQVQTVCECILIMKGYKELNWKTAKGMMSDPNFLRSLMEIDFDSITQGQVKNIKGLLKTLNTTIEEMEAVSKAGLGMLKFVEAVMGYCDVFREIKPKREKVARLERNFFLTKRELERIQNELAAIQKELEALGAKYEAAILEKQKLQEEAEIMERRLIAADKLISGLGSENVRWLNDLDELMHRRVKLLGDCLLCAAFLSYEGAFTWEFRDEMVNQVWQNDILDRDIPLSQPFRLENLLTDDVEISRWGSQGLPPDELSVQNGILTTRASRFPLCIDPQQQALNWIKRKEEKNNLRVASFNDPDFLKQLEMSIKYGTPFLFHDVDEYIDPVIDSVLEKNIKTSQGRQFIILGDKEVDYDSNFRLYLNTKLANPRYSPSVFGKAMVINYTVTLKGLEDQLLSVLVAYERRELEEQREHLIQETSENKNLLKDLEDSLLRELATSTGNMLDNVELVQTLEETKSKATEVSEKLKLAEKTALDIDRLRDGYRPAARRGAILFFVLSEMALVNSMYQYSLIAFLEVFGLSLKKSLPDSILLKRLKNIMDTLTFNIYNYGCTGLFERHKLLFSFNMTIKIEQAEGRVPQEELDFFLKGNISLEKSKWKKPCTWLSDQGWEDIILLSQKFSDIFGNLPLDIEHHLPMWQEWYDQDSLEQFPFPLGYDDNITAFQKLLILRCFRVDRVYRAVTDYVTLTMGEKYVQPPMISFEAIFEQSTPNSPIVFILSPGSDPASDLMKLAERSGFGGTRLKFLAMGQGQEKVALQLLETAVARGQWLMLQNCHLLVKWLKDLEKSLERITKPHPDFRLWLTTDPTKGFPIGILQKSLKVVTEPPNGLKLNMRATYFKISNDMLEQCPHTAFKPLVYVLAFFHAVVQERRKFGKIGWNVYYDFNESDFQVCMEILNTYLTKAFQQRDPRIPWGSLKYLIGEVMYGGRAIDSFDRRILTTYMDEYLGDFIFDTFQPFHFFRNKDVDYKIPVGDIKDKFVEAIEALPLANTPEVFGLHSNAEIGYYTQAARDMWGHLLELQPQTGESSSGVSRDDYIGQVAKDIENKMPKIFDLDQVRKHLGLSITPTSVVLLQELGRFNKLVIRMTRSLAELQRALAGEVGMSNELDDVARSLFLGHIPHIWRKLAPDTLKTLGNWMVYFLRRFSQYTLWVTEGEPSVMWLSGLHIPESYLTALVQATCRRNGWPLDRSTLFTQVTKFQDADEVNERAGQGCFVSGLYLEGADWDIERGCLVKSKPKVLVVDLPILKIIPTEGHRLKLQNTFRTPVYTTSMRRNAMGIGLVFEADLFTAKHISHWVLQGVCLTLNSD 4534          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Mouse
Match: Dnah2 (dynein, axonemal, heavy chain 2 [Source:MGI Symbol;Acc:MGI:107731])

HSP 1 Score: 2325.05 bits (6024), Expect = 0.000e+0
Identity = 1404/4067 (34.52%), Postives = 2254/4067 (55.42%), Query Frame = 1
Query: 1900 WSNFMEDFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEVESIDQLFKTNMNNPPLYHFKSCVAGGISWERHLFYNIKRPILRFLTMDEMMQSDNGKRIRTKYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILALANSENFVSENVPEETIDKMDDDLRVDFGFEINEIITETRNLELLGYKVPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISDY-IEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFKLQSGNKFLKCKEFFEFMESERTSDFEHLGRKYSTIGPLITKLQGEIIGDRDVNPFEKFQPFYEFWEKRIFDRVYNMVLK-NLQDYQNMLRDEN--FPTCLFEVDLMLAGTDVIGNPQTTEIYKLAIQDLRDAVE--ATRVF--IRWKRNSCIETTGMKIDGQDELFYFTFYLDIGNSVEITYFCEQIANYYRNIIGKLRKYQDKWKKHKRVFIPNKQAQIDKWLTKDPTVMDF------YERIRDTIDRKEELLNQPVIRKIGFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDLSLIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSNHPIDQEEIEESDKLRQ---LFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVK-----AMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSS-DCECVQEHMIKMFDNISSLRFTK--GTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEA-VFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLH-------TKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTRE-GMNQD-------TIEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQ-YVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSENAKSDKDYAMTD--PILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEY--SEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEV-AKRKKPYL-WLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLT--KPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTAFPS----LVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQ-TGKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGEPNVM-WLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMG-VGLVVEADLATTEHPS-HWVLQGVCLILNTD 13926
            W      FR  +  +E    + I + F  +R  E    +L  F  + +R+AI +   +K  D+   +  E+  +++  + N   P L  + +  +G   W R L   I R +        +     G+     Y  + + +     K F EW   +DK   + +R+  ++L          + +E +  +D    V+F   +  +  E    E L ++ P    NVA + E    + E LL +   Y+ +I  L   E  +  + I+ + + I PGL++LNW   G S + I +C +     +  V      T+ I  K +E+    L  + +G +  +  EF E     R +  + L + +  +  ++T    E+  + D    ++    Y      + +    + +K +L +    +  +    P  LF V L++   DV G     E +   +Q L   V    + +F  I   R+     T  K++ +        Y+ +    +I     QI++   N    L+ Y   W  ++ ++  NK + I ++   +P V  F      Y  + + + ++E +LN      I F+ ++   L   +  H   W++ +   L E A   LA + + ++ +   +S  P  LEEL   L  + T+Q      E++I  + E++ +L     P+    +E  + L      F  +  +S+ +   L   K KF         DF K   N  + F+ +GP +        L  + +    L  +      L +   +F +      +L  ++KE+  L Q++E+    +++   W    ++ L  + ++    G  +   ++ +E K      + T R+   K+++FK  +PL SDL++ ALRERHW ++  +  + FD   ++FTL  +  + +++  + IAEI  SA+KEL+IE G++ + +TW + +  + PY   G  R   L   +EV Q L+DN + L +M ASRF+  F   V +WE+ LSLI EV+++ + VQR+WMYLE IF+G DIR QLP E+  FD ++  +K IM    K     ++   P  L  L  ++  LE  QKSL+ YL++KR+ FPRF+F+S+D+LL ILG S + E VQ H+ K FDNI  L+  K  G+S +  A  M S + E ++F  PVL+EG VE W+  +E  MR T R + +   V   +    R +W+ D+ G V +  +QI WT +V       K+     +   + L  N+  E +   R  L+K  R K+  ++ I++HARD+++   +  +MD   F+W SQLRFYW ++ D+  I+Q   QF YGYEY+G +GRLVITPLTDR Y+TLT AL ++ GG+P GPAGTGKTET KDL KALG+  +V NC EG+DY+S+G++++GL Q GAWGCFDEFNRI + VLSV++ Q+ +I + L   L+RF+FEG EI L    GIFITMNPGYAGRTELPE++K+ FRP+ ++VPD   I EI+LF +GF + K+LAKK+ TLY L+ +QLS+Q+HYDFGLRAL S+L  AG+ RR  PDLS+++VL+ ++RDMN+ K    D PLF  ++QDLFP ++ P + Y    D++E+ + E    +      K++QLYET  +RH+TM+VG TG  K+   KIL AS T L           +  P+NPK  S+ ELYG  D NT +WTDG+LS++ R +    +K + +++LFDG VD LW+E+MNSVMDDNK+LTL NGERI +    +LLFEV +L  ASPATVSRCGMVY D  +LG+ P+ Q WL K+  K E + L  +++K+I   +             +    ++P+   + +  LC +     T E G+N          +E  F+ S+ WS+   + ED + K D +++ +               G  P++  T+++YY +   + + W  +   +P+ + + P   F +I+VPT+DTVR  +L++  +  Q PVLLVG  GT KT+++Q+ L++    ++  L +N S++TTS ++Q  +ES VEKRTK  Y P  GK ++ F+DD+NMP  D +G+Q P+ +++L ++    YDR K  + K ++D+  +AAMG PGGGR  + PR  S F++ N TFP++S +  I+ ++++   Q F +E+K    ++T+ T+ +YN ++ +  PTP+K HY+FNLRD+S+++QGM +   D         R+W HE  RV  DRL++  D       + ++L         +   +  P +FGD+     + E ++YED+++    K   +  + EY  S +V PM+LVLF +A++H+TRI R I    G+ LLVG+GGSG+QSL +LA+     + F+I +++ Y +++ R+++K LY + G+E ++T F+F D  + +E FLE INN+LSSG VP L+  DE E I + + ++A +  +  S +S++ Y + +  +NLHIVLC+SPVG+  R   R +P +VN TTI+WF  WP +AL  VA  +I   +    ++   ++ + FV +H SV +YS++ + + RR NYVTP NYL+ ++ Y KLL +K +    Q ++L+ GL K+ E   ++  ++ +L   K  V E    CE  L  I  + + A E+++     S+ + ++  + +     A+  L EALP LE+A  AL+ L K D+ EI+S+ +PP  V++V + + + +   E  W  AK  + + +F++SL   D DNI+ K    +     +     D +  VS A   L  +V A+  Y  + R ++PKR ++        + +  L + + ++ ++  +L+ L ++Y+  + +++ L+++++ M+ +L  A  L++GL+ E  RW   +Q L++    L+GDCL+ +AFLSY+G F   +R E++   W   + E ++P S  F +++ LTN  ++  WN +GLP D  S +NGI+ TR +R+ L IDPQ QAL WI   E +  LK       D+L+ LE AI++G P L ++V EY+DP ++ VL K++    GR  + +GDKEV+++PNFR YL TKLSNP Y P    K+ ++N+ V  +GLE QLL ++V+ ER ELEEQ++ L+   +  KR LK+LED +LR L  +TG++LD+ +L+NTL+ +K  A+EV+E+L+    T   ID  R+ YR  A+R ++LFFVL +M  I+ MYQ+SL AY+ +F  S+ KS     L+ R++ +    T  VY Y C  +FE+HKLLF+F +  K+    G L  DE +FF++G   ++   +   P   WL+D  W ++T+L ++    F  L+   E+    W  W  + +PE A LP ++ N     Q++ ++R  R DR+   +T +++  +G  ++ PP+LN + + + STP SP+VFILSPG DP S +++LAE +G    +   +S+GQGQ   A  LL   + +GHW+ L NCHL + W+  L+K +E+L    PHP FRLWL++ P   FPI ILQ S+K+ TEPP GLK N+   Y+   L +   F H + P+    L+F L FFH+++ ER+K+ ++GWNI Y FN+SDF V   +L  YL +  +      PW +LKYLI  V YGG   DD+DRR+L TY+++YF D    T  PF +  S   TY IP+  +     +YI  LP  + PE FG H NA++    + A+ ++  L+ +QPQ T      QSR+E + E A+ +K K+P++ D +  RK   LD SP  VVLLQE++R+N L+  +  SL  L + + G + MS  L+++   +++  +P +W ++ P   K LA+W      R  Q+  W     P V+ WLSG   P  +LTA++Q+  R+N   +D S  +  +      + +      G +V GLYLEGAGWDR   CLV  +P QL+  +P I   P E+ +   +  +  P Y    R  +      V+  DL +    S HW+ +G  L+++ D
Sbjct:  488 WHEDYNKFRGGIKDLEVMTQNLITSAFELVRDVEHGVLLLDTFHRLATREAIMRTYEKKAVDLYMLFNSELALVNR--ELNKKWPYLEPYMTQYSGQAHWVRILRRRIDRVMNCLSGAHFLPHIGTGEESIHTYQQMAQAIDEMVRKTFQEWTATLDK---DCIRRLDMSLLR--------ISQEKVGMLD----VNFDKTLLILFAEIDYWERLLFETPHYVMNVAERAEDLRILRENLLLVARDYNRIIAMLSPDEQALFKERIRFLDKKIHPGLKKLNWALKGASAFFITECRMHASKVQMIVNDFKASTLTIGWKAQEMSELLLVHI-TGKQVYRDLEFEEAQREHRMAAQQKLVKLHQDVVNIMTN-SYEVFKN-DGPEIQQQWLLYTIRLDHMMEDALRLNVKWSLLELSKAINGDGKTTPNPLFRV-LVILQNDVRGGGSQVE-FSPTLQTLASVVNDIGSHLFATISVFRHLPDILTKRKMNRE------PIYVLVERDEDIRKIQAQISSGMTNNASLLQNYLKTWDMYREIWEINKDSFIRRYQRLNPPVSSFDADIARYTEVANNVQKEETVLN------IQFVMLDCSHLKFSLVQHCNEWQNKFTTLLKEMAAGRLADLHSYLKDNAEKISHPPQTLEELGVSLQLMDTLQHDLPNLETQIPPIHEQFTILEKYEVPVPDTVLEMLESLNGEWLTFQQILLDSEQM---LKKHKEKFKTGLIHAADDFKKKAHNLLEDFEFKGPFTSTVGHTAALDQIAQMRAMLMAMRDEENNLRSNLGIFKIEQPVSKDLQILEKELDALQQVWEITRDWEESWNQWKMGCFQTLQTEAMESMAHGLFRRLTRLAKEYKDRNWEIIETTRS---KIEQFKRTMPLISDLRNPALRERHWDQVKEEVQREFDQESESFTLEQIVKLGMDQHVEKIAEISASATKELAIEVGLQNIAKTWDSTQLDIVPYKDKGHHR---LRGTEEVFQALEDNQVALSTMKASRFVKAFEKDVDHWERCLSLILEVIEMVLTVQRQWMYLENIFLGEDIRKQLPNESALFDQVNNNWKAIMDRMNKDNNALRSTHYPGLLETLIEMNAILEDIQKSLDMYLETKRHIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKLLKIQKVGGSSSKWEAVGMFSGDGEYIDFLHPVLLEGPVESWLGDVERAMRMTLRDLLRNCRVALKKFLNKRDKWVKDWAGQVVITASQIQWTADVTKCLMTAKERSDKKILKVSIL--NKYSEAI---RGNLTKIMRLKIVALVTIEIHARDVLEKLYKSGLMDVSSFDWLSQLRFYWEKDVDDCIIRQTNTQFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGIYVIVVNCSEGLDYKSMGRMYSGLAQSGAWGCFDEFNRINIEVLSVVAQQILSILSALTANLTRFYFEGFEINLVWSCGIFITMNPGYAGRTELPENLKSMFRPIAMVVPDSTLIAEIILFGEGFGNCKILAKKVYTLYSLAVQQLSRQDHYDFGLRALTSLLRYAGKKRRLQPDLSDEEVLLLSMRDMNIAKLTSVDVPLFNAIVQDLFPNIELPVIDYGKLRDTIEQEIREMGLQITPFTLTKVLQLYETKNSRHSTMIVGGTGSSKTTSWKILQASLTSLCRAGEPNYNIVREFPLNPKALSLGELYGEYDLNTNEWTDGILSSVMR-VACADEKPDEKWILFDGPVDTLWIESMNSVMDDNKVLTLINGERIAMPEQVSLLFEVENLAVASPATVSRCGMVYTDYVDLGWKPYVQSWLEKRP-KTEVEPLQRMFEKFINKILSF---------KKDNCNELVPVPEYSGIISLCKLYTVLATPENGVNPADAENYSFMVEMTFVFSMIWSVCASVDEDGRKKIDSYLREI--------------EGSFPNK-DTVYEYYVNP--KMRTWTSFEEKLPKSWRYPPNAPFYKIMVPTVDTVRYNYLVSTLVANQNPVLLVGPVGTGKTSIAQSVLQSLPSSQWSVLVVNMSAQTTSNNVQSIIESRVEKRTKGVYVPFGGKSMITFMDDLNMPAKDMFGSQPPLELIRLWIDYGFWYDRVKQ-SIKHIRDMFLMAAMGPPGGGRTVISPRLQSRFNIINMTFPTESQIIRIFGTMINQKLQDFEEEVKPIGNVVTEATLDVYNTVVQRFLPTPAKIHYLFNLRDISKVFQGMLRANKDFHDTKASITRLWIHECFRVFSDRLVDTADMEAFMGILSDKLGTFFDLTFHHLCPNKRPPIFGDF-----LKEPKVYEDLVDLTVLKTAMETALNEYNLSPSVVPMQLVLFREAIEHITRIVRVIGQPRGNMLLVGIGGSGRQSLARLASSICDYNTFQIEVTKHYRKQEFRDDIKRLYRQAGVELQTTSFLFVDTQIADESFLEDINNILSSGEVPNLYKSDEFEEIQNHIIDQARAEQIPESSDSLFAYLIERVRNNLHIVLCLSPVGDPFRNWIRQYPALVNCTTINWFSEWPREALLEVAEKYIIGVDLGTQENIHRKVAQIFVTMHWSVAQYSQKMLLELRRYNYVTPTNYLELVSGYKKLLGEKRQELLDQANKLRTGLFKIDETREKVEVMSLELEDAKKKVAEFQKQCEEYLVIIVQQKREADEQQKAVTANSEKIAIEEVKCQALADNAQKDLEEALPALEEAMRALESLNKKDIGEIKSYGRPPAQVEIVMQAVMILRG-NEPTWAEAKRQLGEQNFIKSLINFDKDNISDKVLKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAAMAQLQEKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEETVQGLEEDLGYLVGDCLIAAAFLSYMGPFLTNYRDEIINQIWIRKIRELQVPCSPRFAIDNFLTNPTKVRDWNIQGLPSDAFSTENGIIVTRGNRWALMIDPQGQALKWIKNMEGNQGLKIIDLQMHDYLRVLEHAIQFGFPVLLQNVQEYLDPTLNPVLNKSVARIGGRMLIRIGDKEVEYNPNFRFYLTTKLSNPHYNPETSAKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIAAGKRKLKELEDEILRLLNEATGSLLDDVQLVNTLQTSKITATEVTEQLETSETTEINIDLAREAYRPCAQRASVLFFVLNDMGRIDPMYQFSLDAYIGLFILSIDKSHRSNKLEDRIEYLNDYHTYAVYRYTCRTLFERHKLLFSFHMCAKILETSGKLNMDEYNFFLRGGVVLDREGQMDNPCTSWLADAYWDNITELDKL--TNFHGLMNSFEQYPRDWHLWYTNSSPEKAMLPGEWENACNEMQRMLIVRSLRQDRVAFCVTSFIVSNLGSRFIEPPVLNMKSVMEDSTPRSPLVFILSPGVDPTSALLQLAEHTGMA-HRFHALSLGQGQAPIAARLLREGVNQGHWVFLANCHLSLSWMPNLDKLVEQLQVEDPHPSFRLWLSSSPHPDFPISILQASIKMTTEPPKGLKANMTRLYQ---LMTEAQFTHCSKPAKYKKLLFALCFFHSILLERKKFLQLGWNIIYGFNDSDFEVSENLLSLYLDEYEE-----TPWDALKYLIAGVNYGGHVTDDWDRRLLTTYINDYFCDLSLTT--PF-YRLSVLDTYYIPKDGSLASYKEYISMLPSMDPPEAFGQHPNADVASQITEARTLFETLLSLQPQITPTRVGGQSREEKVLELAADVKQKIPEMIDYEGTRKLLALDPSPLNVVLLQEIQRYNKLMKTILFSLTDLEKGIQGLIVMSTSLEEIFNCIFDAHVPPLWGKVYPSQ-KPLASWTRDLAVRVEQFETWASRARPPVLFWLSGFTFPTGFLTAVLQSAARQNNISVD-SLSWEFIVSTVDDSNLVYPPKDGVWVRGLYLEGAGWDRKNSCLVEAEPMQLVCLMPTIHFRPAESRKKSAKGMYSCPCYYYPNRAGSTDRASFVIGIDLRSGSMTSDHWIKRGTALLMSLD 4455          

HSP 2 Score: 72.4034 bits (176), Expect = 1.966e-11
Identity = 54/201 (26.87%), Postives = 106/201 (52.74%), Query Frame = 1
Query:  901 RDEFLISLKKFTSIVDQTIIQIASEVKLEIPDLDLFENDKENLSDKEIMEMIESTVLKWDQQITGTLESLQKIVPHGPS--PLAEIDFWRERNAXXXXXXXXXXXPKVKRILNLYSLAEGPV---FDTQNNELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIA 1488
            R+ F+  L +F + +  T  ++     L IP   +  + +  + DKE+++ +E++++ W +QI   L S Q+ V  G +  PL EI+FW  R   LS++ +QL    VK I ++  LA+      F     ++     +A+ N  FLS++   ++ +A+ +    +++ +P ++  +R+IW+ S HYN  ER+  L  ++ 
Sbjct:  229 RNHFVSHLHRFLASLTDTRYKLEGHTVLYIPAEAVQMDPEVVVKDKELVQRLETSMIHWTRQIKEVL-SAQESVETGENLGPLEEIEFWHNRCMDLSSISKQLVKKGVKHIESILFLAKSSYLTPFRKLAQQIQDGSRQAQSNLTFLSILREPYQELAF-MKPKDISEKLPKLISLIRIIWVNSPHYNTRERLTALFRKVC 427          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Mouse
Match: Dnah2 (dynein, axonemal, heavy chain 2 [Source:MGI Symbol;Acc:MGI:107731])

HSP 1 Score: 2321.2 bits (6014), Expect = 0.000e+0
Identity = 1403/4068 (34.49%), Postives = 2253/4068 (55.38%), Query Frame = 1
Query: 1900 WSNFMEDFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEVESIDQLFKTNMNNPPLYHFKSCVAGGISWERHLFYNIKRPILRFLTMDEMMQSDNGKRIRTKYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILALANSENFVSENVPEETIDKMDDDLRVDFGFEINEIITETRNLELLGYKVPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISDY-IEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFKLQSGNKFLKCKEFFEFMESERTSDFEHLGRKYSTIGPLITKLQGEIIGDRDVNPFEKFQPFYEFWEKRIFDRVYNMVLK-NLQDYQNMLRDEN--FPTCLFEVDLMLAGTDVIGNPQTTEIYKLAIQDLRDAVE--ATRVF--IRWKRNSCIETTGMKIDGQDELFYFTFYLDIGNSVEITYFCEQIANYYRNIIGKLRKYQDKWKKHKRVFIPNKQAQIDKWLTKDPTVMDF------YERIRDTIDRKEELLNQPVIRKIGFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDLSLIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSNHPIDQEEIEESDKLRQ---LFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVK-----AMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSS-DCECVQEHMIKMFDNISSLRFTK--GTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEA-VFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQI-DEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLH-------TKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTRE-GMNQD-------TIEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQ-YVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSENAKSDKDYAMTD--PILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEY--SEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEV-AKRKKPYL-WLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLT--KPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTAFPS----LVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQ-TGKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGEPNVM-WLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMG-VGLVVEADLATTEHPS-HWVLQGVCLILNTD 13926
            W      FR  +  +E    + I + F  +R  E    +L  F  + +R+AI +   +K  D+   +  E+  +++  + N   P L  + +  +G   W R L   I R +        +     G+     Y  + + +     K F EW   +DK   + +R+  ++L          + +E +  +D    V+F   +  +  E    E L ++ P    NVA + E    + E LL +   Y+ +I  L   E  +  + I+ + + I PGL++LNW   G S + I +C +     +  V      T+ I  K +E+    L  + +G +  +  EF E     R +  + L + +  +  ++T    E+  + D    ++    Y      + +    + +K +L +    +  +    P  LF V L++   DV G     E +   +Q L   V    + +F  I   R+     T  K++ +        Y+ +    +I     QI++   N    L+ Y   W  ++ ++  NK + I ++   +P V  F      Y  + + + ++E +LN      I F+ ++   L   +  H   W++ +   L E A   LA + + ++ +   +S  P  LEEL   L  + T+Q      E++I  + E++ +L     P+    +E  + L      F  +  +S+ +   L   K KF         DF K   N  + F+ +GP +        L  + +    L  +      L +   +F +      +L  ++KE+  L Q++E+    +++   W    ++ L  + ++    G  +   ++ +E K      + T R+   K+++FK  +PL SDL++ ALRERHW ++  +  + FD   ++FTL  +  + +++  + IAEI  SA+KEL+IE G++ + +TW + +  + PY   G  R   L   +EV Q L+DN + L +M ASRF+  F   V +WE+ LSLI EV+++ + VQR+WMYLE IF+G DIR QLP E+  FD ++  +K IM    K     ++   P  L  L  ++  LE  QKSL+ YL++KR+ FPRF+F+S+D+LL ILG S + E VQ H+ K FDNI  L+  K  G+S +  A  M S + E ++F  PVL+EG VE W+  +E  MR T R + +   V   +    R +W+ D+ G V +  +QI WT +V       K+     +    K     I ++    +R  L+K  R K+  ++ I++HARD+++   +  +MD   F+W SQLRFYW ++ D+  I+Q   QF YGYEY+G +GRLVITPLTDR Y+TLT AL ++ GG+P GPAGTGKTET KDL KALG+  +V NC EG+DY+S+G++++GL Q GAWGCFDEFNRI + VLSV++ Q+ +I + L   L+RF+FEG EI L    GIFITMNPGYAGRTELPE++K+ FRP+ ++VPD   I EI+LF +GF + K+LAKK+ TLY L+ +QLS+Q+HYDFGLRAL S+L  AG+ RR  PDLS+++VL+ ++RDMN+ K    D PLF  ++QDLFP ++ P + Y    D++E+ + E    +      K++QLYET  +RH+TM+VG TG  K+   KIL AS T L           +  P+NPK  S+ ELYG  D NT +WTDG+LS++ R +    +K + +++LFDG VD LW+E+MNSVMDDNK+LTL NGERI +    +LLFEV +L  ASPATVSRCGMVY D  +LG+ P+ Q WL K+  K E + L  +++K+I   +             +    ++P+   + +  LC +     T E G+N          +E  F+ S+ WS+   + ED + K D +++ +               G  P++  T+++YY +   + + W  +   +P+ + + P   F +I+VPT+DTVR  +L++  +  Q PVLLVG  GT KT+++Q+ L++    ++  L +N S++TTS ++Q  +ES VEKRTK  Y P  GK ++ F+DD+NMP  D +G+Q P+ +++L ++    YDR K  + K ++D+  +AAMG PGGGR  + PR  S F++ N TFP++S +  I+ ++++   Q F +E+K    ++T+ T+ +YN ++ +  PTP+K HY+FNLRD+S+++QGM +   D         R+W HE  RV  DRL++  D       + ++L         +   +  P +FGD+     + E ++YED+++    K   +  + EY  S +V PM+LVLF +A++H+TRI R I    G+ LLVG+GGSG+QSL +LA+     + F+I +++ Y +++ R+++K LY + G+E ++T F+F D  + +E FLE INN+LSSG VP L+  DE E I + + ++A +  +  S +S++ Y + +  +NLHIVLC+SPVG+  R   R +P +VN TTI+WF  WP +AL  VA  +I   +    ++   ++ + FV +H SV +YS++ + + RR NYVTP NYL+ ++ Y KLL +K +    Q ++L+ GL K+ E   ++  ++ +L   K  V E    CE  L  I  + + A E+++     S+ + ++  + +     A+  L EALP LE+A  AL+ L K D+ EI+S+ +PP  V++V + + + +   E  W  AK  + + +F++SL   D DNI+ K    +     +     D +  VS A   L  +V A+  Y  + R ++PKR ++        + +  L + + ++ ++  +L+ L ++Y+  + +++ L+++++ M+ +L  A  L++GL+ E  RW   +Q L++    L+GDCL+ +AFLSY+G F   +R E++   W   + E ++P S  F +++ LTN  ++  WN +GLP D  S +NGI+ TR +R+ L IDPQ QAL WI   E +  LK       D+L+ LE AI++G P L ++V EY+DP ++ VL K++    GR  + +GDKEV+++PNFR YL TKLSNP Y P    K+ ++N+ V  +GLE QLL ++V+ ER ELEEQ++ L+   +  KR LK+LED +LR L  +TG++LD+ +L+NTL+ +K  A+EV+E+L+    T   ID  R+ YR  A+R ++LFFVL +M  I+ MYQ+SL AY+ +F  S+ KS     L+ R++ +    T  VY Y C  +FE+HKLLF+F +  K+    G L  DE +FF++G   ++   +   P   WL+D  W ++T+L ++    F  L+   E+    W  W  + +PE A LP ++ N     Q++ ++R  R DR+   +T +++  +G  ++ PP+LN + + + STP SP+VFILSPG DP S +++LAE +G    +   +S+GQGQ   A  LL   + +GHW+ L NCHL + W+  L+K +E+L    PHP FRLWL++ P   FPI ILQ S+K+ TEPP GLK N+   Y+   L +   F H + P+    L+F L FFH+++ ER+K+ ++GWNI Y FN+SDF V   +L  YL +  +      PW +LKYLI  V YGG   DD+DRR+L TY+++YF D    T  PF +  S   TY IP+  +     +YI  LP  + PE FG H NA++    + A+ ++  L+ +QPQ T      QSR+E + E A+ +K K+P++ D +  RK   LD SP  VVLLQE++R+N L+  +  SL  L + + G + MS  L+++   +++  +P +W ++ P   K LA+W      R  Q+  W     P V+ WLSG   P  +LTA++Q+  R+N   +D S  +  +      + +      G +V GLYLEGAGWDR   CLV  +P QL+  +P I   P E+ +   +  +  P Y    R  +      V+  DL +    S HW+ +G  L+++ D
Sbjct:  488 WHEDYNKFRGGIKDLEVMTQNLITSAFELVRDVEHGVLLLDTFHRLATREAIMRTYEKKAVDLYMLFNSELALVNR--ELNKKWPYLEPYMTQYSGQAHWVRILRRRIDRVMNCLSGAHFLPHIGTGEESIHTYQQMAQAIDEMVRKTFQEWTATLDK---DCIRRLDMSLLR--------ISQEKVGMLD----VNFDKTLLILFAEIDYWERLLFETPHYVMNVAERAEDLRILRENLLLVARDYNRIIAMLSPDEQALFKERIRFLDKKIHPGLKKLNWALKGASAFFITECRMHASKVQMIVNDFKASTLTIGWKAQEMSELLLVHI-TGKQVYRDLEFEEAQREHRMAAQQKLVKLHQDVVNIMTN-SYEVFKN-DGPEIQQQWLLYTIRLDHMMEDALRLNVKWSLLELSKAINGDGKTTPNPLFRV-LVILQNDVRGGGSQVE-FSPTLQTLASVVNDIGSHLFATISVFRHLPDILTKRKMNRE------PIYVLVERDEDIRKIQAQISSGMTNNASLLQNYLKTWDMYREIWEINKDSFIRRYQRLNPPVSSFDADIARYTEVANNVQKEETVLN------IQFVMLDCSHLKFSLVQHCNEWQNKFTTLLKEMAAGRLADLHSYLKDNAEKISHPPQTLEELGVSLQLMDTLQHDLPNLETQIPPIHEQFTILEKYEVPVPDTVLEMLESLNGEWLTFQQILLDSEQM---LKKHKEKFKTGLIHAADDFKKKAHNLLEDFEFKGPFTSTVGHTAALDQIAQMRAMLMAMRDEENNLRSNLGIFKIEQPVSKDLQILEKELDALQQVWEITRDWEESWNQWKMGCFQTLQTEAMESMAHGLFRRLTRLAKEYKDRNWEIIETTRS---KIEQFKRTMPLISDLRNPALRERHWDQVKEEVQREFDQESESFTLEQIVKLGMDQHVEKIAEISASATKELAIEVGLQNIAKTWDSTQLDIVPYKDKGHHR---LRGTEEVFQALEDNQVALSTMKASRFVKAFEKDVDHWERCLSLILEVIEMVLTVQRQWMYLENIFLGEDIRKQLPNESALFDQVNNNWKAIMDRMNKDNNALRSTHYPGLLETLIEMNAILEDIQKSLDMYLETKRHIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKLLKIQKVGGSSSKWEAVGMFSGDGEYIDFLHPVLLEGPVESWLGDVERAMRMTLRDLLRNCRVALKKFLNKRDKWVKDWAGQVVITASQIQWTADVTKCLMTAKERSDKKILKVMKKKQVSILNKYSEAIRGNLTKIMRLKIVALVTIEIHARDVLEKLYKSGLMDVSSFDWLSQLRFYWEKDVDDCIIRQTNTQFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGIYVIVVNCSEGLDYKSMGRMYSGLAQSGAWGCFDEFNRINIEVLSVVAQQILSILSALTANLTRFYFEGFEINLVWSCGIFITMNPGYAGRTELPENLKSMFRPIAMVVPDSTLIAEIILFGEGFGNCKILAKKVYTLYSLAVQQLSRQDHYDFGLRALTSLLRYAGKKRRLQPDLSDEEVLLLSMRDMNIAKLTSVDVPLFNAIVQDLFPNIELPVIDYGKLRDTIEQEIREMGLQITPFTLTKVLQLYETKNSRHSTMIVGGTGSSKTTSWKILQASLTSLCRAGEPNYNIVREFPLNPKALSLGELYGEYDLNTNEWTDGILSSVMR-VACADEKPDEKWILFDGPVDTLWIESMNSVMDDNKVLTLINGERIAMPEQVSLLFEVENLAVASPATVSRCGMVYTDYVDLGWKPYVQSWLEKRP-KTEVEPLQRMFEKFINKILSF---------KKDNCNELVPVPEYSGIISLCKLYTVLATPENGVNPADAENYSFMVEMTFVFSMIWSVCASVDEDGRKKIDSYLREI--------------EGSFPNK-DTVYEYYVNP--KMRTWTSFEEKLPKSWRYPPNAPFYKIMVPTVDTVRYNYLVSTLVANQNPVLLVGPVGTGKTSIAQSVLQSLPSSQWSVLVVNMSAQTTSNNVQSIIESRVEKRTKGVYVPFGGKSMITFMDDLNMPAKDMFGSQPPLELIRLWIDYGFWYDRVKQ-SIKHIRDMFLMAAMGPPGGGRTVISPRLQSRFNIINMTFPTESQIIRIFGTMINQKLQDFEEEVKPIGNVVTEATLDVYNTVVQRFLPTPAKIHYLFNLRDISKVFQGMLRANKDFHDTKASITRLWIHECFRVFSDRLVDTADMEAFMGILSDKLGTFFDLTFHHLCPNKRPPIFGDF-----LKEPKVYEDLVDLTVLKTAMETALNEYNLSPSVVPMQLVLFREAIEHITRIVRVIGQPRGNMLLVGIGGSGRQSLARLASSICDYNTFQIEVTKHYRKQEFRDDIKRLYRQAGVELQTTSFLFVDTQIADESFLEDINNILSSGEVPNLYKSDEFEEIQNHIIDQARAEQIPESSDSLFAYLIERVRNNLHIVLCLSPVGDPFRNWIRQYPALVNCTTINWFSEWPREALLEVAEKYIIGVDLGTQENIHRKVAQIFVTMHWSVAQYSQKMLLELRRYNYVTPTNYLELVSGYKKLLGEKRQELLDQANKLRTGLFKIDETREKVEVMSLELEDAKKKVAEFQKQCEEYLVIIVQQKREADEQQKAVTANSEKIAIEEVKCQALADNAQKDLEEALPALEEAMRALESLNKKDIGEIKSYGRPPAQVEIVMQAVMILRG-NEPTWAEAKRQLGEQNFIKSLINFDKDNISDKVLKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAAMAQLQEKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEETVQGLEEDLGYLVGDCLIAAAFLSYMGPFLTNYRDEIINQIWIRKIRELQVPCSPRFAIDNFLTNPTKVRDWNIQGLPSDAFSTENGIIVTRGNRWALMIDPQGQALKWIKNMEGNQGLKIIDLQMHDYLRVLEHAIQFGFPVLLQNVQEYLDPTLNPVLNKSVARIGGRMLIRIGDKEVEYNPNFRFYLTTKLSNPHYNPETSAKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIAAGKRKLKELEDEILRLLNEATGSLLDDVQLVNTLQTSKITATEVTEQLETSETTEINIDLAREAYRPCAQRASVLFFVLNDMGRIDPMYQFSLDAYIGLFILSIDKSHRSNKLEDRIEYLNDYHTYAVYRYTCRTLFERHKLLFSFHMCAKILETSGKLNMDEYNFFLRGGVVLDREGQMDNPCTSWLADAYWDNITELDKL--TNFHGLMNSFEQYPRDWHLWYTNSSPEKAMLPGEWENACNEMQRMLIVRSLRQDRVAFCVTSFIVSNLGSRFIEPPVLNMKSVMEDSTPRSPLVFILSPGVDPTSALLQLAEHTGMA-HRFHALSLGQGQAPIAARLLREGVNQGHWVFLANCHLSLSWMPNLDKLVEQLQVEDPHPSFRLWLSSSPHPDFPISILQASIKMTTEPPKGLKANMTRLYQ---LMTEAQFTHCSKPAKYKKLLFALCFFHSILLERKKFLQLGWNIIYGFNDSDFEVSENLLSLYLDEYEE-----TPWDALKYLIAGVNYGGHVTDDWDRRLLTTYINDYFCDLSLTT--PF-YRLSVLDTYYIPKDGSLASYKEYISMLPSMDPPEAFGQHPNADVASQITEARTLFETLLSLQPQITPTRVGGQSREEKVLELAADVKQKIPEMIDYEGTRKLLALDPSPLNVVLLQEIQRYNKLMKTILFSLTDLEKGIQGLIVMSTSLEEIFNCIFDAHVPPLWGKVYPSQ-KPLASWTRDLAVRVEQFETWASRARPPVLFWLSGFTFPTGFLTAVLQSAARQNNISVD-SLSWEFIVSTVDDSNLVYPPKDGVWVRGLYLEGAGWDRKNSCLVEAEPMQLVCLMPTIHFRPAESRKKSAKGMYSCPCYYYPNRAGSTDRASFVIGIDLRSGSMTSDHWIKRGTALLMSLD 4461          

HSP 2 Score: 72.4034 bits (176), Expect = 2.067e-11
Identity = 54/201 (26.87%), Postives = 106/201 (52.74%), Query Frame = 1
Query:  901 RDEFLISLKKFTSIVDQTIIQIASEVKLEIPDLDLFENDKENLSDKEIMEMIESTVLKWDQQITGTLESLQKIVPHGPS--PLAEIDFWRERNAXXXXXXXXXXXPKVKRILNLYSLAEGPV---FDTQNNELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIA 1488
            R+ F+  L +F + +  T  ++     L IP   +  + +  + DKE+++ +E++++ W +QI   L S Q+ V  G +  PL EI+FW  R   LS++ +QL    VK I ++  LA+      F     ++     +A+ N  FLS++   ++ +A+ +    +++ +P ++  +R+IW+ S HYN  ER+  L  ++ 
Sbjct:  229 RNHFVSHLHRFLASLTDTRYKLEGHTVLYIPAEAVQMDPEVVVKDKELVQRLETSMIHWTRQIKEVL-SAQESVETGENLGPLEEIEFWHNRCMDLSSISKQLVKKGVKHIESILFLAKSSYLTPFRKLAQQIQDGSRQAQSNLTFLSILREPYQELAF-MKPKDISEKLPKLISLIRIIWVNSPHYNTRERLTALFRKVC 427          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Mouse
Match: Dnah9 (dynein, axonemal, heavy chain 9 [Source:MGI Symbol;Acc:MGI:1289279])

HSP 1 Score: 2239.15 bits (5801), Expect = 0.000e+0
Identity = 1431/4392 (32.58%), Postives = 2389/4392 (54.39%), Query Frame = 1
Query: 1033 DKEIMEMIESTVLKWDQQITGTL--ESLQKIVP-HGPSPLAEIDFWRERNAXXXXXXXXXXXPKVKRILNLYSLAEG---PVFDTQNNELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIAWNLSDRVARLIDVNTIFNLPLEHVLKDTAEAEKMLRVWNDT-----------------YFEVRASIEASGRDARWEFDRKRLFEKTNYMADICH---DLNEIAMILQ-----EFYNIFGPELKSVTNEAKRIXXXXXXXXXXXXPLKEMPFNPFNLMKHKYDWSNFMEDFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEVESIDQLFKTNMNN------PPLYHFKSCVAGGISWERHLFYNIKRPILRFLTMDEM-MQSDNGKRIRTKYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILALANSENFVSENVPEETIDKMDDDLRVDFGFEINEIITETRNLELLGYK-VPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISDYIEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFKLQSGNKFLKCKEFFEFMESERTSDFEHLGRKYSTI---GPLITKLQGEIIGDRDVNPFEK-FQPFYEFWEKRIFDRVYNMVLKNLQDYQNMLRDENFPTCLFEVDLMLAGTDVIGNPQTTEIYKLAIQDLRDAVEATRVFI------RWKRNSCIETTGMKIDGQDELFYFTFYLDIGNSVEITYFC---EQIANYYRNIIGKLRKYQDKWKKHKRVFIPNK-QAQIDKWLTKDPTVMDFYERIRDTIDRKEELLNQ-----PVIRKIGFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDL--SLIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSNHPIDQEEIEESDKLRQLFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGG-DIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDC-ECVQEHMIKMFDNISSLRFTKGTSLEMSATA--MISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTREGMNQDTIEAI----FIQSIYWSLGGCLIEDSQVKF-DQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQM--FSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSEN-AKSDKDYAMTDPI-LFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVF-----KNYKEINWKVAKGMMAD-PSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMS-----DPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKRKKPYLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKF--ISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLR-ELEKDLERLTKPHPDFRLWLTTEPTEA-----FPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNH-TAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYIES-LPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTGKSGSSQ--SRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENG-EPNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMGVGLVVEADLATTEHPSHWVLQGVCLIL 13917
            DK  +  +ES V+KW  Q+   L  ES Q ++    P+P  E++FW+ R   L  +  QL   KVK +  L    +    P F     ++     EA+D    L  +++H   I   V F  V   + P++  + +IW   + Y    R+  L++ I  NL      LI   + +  P + +  +  E++K L+V +DT                 YF+  + +        W+F    +F + +      H   DL + A+ L      EF  + G    S++ + +R+ E  +++ ++         +P        ++ N + +F ++V  ++ +    +   F      E AF +L     +  R  + + ++QK+  ++  +  E++++  ++  ++         P++     +AGGI W + L   +K P   F  +  + +QS  GKR+  KY ++   +  +E + + +W     + +SE  + N+            ++P    D     L V+F  ++  ++ E   L+    K +PE A  +    E+Y ++V  L  M   Y+ VIK L  +E  ++ +E++ +   +R     L+W + GI DY  +   ++H  E ++        +I+  +K    + +FK + G K     E+   ++ ++    +H+ + YS I   G  I  L  E +     +P    ++ +  + +  + D  +  +  +L+        +   T +FE  L L   +++ +P      K  + D+  ++  TR+F       R   +S        ++   +L      L       +T  C     ++ Y    +   ++   ++  +  V  P + +A  +  + ++P ++  +   +D ID  E+L  +     P     G++ V+++   + + +  K+W  ++   L +    +L+ + + I    + L   +   D + L  ++  + T++      +     +++   +L      + +   ++ ++L + + ++   +  V  ++ P++     + ++  S F  + + F ++F++E P     D      +L  +H E+  +E     ++ +  LF + +  Y +L   +KE   L ++++       +   W  T W+N+ ++ +D   + F +  R + +E ++      L   +     +L   ++L++ A+R+RHW++LM  TG NF +N DT TL+ +  ++L+ F+D +  IV  A KE+S+EK ++E++ TW +++F    Y    + R  +L + ++++++L+DN + LQ++  S+++  FL  V +W+K LS    V+ +W  VQR W +LE IFIG  DIR+QLP+++K+F+ ID  F+++  +  K P + +A         L ++   L  C+K+L +YLD+KR +FPRF+F+S  +LL IL +    + VQ H+ K+FDN++ ++F    S   + T+  M S E+E + F       G+VE W+ ++   M+ T R    E V  Y E K R QW+FDY   VAL   QIWWT EV   F ++++G ++A+KDY K    Q+  ++  +  PLSK DR K+ T+  IDVHARD+V   +   + +A+ F W SQLR  W  EA       C  QF Y YEY+G   RLVITPLTDR Y+TLTQ+L + + GAPAGPAGTGKTETTKDL +ALG++  V NC E MDY+S G I+ GL Q GAWGCFDEFNRI V VLSV++ Q+K+IQ+ +  K  RF F G+EI LD  VGIFITMNPGYAGRTELPE++KA FRP  ++VPD + I EIML ++GF+ A++LA+K  TLYRL KE LSKQ+HYD+GLRA+KSVLV+AG L+R DPD  ED+VLMR+LRD N+PK + +D P+F+GLI DLFP LD PR R  DF   V + + + K     +   K+VQL E +  RH+  VVG  G GKS V++ L  +   ++       +NPK  +  EL+GI++P TR+W DGL S+I RE+      +  +++L DGD+D +W+E++N+VMDDNK+LTLA+ ERI L     LLFE+  L+ A+PATVSR G++Y++P +LG+NP    W++++E + E   L  L+ KY+P  +D +           + K IIP+   +++  LC +L+C LT+E +  D  + I    F+ +  W+ G  +I+D  V +  +F K               K  + PS+  T+FDYY D   E +++ PWA L+PQ+  +PE      LV T +T+R+ + +   ++ +RPV+LVG  G+ K+ +    L + +P++Y+   + F+  TTS  +Q  LE  +EK+   +YGPP  ++L+ FIDDMNMP+VD YGT QP  +++  L+    YDR K L+ K++ ++ +++ M  P  G   ++PR    FSVF   FP   +L SIYS+IL+ H +   F   ++ ++P +  + +T + +I     PT  KFHYIFNLRD + I+QG+  ++++    +    +++ HE +RV  D+++ + D     K   E L +N   S++    T  + ++  + N   + E + Y  + +++       E +E ++E  + M LVLF+DA+ H+  I+R +    G+ALLVGVGGSGKQSLTKLAA+  S D+F+I L +GY   D + +L +L  K G++N STVF+  D HV +E FL LIN++L+SG +P L+ D+E E II+ VRNE  S G+  S+E+ W++F+ +    L + LC SPVG  LR R R FP +VN T I+WF  WP++AL +V+  F+    ++ P  ++  I K    VH+SV + S+ ++   +R NY TPK++L+FI  Y  LLE   K  +++ +RL+ GL KL   S Q+ +L  KLA Q+V +  K    + L++ +   T   + +K IA E+ Q V +   E+++++ + E  L +A P L  A+ AL+ L K ++ E++SF  PP  V  VS  + V      K  K+ +WK AK  MA   SFL SL   D +NI       +R  L       + + + S A  GL  +V  ++ + +V  +++PKR+ + +        + +L  +K +I  L   L  L  ++E A  E+ + Q+E ++    ++ A++L+ GL+SEN RW   +Q  + Q+  L GD L+ +AF+SY+G F+ ++RK ++   W+  + + K+P+      DP R+   LT+D E++ W +EGLP D +S++N  +     R+PL +DPQ Q + WI  K     L+         L+ +E A++ G   L ++++E IDPV+  +L + +   +GR F+ +GDKE +F+P FRL L+TKL+NP Y P +  ++ +IN+TVT  GLEDQLL+ +V  ER +LE+ +  L ++ +  K  LK LED+LL  L++++GN L  T L+  LE TK  A++V EK++    T  +I++ R+ YR AA R ++L+F++ ++S I+ MYQ+SL A+  VF+ +++K+ P  ++ +R+ N++ ++T +VY Y   G+FE  KL +  Q+T ++ +    +   ELDF ++            P  +LS  +W  +  L+ M   +F  L  DIE    SWK+++  E PE    P+++ NK  + Q+LC++R  R DR+  A+  +V E++G +YV    L+F    ++S P +P+ FILSPG DP  DV    ++ G+      F  +S+GQGQE  A+  LD A  +GHW+ILQN HL+ KWL    +K  E   + HPDFR++++ EP  +      P GIL+ S+K+  EPP G+  NL    +     +L   +  T F +++F L +FHAVV ERRK+G  GWN  Y FN  D  + + +L  +L     + ++K+P+  L+YL GE+MYGG   DD+DRR+ RTY++E+    + +         S    + +P         +YI++ LP E +P ++GLH NAEIG+ T  +++++  ++++QP+  ++G     +R+E +      I  ++   F++  L  K   + +P IVV LQE ER NIL   + +SL  L   L GE+ M++E++++  +LY   +P+ W R A  +   LA W     +R  +   W  +   P+ +WL+G   P+S+LTA++Q+  RKN WPLD+  L   VT+     E      +G +++GL++EGA WD     +   K K L   +PV+ +  I A +   ++ +  PVY T QR    G   V   +L T E+PS WVL GV L+L
Sbjct:  208 DKSTLYAVESAVIKWSHQVQVVLKRESSQALIQGQNPTPKVELEFWKSRCEDLEHIYNQLMTIKVKGMAELLDKLQSSYLPAFKAMFRDVEAALTEAQDIHVHLLPLQQHL-DILENVEFPKVKGRLRPLLHVVCLIWATCKWYRSPGRLTVLLQEIC-NL------LIQQASNYLSPEDLLRSEVEESQKKLQVVSDTLSFFKQAFQDRREHLHTYFKEDSEVRV------WDFQASLVFVRLDGFLGRVHMVEDLLKTALDLNNLEKLEFSGLRG---NSLSQKVQRMHEEFEEMYKVFLDCSYDCLDP-----KGTEFENDVCEFNKRVEDLDRRLGTILIQAFDDAPDVEHAFKLLDITGTLIKRPLVAQDVSQKYLALIRMFSTELDAVRVIYSQHIQKEAEHGFSPVHKNMPTMAGGICWAQELRQRVKGPFGNFKNIPHLYLQSAEGKRMIQKYEDLLSLLEEYERRLYEDWC----QTVSEKSQYNL------------SLPLLHRDPNTKQLSVNFNPQLISVLKEMNYLQPSEVKTIPETAAAMFSSREFYRQLVANLELMANWYNKVIKILLEVEFPLVEEELQNIDLRLRAAEETLSWKTEGIWDYAMQITNSIHDLEQRIQKTKDNVEEIQNIMKTW-VSPIFKRKDGKK-----EWPLSLDDQQ----DHMEKYYSLIQESGLKIHALVQENLVLFAADPASSIWKSYVNYIDSMLLDGFFLAIECSLKYLLENTECKPGLTPVFEAQLNLVTPELVFHPSLDSGVKGGLYDIVQSL-VTRIFAMPSLVPRLSPHSGSPHYQGDLEDMADLAGLRSVLMERVQNMMTLCCGYRNTLSQYSYLYVEDRKEILGQFLLYGHVLTPEEIEAHAEDGIPENPPLLHHF---KDQIDSYEKLYEEVVSLEPTKVFDGWMRVDVRPFKASLLNTIKKWSLMFKQHLVDFVTNSLSDLDSFIRSTESGLLKRVEKGDFQGLVEIMGHLVTLKERQSSTDDMFEPLKQTIELLKSYEQELPETVFKQLEELPEKWKNMKKMAITVRQQVAPLQANEVALLRQRCSAFDDEQQQFQERFRKEAPFRF--DSINPHQMLDAWHVEIQHMESTMATISKSADLFEVNVPDYKQLRQCRKEACQLKELWDTIGMVTSSIRAWEATSWRNISVEAMDSECKQFARHIRNLDKEFRSWDAFTGLESTVLNTLTSLRAVAELQNPAIRDRHWRQLMQATGVNFTMNQDT-TLAHLLQLQLHHFEDEVRGIVDRAVKEMSMEKTLKELQTTWASMEFQ---YESHARTRVPLLQSDEDLIEVLEDNQVQLQNLMMSKYVAFFLEEVSSWQKKLSTADSVISIWFEVQRTWSHLESIFIGSEDIRAQLPQDSKRFEGIDSDFRELAYDAQKTPNVVEATNKSGLYEKLEDIQSRLCLCEKALAEYLDTKRLSFPRFYFLSSSDLLDILSNGTAPQQVQRHLSKLFDNMAKMQFQLDASQNPTKTSLGMYSKEEEYVAFSEACDCSGQVEIWLNRVLRHMKATVRHEMTEGVTAYEE-KPRDQWLFDYPAQVALTCTQIWWTTEVGIAFARLEEGYESAMKDYYKKQVAQLKTLITMLIGPLSKGDRQKIMTICTIDVHARDVVAKMIAQKVDNAQAFLWLSQLRHRWDDEAKHCFANICDAQFLYSYEYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKSCGNIYKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKSIQDAIRDKKQRFSFLGEEISLDPSVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELISEIMLVAEGFIEARLLARKFITLYRLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDPDRPEDQVLMRSLRDFNIPKIVTDDMPVFMGLIGDLFPALDVPRKRDLDFEAVVRKAIVDLKLQAEDNFVLKVVQLEELLAVRHSVFVVGGAGTGKSQVLRSLHKTYQIMRRRPVWTDLNPKAVTNDELFGIINPATREWKDGLFSSIMREL-AIISHDGPKWILLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLNPTMRLLFEISHLRTATPATVSRAGILYINPADLGWNPPVSSWIDQREVQTERANLTILFDKYLPTCLDTL---------RTRFKKIIPVPEQSMIQMLCYLLECLLTKEDIPADCPKEIYELYFVFAAIWAFGSAVIQDQLVDYRAEFSKWWLT---------EFKTVKFPSQ-GTVFDYYIDP--ETKKFEPWAKLIPQFEFDPEMPLQACLVHTSETIRVCYFMERLMQWRRPVMLVGPAGSGKSVLVGAKLSSLNPEEYMVKNVPFNYYTTSAMLQAVLEKPLEKKAGRNYGPPGNRKLIYFIDDMNMPEVDAYGTVQPHTVIRQHLDYGHWYDRNK-LSLKEIMNVQYISCMN-PTAGSFTINPRLQRHFSVFALCFPGADALSSIYSTILTHHLKFGNFPTTLQKSIPPLINLAVTFHQKIATTFLPTAIKFHYIFNLRDFANIFQGILFSSVECVKSTQDLVKLYLHESSRVYRDKMVEEKDFNLFDKIQTEFLKKNFDDSEEVLKQTQNLNMYCHFANG--IGEPK-YMPVQSWDLLNQTLVEALESHNEVNAVMDLVLFEDAIRHICHINRILESPRGNALLVGVGGSGKQSLTKLAAFISSMDVFQITLRKGYQIPDFKVDLASLCLKAGVKNLSTVFLMTDAHVADERFLVLINDLLASGEIPDLYSDEEEENIINNVRNEVKSQGLMDSRENCWKFFIERVQRQLKVTLCFSPVGNKLRIRSRKFPAIVNCTAINWFHEWPQEALESVSLRFLQNTKNIEPAVKQ-SISKFMAFVHISVNKTSQSYLTNEQRYNYTTPKSFLEFIRLYQSLLERNGKELQAKVERLENGLLKLHSTSAQVDDLKAKLATQEVELRHKNEDTDKLIQVVGVETSKVSREKAIADEEEQKVALIMLEVQQKQKDCEEDLAKAEPALTAAQAALNTLNKTNLTELKSFGSPPLAVSNVSAAVMVLMAPGGKVPKDRSWKAAKITMAKVDSFLDSLIHFDKENIHENCLKAIRPYLQDPAFNPEFVATKSYAAAGLCSWVINIVRFYEVFCDVEPKRQALNKATSDLTTAQEKLAAIKAKITHLNENLAKLTTKFEKATAEKLKCQQEAELTAGTISLANRLVGGLASENIRWAEAVQNFRQQERTLCGDILLTTAFISYLGFFTKKYRKSLMDGTWRPYLSQLKVPIPTTPTLDPLRM---LTDDAEVAAWQNEGLPADRMSMENATILINCERWPLMVDPQLQGIKWIKNK-YGEELRVTQIGQKGCLQTIERALEAGDVVLIENLEESIDPVLGPLLGREVI-KKGR-FIKIGDKECEFNPKFRLILHTKLANPHYQPELQAQATLINFTVTRDGLEDQLLAAVVSMERPDLEQLKSDLTKQQNGFKITLKTLEDNLLSRLSSASGNFLGETALVENLEVTKQTAADVEEKVQEAKLTEVKINEAREHYRPAAARASLLYFIMNDLSKIHPMYQFSLKAFSIVFQKAVEKAAPSESVTERVTNLIDSITFSVYQYTTRGLFECDKLTYLAQLTFQILLVNQEVNAAELDFLLRAPVQTGTP---SPMEFLSHQAWGGIKALSSM--EEFCNLDRDIEGSAKSWKKFVESECPEKEKFPQEWKNK-TALQRLCMMRAMRPDRMTYAMRDFVEEKLGSKYVMGRALDFVTSFEESGPATPMFFILSPGVDPLKDVENQGKKLGYTFNNRNFHNVSLGQGQEVVAEAALDLAAKKGHWVILQNIHLVAKWLSTLEKKLEELSEESHPDFRVFISAEPAPSPEGHIIPQGILENSIKITNEPPTGMHANLHKALDNFTQDTLEMCSRETEFKTILFALCYFHAVVAERRKFGPQGWNRSYPFNTGDLTISVNVLYNFL-----EANTKVPYDDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFIRPEMLEG------ELSLAPGFPLPGNMDYSGYHQYIDAELPPE-SPYLYGLHPNAEIGFLTQTSEKLFRTVLEMQPRDSQAGDGAGITREEKVKTFLEEILDRMTDEFNIAELMAKVE-ERTPYIVVALQECERMNILTREIQRSLRELHLGLQGELTMTSEMENLQNALYLDVVPESWARRAYPSTAGLAAWFLDLLNRIKELESWTGDFLMPSTVWLTGFFNPQSFLTAIMQSMARKNEWPLDQMALQCDVTK-KNREEFRSPPREGAYIYGLFMEGACWDTQTGIIAEAKLKDLTPPMPVMFLKAIPADKQDCRSVYACPVYKTCQR----GPTYVWTFNLKTKENPSKWVLAGVALLL 4482          
BLAST of Dynein heavy chain 10, axonemal vs. UniProt
Match: sp|Q8IVF4|DYH10_HUMAN (Dynein heavy chain 10, axonemal OS=Homo sapiens OX=9606 GN=DNAH10 PE=1 SV=4)

HSP 1 Score: 5271.44 bits (13673), Expect = 0.000e+0
Identity = 2662/4476 (59.47%), Postives = 3353/4476 (74.91%), Query Frame = 1
Query:  538 LQMARTPLVNA--EDTLCFFLVRTTDDMVVLPSNINEANSELPSYFESGTLKGDMLLLLSQLIHSVYDYMLSYHQHRVTSDLGMSRASTPASQGRIPKKSQSDGDKIESIDEKVHETRAAVQARDEFLISLKKFTSIVDQTIIQIASEVKLEIPDLDLFENDKENLSDKEIMEMIESTVLKWDQQITGTLESLQKIVPHGPSPLAEIDFWRERNAXXXXXXXXXXXPKVKRILNLYSLAEG-------PVFDTQNNELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIAWNLSDRVARLIDVNTIFNLPLEHVLKDTAEAEKMLRVWNDTYFEVRASIEASGRDARWEFDRKRLFEKTNYMADICHDLNEIAMILQEFYNIFGPELKSVTNEAKRIXXXXXXXXXXXXPLKEMPFNPFNLMKHKYDWSNFMEDFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEVESIDQLFKTNMNNPPLYHFKSCVAGGISWERHLFYNIKRPILRFLTMDEMMQSDNGKRIRTKYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILALANSENFVSENVPEETIDKMDDDLRVDFGFEINEIITETRNLELLGYKVPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISDYIEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFKL---QSGNKFLKCKEFFEFMESERTSDFEHLGRKYSTIGPLITKLQGEIIGDRDVNPFEKFQPFYEFWEKRIFDRVYNMVLKNLQDYQNMLRDENFPTCLFEVDLMLAGTDVIGNPQTTEIYKLAIQDLRDAVEATRVFIRWKRNSCIETTGMKIDGQDELFYFTFYLDIGNSVEITYFCEQIANYYRNIIGKLRKYQDKWKKHKRVFIPNKQAQIDKWLTKDPTVMDFYERIRDTIDRKEELLNQPVIRKIGFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDLSLIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSN-HPIDQEEIEESDKLRQLFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTREGMNQDTIEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSENAKSDKDYAMTDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKRKKPYLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLTKPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTGKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGEPNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMGVGLVVEADLATTEHPSHWVLQGVCLILNTD 13926
            L M  TPL     +  + FFL R T + +   +++ EA   +P   E G +  ++L  L  +I  V+   LS++QHR ++ +G++        G +   S+ + D      E V E  +    RDEFL++++KF S + +T+ Q+  E+KLE+P + +     +  +D E ++++E  V+ W  QI+  +E+  K  P G  PLAEI+FWRERNA LSAL EQ KLP V+++L++   ++        PVF     EL KFH EA DN +FLS VER+FK+I +G  F  V D+IP MM ALRM+WIISRHYNKDERM+PLMERIAW +++RV R++++ T+F          T EA   LR+W   YF+ RA IEASGR+ RWEFDRKRLFE+T+YMA IC DL+++  IL+EFYNIFGPELK+VT + KRI++VL +V+ LV P++ + F+PF++   ++ W   M++F+ +V+      ID IN  F                                                     N+ NPPLY     VAG I WER LF+ IK  ILRF  + E++ SD G+ ++ KYL VGRTM+ +E++++ +W    ++VL  L++K++L    +++ ++   P  T+++      ++F   + EII ET+ LE LG+ VPELARNVALQ++ + +   G+  M+  YH +I +L   E  +L D  +E+ R  R G +RLNWNSLGI DYI  C  A+  FES V  IHK   DI  +L  I+   LFK    +S  +    KEFFE +E ER SD +H+ R Y  IGPL+TK++G ++   +     K   +Y++WEK+I++ +  ++LKNLQ + +++   N P  LF  + +L   ++I +P T EI K+    +R+ VE T+ F+RW   SCIE    K + ++E+    FY DI  + +I      I      I+  L KY  KWK+++ ++  +K   ++K+  K P  + + E+++       E++  P+I+    I + L+ L + V+++ K W       L+ESAK  L ++  ++E    +L  IP  LE+LK +L+TI  I+  SL  E R  DVQERYR + + N  P D E+ E  DK+  ++ +L  +S NV + L  +K  FT++T+ EI ++   ++ FA +F  EGPGS+G DLD G+ +L  +  EL   E  RQEL  AE+LF+LPIT YPEL  VQKEM  L  IYELY+  K A+E W++TLW NL++++L EGIEGFL+  RK+PR V+ +     L  K+K FKD++PL  DLK+EALR+RHWKELM KT   F++  +TFTL ++FAMEL++  DV+ EIVT+A KE++IEK V+E+ +TW  +KF+V  Y KG +ERGYILG++DE++Q LDDN  NLQS+S SRF+GPFL +V  WEK LSLI EV+++WM+VQRKWMYLE IFIGGDIRSQLPEEAKKFD IDK FK+IM ET K P+IK+ C+ PNRLSDL N+S+GLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSD  CVQEHMIKM+DNI+SLRF  G S E   +AMIS+E E+MEFR  +  EGRVEDWMT +  EMRRTNR+ITKEA+F Y E + RV WM  YQGMV L  +Q+WWTWEVEDVF K +KG+K A+K+Y + +H QIDE+V  +  PLSKNDR K  TVLIIDVHARDIVDSF+R SI++A+EF+WESQLRFYW RE DE+ I+QCTG FGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDYR+VGKIF+GL QCGAWGCFDEFNRI+ SVLSVIS+Q++TI+N LI +L+ F FEGQEI LDSR+GIFITMNPGYAGRTELPESVKA FRPVVVIVPDLQQICEIMLFS+GFL AK LAKKMT LY+L++EQLSKQ HYDFGLRALKSVLVMAGEL+R   DL ED VLMRALRDMNLPKF+FED PLFLGLI DLFPGLDCPRVRYPDFND+VE+ L E+ Y VL  Q DK+VQ++ETM TRHTTMVVGPT GGKSVVI  LC +QTKL L TKL  +NPK  SVIELYGILDP TRDWTDG+LSNIFREINKPTDK ER+Y+LFDGDVDALWVENMNSVMDDN+LLTLANGERIRLQ HCALLFEVGDLQYASPATVSRCGMVYVDPKNL Y P+W+ W+N+  NK E   L  L++KY+P  +D ++EG+++G+  EKLKTI+P T+LN+VTQL  MLD  L  E  + D +E  F++++Y SLG  L+ED ++KFD++IK L ++   + E   A  GELP + PTL+D++FD+  ++ +W+PW+ LVP+Y+H PE+KF  ILV T+DT R TW+L + +KI++PV+ VGE+GTSKTA +Q FL+N   +  I L +NFSSRTTS+DIQRNLE+NVEKRTKD+YGPPMGKRLLVF+DDMNMP+VD+YGTQQPIA+LKL+LE+   YDRGK+LN K ++D+GF+AAMGK GGGRN+VDPRFISLFSVFN  FPS+ SL  IYSSIL GH   F + I      +T  T+ +Y  I+  LPPTPSKFHYIFNLRDLSR++ G+  T  +RF    Q  RVWR+E  RV  DRLI++ DK  VQ+ I   + E+ K D +  M DPILFGD++ AL   E R+YED+ +YEAAK LFQEI+EEY+E+ + M LVLFDDAL+HLTR+HR IRMD GHALLVGVGGSGKQSL++LAA+T SC++FEI LSRGYSE   RE+LK+LY KLGIENK+ +F+F D HV EEGFLELINNML+SGIVPALF ++E+E+I+SQ+  EA   GMGP+KES+WQYFVNK A+NLHIVL MSPVG+TLRT CRNFPG+VNNT IDWF PWP QAL+AVA  F+G  N +IP +    +VKH V+VH SV+ YS++F+QK RR NYVTPKNYLDFINTY KLL++K +   +QC RL GGL KL EA++QL ELN KLA QK+ + EK+ ACE LL+EI   T +A EKK++A+EK+  +E Q+K I  EK EAE  L E +P+LE A+L L  L+K+DV EIRSFAKPPK VQ V ECI + K YKE+NWK AKG+M+DP+FL+SL  +D D+IT  Q   ++  L  L  T +EM +VSKAG G+LKFV AV+GY DV REIKPKREKVARLE+ F   KRELE+++NE+  ++ EL+ L  +YE AI E+Q+LQEE +IM+RRL AADKLI+GL SEN RWL DL  L  ++V+LLGDCL+C+AFLSY GAF+WEFR EMV   W++D++ER+IP+S PFRLE +LT+DVEIS+W S+GLPPDELS+QNGILTTRASRFPLCIDPQQQALNWI +KEE NNL+ A+FNDPDFLKQLE++IKYG PFLF+DVDEYIDPVIDNVLEKNIK  QGR+F+ILGDKEVD+D NFRLYLNTKL+NP+Y P++FGK+MVINYTVTLKGLEDQLLSV+V +ER+ELEEQRE LIQETS+NK LLKDLEDSLLRELATSTGNMLDN +L++TLEETKSKA+EVSEKLKL  +T+ +ID+ RDGYR AA+RGAILFFVL+EM+ +NSMYQYSL A+L+VF+ SLKKSLPD  L KRL+N+M TLT ++Y +GCTG+FE+HKLLF+F +T+K+E  +G + Q+ELDFF+KGN S+E +KRKKP  WLSD  W+D+  L+EM    F  L +D+E ++  W++W + ++ E   +P  Y N +  FQKL +LRCFR+DR+YRA+T YV   MGE+YV PP+++FE I +QSTP SPIVFILSPGSDPA+D++KLAERSGFG  +LKF++MGQGQE  A  LL+ A+ARG WL+LQNCHLLVKWL++LEK LER+TKPHPDFRLWLTT+PT+ FPIGILQ+SLKVVTEPPNGLKLN+R+TY KI+   L+   H AF  LV+ LAFFHAVVQERRK+GKIGWN+ YDFNESDF+VC++IL TYL KA  Q D +IPWGSLKYLIGEVMYGGRAID FDRRIL  YMDEY GDF+FDTFQPFHF+ +K   Y IP  D  +  ++ IE+LPL NTPEVFGLH NAEIGYYT AA++MW+ L+++QPQTG+S S  SRD+ I + A  I++K+PK+FDLD++RK+ G  +SPT VVLLQELERFN LV RMTKSL  L RAL GEVGMS ELDDVA+SL+ G IP IW+RLAPDTLKSL NW+ +F  R++QY  WV   EP+VMWLSGLHIPESYLTALVQATCRKNGWPLD+STL+T VT+F  A EV ERA QGCFV GLYLEGA WD  + CL++ KPK L+  LP++K+IPIEAHRLK QNTF TPVY TS RRNAMGVGLV EADL TT H SHWVLQGVCL LN+D
Sbjct:   83 LHMLCTPLPEEFLDQNVVFFL-RNTKEAISEATDMKEAMEIMPETLEYGIINANVLHFLKNIICQVFLPALSFNQHRTSTTVGVT-------SGEVSNSSEHESDLPPMPGEAV-EYHSIQLIRDEFLMNVQKFASNIQRTMQQLEGEIKLEMPIISVEGEVSDLAADPETVDILEQCVINWLNQISTAVEAQLKKTPQGKGPLAEIEFWRERNATLSALHEQTKLPIVRKVLDVIKESDSMLVANLQPVF----TELFKFHTEASDNVRFLSTVERYFKNITHGSGFHVVLDTIPAMMSALRMVWIISRHYNKDERMIPLMERIAWEIAERVCRVVNLRTLFKENRASAQSKTLEARNTLRLWKKAYFDTRAKIEASGREDRWEFDRKRLFERTDYMATICQDLSDVLQILEEFYNIFGPELKAVTGDPKRIDDVLCRVDGLVTPMENLTFDPFSIKSSQF-WKYVMDEFKIEVL------IDIINKIFV---------------------------------------------------QNLENPPLYKNHPPVAGAIYWERSLFFRIKHTILRFQEVQEILDSDRGQEVKQKYLEVGRTMKEYEDRKYEQWMEVTEQVLPALMKKSLL----TKSSIATEEP-STLER-GAVFAINFSPALREIINETKYLEQLGFTVPELARNVALQEDKFLRYTAGIQRMLDHYHMLIGTLNDAESVLLKDHSQELLRVFRSGYKRLNWNSLGIGDYITGCKQAIGKFESLVHQIHKNADDISSRLTLIEAINLFKYPAAKSEEELPGVKEFFEHIERERASDVDHMVRWYLAIGPLLTKVEGLVV-HTNTGKAPKLASYYKYWEKKIYEVLTKLILKNLQSFNSLILG-NVP--LFHTETILTAPEIILHPNTNEIDKMCFHCVRNCVEITKHFVRWMNGSCIECPPQKGE-EEEVVIINFYNDISLNPQIIEQAVMIPQNVHRILINLMKYLQKWKRYRPLWKLDKAIVMEKFAAKKPPCVAYDEKLQFYSKIAYEVMRHPLIKDEHCIRLQLRHLANTVQENAKSWVISLGKLLNESAKEELYNLHEEMEHLAKNLRKIPNTLEDLKFVLATIAEIRSKSLVMELRYRDVQERYRTMAMYNLFPPDAEK-ELVDKIESIWSNLFNDSVNVEHALGDIKRTFTELTRGEIMNYRVQIEEFAKRFYSEGPGSVGDDLDKGVELLGVYERELARHEKSRQELANAEKLFDLPITMYPELLKVQKEMSGLRMIYELYEGLKVAKEEWSQTLWINLNVQILQEGIEGFLRALRKLPRPVRGLSVTYYLEAKMKAFKDSIPLLLDLKNEALRDRHWKELMEKTSVFFEMT-ETFTLENMFAMELHKHTDVLNEIVTAAIKEVAIEKAVKEILDTWENMKFTVVKYCKGTQERGYILGSVDEIIQSLDDNTFNLQSISGSRFVGPFLQTVHKWEKTLSLIGEVIEIWMLVQRKWMYLESIFIGGDIRSQLPEEAKKFDNIDKVFKRIMGETLKDPVIKRCCEAPNRLSDLQNVSEGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDPLCVQEHMIKMYDNIASLRFNDGDSGEKLVSAMISAEGEVMEFRKILRAEGRVEDWMTAVLNEMRRTNRLITKEAIFRYCEDRSRVDWMLLYQGMVVLAASQVWWTWEVEDVFHKAQKGEKQAMKNYGRKMHRQIDELVTRITMPLSKNDRKKYNTVLIIDVHARDIVDSFIRGSILEAREFDWESQLRFYWDREPDELNIRQCTGTFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDYRAVGKIFSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALIHQLTTFQFEGQEISLDSRMGIFITMNPGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLEAKTLAKKMTVLYKLAREQLSKQYHYDFGLRALKSVLVMAGELKRGSSDLREDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRVRYPDFNDAVEQVLEENGYAVLPIQVDKVVQMFETMLTRHTTMVVGPTRGGKSVVINTLCQAQTKLGLTTKLYILNPKAVSVIELYGILDPTTRDWTDGVLSNIFREINKPTDKKERKYILFDGDVDALWVENMNSVMDDNRLLTLANGERIRLQAHCALLFEVGDLQYASPATVSRCGMVYVDPKNLKYRPYWKKWVNQIPNKVEQYNLNSLFEKYVPYLMDVIVEGIVDGRQAEKLKTIVPQTDLNMVTQLAKMLDALLEGEIEDLDLLECYFLEALYCSLGASLLEDGRMKFDEYIKRLASLSTVDTEGVWANPGELPGQLPTLYDFHFDN--KRNQWVPWSKLVPEYIHAPERKFINILVHTVDTTRTTWILEQMVKIKQPVIFVGESGTSKTATTQNFLKNLSEETNIVLMVNFSSRTTSMDIQRNLEANVEKRTKDTYGPPMGKRLLVFMDDMNMPRVDEYGTQQPIALLKLLLEKGYLYDRGKELNCKSIRDLGFIAAMGKAGGGRNEVDPRFISLFSVFNVPFPSEESLHLIYSSILKGHTSTFHESIVAVSGKLTFCTLALYKNIVQDLPPTPSKFHYIFNLRDLSRVFNGLVLTNPERFQTVAQMVRVWRNECLRVFHDRLISETDKQLVQQHIGSLVVEHFKDDVEVVMRDPILFGDFQMALHEGEPRIYEDIQDYEAAKALFQEILEEYNESNTKMNLVLFDDALEHLTRVHRIIRMDRGHALLVGVGGSGKQSLSRLAAFTASCEVFEILLSRGYSENSFREDLKSLYLKLGIENKAMIFLFTDAHVAEEGFLELINNMLTSGIVPALFSEEEKESILSQIGQEALKQGMGPAKESVWQYFVNKSANNLHIVLGMSPVGDTLRTWCRNFPGMVNNTGIDWFMPWPPQALHAVAKSFLG-YNPMIPAENIENVVKHVVLVHQSVDHYSQQFLQKLRRSNYVTPKNYLDFINTYSKLLDEKTQCNIAQCKRLDGGLDKLKEATIQLDELNQKLAEQKIVLAEKSAACEALLEEIAVNTAVAEEKKKLAEEKAMEIEEQNKVIAMEKAEAETTLAEVMPILEAAKLELQKLDKSDVTEIRSFAKPPKQVQTVCECILIMKGYKELNWKTAKGVMSDPNFLRSLMEIDFDSITQSQVKNIKGLLKTLNTTTEEMEAVSKAGLGMLKFVEAVMGYCDVFREIKPKREKVARLERNFYLTKRELERIQNELAAIQKELETLGAKYEAAILEKQKLQEEAEIMERRLIAADKLISGLGSENIRWLNDLDELMHRRVKLLGDCLLCAAFLSYEGAFTWEFRDEMVNRIWQNDILEREIPLSQPFRLESLLTDDVEISRWGSQGLPPDELSVQNGILTTRASRFPLCIDPQQQALNWIKRKEEKNNLRVASFNDPDFLKQLEMSIKYGTPFLFRDVDEYIDPVIDNVLEKNIKVSQGRQFIILGDKEVDYDSNFRLYLNTKLANPRYSPSVFGKAMVINYTVTLKGLEDQLLSVLVAYERRELEEQREHLIQETSENKNLLKDLEDSLLRELATSTGNMLDNVDLVHTLEETKSKATEVSEKLKLAEKTALDIDRLRDGYRPAARRGAILFFVLSEMALVNSMYQYSLIAFLEVFRLSLKKSLPDSILMKRLRNIMDTLTFSIYNHGCTGLFERHKLLFSFNMTIKIEQAEGRVPQEELDFFLKGNISLEKSKRKKPCAWLSDQGWEDIILLSEMFSDNFGQLPDDVENNQTVWQEWYDLDSLEQFPVPLGYDNNITPFQKLLILRCFRVDRVYRAVTDYVTVTMGEKYVQPPMISFEAIFEQSTPHSPIVFILSPGSDPATDLMKLAERSGFGGNRLKFLAMGQGQEKVALQLLETAVARGQWLMLQNCHLLVKWLKDLEKSLERITKPHPDFRLWLTTDPTKGFPIGILQKSLKVVTEPPNGLKLNMRATYFKISHEMLDQCPHPAFKPLVYVLAFFHAVVQERRKFGKIGWNVYYDFNESDFQVCMEILNTYLTKAFQQRDPRIPWGSLKYLIGEVMYGGRAIDSFDRRILTIYMDEYLGDFIFDTFQPFHFFRNKEVDYKIPVGDEKEKFVEAIEALPLANTPEVFGLHPNAEIGYYTQAARDMWAHLLELQPQTGESSSGISRDDYIGQVAKEIENKMPKVFDLDQVRKRLGTGLSPTSVVLLQELERFNKLVVRMTKSLAELQRALAGEVGMSNELDDVARSLFIGHIPNIWRRLAPDTLKSLGNWMVYFLRRFSQYMLWVTESEPSVMWLSGLHIPESYLTALVQATCRKNGWPLDRSTLFTQVTKFQDADEVNERAGQGCFVSGLYLEGADWDIEKGCLIKSKPKVLVVDLPILKIIPIEAHRLKLQNTFRTPVYTTSMRRNAMGVGLVFEADLFTTRHISHWVLQGVCLTLNSD 4471          
BLAST of Dynein heavy chain 10, axonemal vs. UniProt
Match: sp|Q9SMH3|DYH1A_CHLRE (Dynein-1-alpha heavy chain, flagellar inner arm I1 complex OS=Chlamydomonas reinhardtii OX=3055 GN=DHC1 PE=1 SV=1)

HSP 1 Score: 4160.14 bits (10788), Expect = 0.000e+0
Identity = 2195/4487 (48.92%), Postives = 3005/4487 (66.97%), Query Frame = 1
Query:  643 ANSELPSYFESGTL-KGDMLLLLSQLIHSVYDYMLSYHQHRVTSDLGMSRASTPASQGRIPKKSQSDGDKIESIDEKVHETRAAVQARDEFLISLKKFTSIVDQTIIQIASEVKLEIPDLDLFENDKENLSDKEIMEMIESTVLKWDQQITGTLESLQKIVPHGPSPLAEIDFWRERNAXXXXXXXXXXXPKVKRILNLY-------SLAEGPVFDTQNNELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIAWNLSDRVARLIDVNTIFNLPLEHVLKDTAEAEKMLRVWNDTYFEVRASIEASGRDARWEFDRKRLFEKTNYMADICHDLNEIAMILQEFYNIFGPELKSVTNEAKRIXXXXXXXXXXXXPLKEMPFNPFNLMKHKYDWSNFMEDFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEVESIDQLFKTNMNNPPLYHFKSCVAGGISWERHLFYNIKRPILRFLTMDE--MMQSDNGKRIRTKYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILALANSENFVSENVPEETIDKMDDDLRVDFGFEINEIITETRNLELLGYKVPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISDYIEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLF-KLQSGNKFLKCKEFFEFMESERTSDFEHLGRKYSTIGPLITKLQGEIIGDRDVNPFEKFQPFYEFWEKRIFDRVYNMVLKNLQDYQNMLRDENFPT------CLFEVDLMLAGTDVIGNPQTTEIYKLAIQDLRDAVEATRVFIRWKRNSCIETTGMK-IDGQDELFYFTFYLDIGNSVEITYFCEQIANYYRNIIGKLRKYQDKWKKHKRVFIPNKQAQIDKWLTKDPTVMDFYERIRDTIDRKEELLNQPVIRKIGFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDLSLIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRV-LTLSNHPIDQ----EEIEESDKLRQLFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEK-LKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGD-IRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVL---SDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKP--TDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTREGMNQD--TIEAIFIQSIYWSLGGCLIEDSQV----KFDQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGH-CQMFSDEIKNTV-PIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSENAKSDKDYAMTDPILFGDYRNAL-------EVAEVRLYEDMINYEAAKGLFQEIMEE-YSEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLD--KLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESN-NLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKRKKPYLWLSDISWQDVTKLTEMIPIKFSM---------LLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGF-GTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLTKPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTGKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGEPNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMGVGLVVEADLATTEHPSHWVLQGVCLILNTD 13926
            A  EL S  E G L +G  L +L Q++ SV+  +L                    S G +     S G  ++S+ +  H          E L +++KF S V Q + Q+  +V L++PD  L + D+   +D +++  +E  + +W Q +   L+   +  P G  PLAEI+FWRERNA+LS+L EQL LP+VKR++ +        +L  G  F +Q  EL K   EA+DN KFL+ +ERHFK+IA G     + D++PPMM ALRM+WIISRHY+ D+RM  L +RIA  + DRV   +D+  IF +     ++     + +L  W  TY  +R  IE SGRDARWEF ++ LF +TNYMA+IC DL E+  I+ +F+   GPELK+VT +   I+ V+ +V  + +P++ + FN F+   ++++W    + F      I+    + I+  F  LRSAEGA ++L  F+ I+S+ AI K +  KFNDI+ Q+ +E+E    +F+ N + PP+   +  VAG I W R L   +KR + + L+ +E  +  ++ G+ + +K+ +  R++   E+K F+ W   ++ V  + L++ I   + + N V                 V+F  ++  +I ETR L+ +G+ +PE+A NVALQ++ + + +EGL  M+  Y+  I  L  +E +++  +++E++  ++PG   LNWNSLGI+++I  C+ A+  F+  V  + K +  IE+ +  I  A+L  + + G + +  +EF+E +E +R +  E L +KY TI PL+ K++ E++   +         +Y FWE+ IF+ +  MVL  +   Q+M+   +          LF+V + L   DV+  P  TE+ K   + +R  VE+T+ F+RW   +C+ET   +     DE   FTFY D+  + ++      +    +  I  + KY + W++H+ ++  +K + +DK+  +DP+   F +++        E+  Q       FI V+   L S V D  + W      ++ E      + +++ I  + T L   P  LEELK +L+T+ TI+  S+  E R  D++ERYR  L  + +P ++     E+  + ++R L+  L  E++ V++ L   K KF++ T+ ++SDF        +KF+  GPG    +L  GL  L K+   L     +R++L  AE+LF + IT YPEL  ++ E++ L Q+Y +Y    +A   +   LW  LD+  +  G E  L + RK+       V    L EK ++ F ++LPL  +LK EALR+RHW  LM  TGQ FD++P TFTL ++FAM+L+++ + I +I  +A KEL+IE  +R++ + W   +F +  Y+KG ++RG++L + +++L +L+D  +NLQSM AS F+ PFL  V+ WE+ LSLI E ++VWM VQRKWMYLE IF+G D IR QLP EAK+FD ID+ ++KIM +TAK  ++  AC    RL  L +LS+ LE CQKSL++YLD+KR AFPRF+FISDDELLSILG+SD   VQEHM+K+FDN ++L F +G     + T M+SSE+E  EFR+ V IEG VE WMT +E EMR+T   ITKE +FFY ++  R +W+ +  GMV L  +QIWWTWE EDVFR+++ G K ++K++A  L  Q+ E+   VRS LS   R K+ T++IIDVHARDI+D++VRDSI+DA+EF WESQLRFYW R+ D+I I+QCTG F YGYEYMGLNGRLVIT LTDR Y+TLT AL+  LGGAPAGPAGTGKTETTKDLAK++ LLCVV NCGEG+DY+++G IF+GL QCGAWGCFDEFNRIE  VLSV+S+Q+K IQ  L   L+RF FEG+EI +D R GIFITMNPGYAGRTELP+++KA FRPV ++VPDL+QICEIMLFS+GF SAKVLAKKMT LY+LS+EQLSKQ+HYDFGLRALKSVLVMAG L+R  PD+SE  VLMRALRDMNLPKFIF+D PLFLGLI DLFPG+DCPRVRYP FND VE  LA+  + VL   S+Q DK+VQLYE M TRHTTMVVG TGGGK+V++  L  +QTKL   T L  +NPK  SV ELYG+LD +TRDWTDGLLSNIFRE+NKP   +++E RY++FDGDVDA+WVENMNSVMDDNKLLTL NGERIRLQNHC LLFEV DLQYASPAT+SRCGMVYVD +NLGY P+   WLN +  + E D L GL++KY  P++D ++EG+   + V + K  +P+TNLN++TQLCN+L+  +T      D   +EAIFI    WSLG  +++  +     +FD F+K + +M   + E     A +LP+R  +L++Y FD+ E    W  W + +  Y    +  F++ILVPT+D VR TWLL   +   +P L VGE+GT+K+     +L + D    I L +NFSSRT+SLD+QR +E + EKRTKD+YGPPMGKRLL+FIDD+NMP+VD YGTQQPIA+LKL +ER+G YDRGK+L+WK M+D+  + AMG PGG RN VDPRFISLFSVF   FPS  +L +IY +ILS H  ++ +DEI++ +   +T +T+ +YN II +LPPTPS+FHYIFNLRDLSRIY+G+  T  D F   +QF R+WR+E  RV+ DRLI+ DDK  + + +E  + +   +   + +  P+LFGD++N +       EVA  R+Y+D+ +Y + K LF+++M   Y+    PM LV F+DAL+HLTRIHRT+R+  G+ LLVGVGGSGKQSL+KLAA+T  C++FEI L+RGY E   RE+LK LY  LG +NK  +F+F D HV +EGFLELINNML+SG+VPAL+   E++ +I  VR E    G+  +KES W Y+V+KC +NLH+VL MSPVGETLR+RCRNFPG+VNNT IDWF PWPEQAL +VASVF+  E   +P+  R +IV+H V VH SV  +S  F+++ RR NYVTPKNYLDFIN Y + L    +  E    RL GGL+KL +A+V++  +  +L+  +V V + T  C  LL+ I++ T     K + A  K   ++V S++I  EK EAEAAL EA+P LE+A  AL DL K+ + EIRS+AKPP+ VQ V EC+ + +N K+++W  AK MMAD +FL+SL   D D++T KQ   V++     K  +T D +R++S AG GLLK+V A++ Y +VAR ++PKR+KVA  EK     +++L   K E+  L  +L  L  ++E    E+Q L+ + D+M+RRL AA KLI GL SE +RW  D+  L+ ++ RL+GDCL+ S+FLSY GAF+  +R  MVY  W+DDV  R +P++ PFRLE +LT+DVE + W SEGLP DELSIQNGILT RA+R+PLCIDPQ QA+NWI  +E      K  TFND DFLKQLEL+I+YG PFLF+++DEYIDPVID VLEKN+    G+  + LGDKEV++D NFRLY+ +KLSNP YGP I GK+M+INY VT +GL +QLL+V ++ ER +LEE RE LI++ S+NK  L+ LED+LLREL+ + GN+LDN+ELI TLE  K KA E++EKL+    T+ EI++ R  Y  AAKRGAILFFV+A +S I +MY+YSL+++L VF  SL  S  D +++ RL+N++ TLT +VY Y C G+FE+HKL+F+FQ+T K+      L    LDFF+KGN S+E A R+KP+ W  D  WQD+ +L E+   K            L  D+E DE +W+ W + E PE A LP  Y + L  F+KLCL+RC R+DR+   IT +VI  MGE+YV PP+L +  I+ QST  +PIVF+LSPG+DPA DV KL E  GF    KLK++++GQG    A+ L++    RG W++LQNCHLL  WL+ LEK LE++TKPH DFRLWLTTE T+ FP+G+LQRSLKVVTEPPNGLKLN+R +Y KI    L +  H AF  LV+ L FFHAVVQERRKYGK+GWN+PYDFNE+DFR+ + ++ TYL KA D  D  IPWG+L+YLIGE MYGGR  D +DRRIL TY+DEY GDFLFDTFQPF FYA K     IPQ  + D  LK +E+LPL  +PE FGL++NA+I YYTSA K +W+ L+D+QP+TG  G   +R+E I   A  I +K+P+ FDL +LRK+ G   SPT VVLLQELER+N ++  M  SL  L RAL GE+G S+ L+++A SLYNG++P +W RL P T K+L  W+  F  RY QY  W E+GEP V+WLSGLHIPE+Y+ ALVQA CR  GWPLDKSTLYT VT+F    +V+ER   GC++ GLYLEGA WD     L +  PK L+  LP+++VIPIEA++LK  NTF  PVYVT  RRNAMGVGLV +ADLA+ EH SHWVLQGV L+LN D
Sbjct:  206 AAEELDSAVEFGLLSEGPSLRILEQMLSSVFVPIL-----------------VQMSGGDVA----SGGVLMQSMTDNSHR---------ELLGNMQKFHSQVTQALQQLTGDVTLQLPDFPLEDMDRAA-ADTDLVMQLEQYMAEWSQVLASVLQRESQKHPTGKGPLAEIEFWRERNAVLSSLYEQLNLPQVKRMILVVEKGSDDRNLMAG--FKSQLGELTKLATEARDNVKFLTTLERHFKNIATG-PLGGILDTLPPMMNALRMVWIISRHYSDDQRMGSLFQRIAREIGDRVEAAVDLRHIFRMTSADAVELLKVCKSVLEHWLQTYMAMREKIELSGRDARWEFPKQLLFARTNYMAEICTDLIEMVEIVDDFFRFLGPELKTVTGDTAGIDRVVHRVVAMYEPIESISFNVFD-YGNQHEWKAAKQQFYADNEDIKEATRELIDTSFRKLRSAEGACELLQSFKSIKSKGAIQKQVMNKFNDILEQFAREIEQTADIFERNKDAPPVTKNQPPVAGAIKWVRSLLERLKRTMAKLLSTEEEIIRTTELGQAVESKFKSFARSVMLTEKKWFSSWSDSINGVAMQHLKQTIFRRSAATNRVE----------------VNFHPDLVRLIRETRYLDRMGFPIPEIALNVALQEDKFLQWLEGLNSMLFKYYESIDQLTPVERELMERKLEELESCLQPGFTILNWNSLGITEFIGTCDKAIATFQQLVKQVQKNSGIIEQVVYAIAGAQLVTEPEEGAEVMDLQEFYEDIERQRLAALESLVKKYRTISPLLGKIE-EVVAGTNSGKSPALSSYYSFWERAIFNALNTMVLCAMTKLQDMIEQRSKHAEGGRKPPLFKVTVSLQSVDVVVQPPMTEVNKALGRLVRSLVESTKAFVRWMDGTCVETPEQRGATDDDEPIVFTFYWDVAANPQVIKTMLNLNQSIQRAITSVNKYAESWRRHQALWKTDKNSVLDKFKARDPSAAQFEDKLSKYAKMATEISAQAKDFDQDFIRVSCHALASSVCDEAQAWVRAIAQTMRELDAVTESQLRDKIAKYQTALHRPPDTLEELKQVLNTVNTIRGESMVMELRYADLEERYRTRLLYATNPEEESQCAHELASASQVRALWTELLNEAEAVDWSLEETKKKFSETTRSQVSDFAAITAELWEKFRTTGPGLPTVELASGLDELHKYESNLADALRQREQLVLAEKLFGMEITAYPELAQLESEIRKLAQVYGVYAEHAEAVRQYGGQLWSELDVGKMMAGTEAILTKLRKLKSLKLLPVY--ELVEKEIQGFYNSLPLMKELKSEALRKRHWTRLMEVTGQEFDMDPKTFTLGNMFAMQLHKYAEEIGKITNAAVKELTIESEIRKLADVWREQRFELGKYMKGPEDRGWVLRSTEDILVLLEDMGLNLQSMMASPFVRPFLTEVRAWEQKLSLIGECIEVWMHVQRKWMYLESIFVGSDDIRHQLPAEAKRFDNIDRQWQKIMNDTAKNTVVLDACMADGRLDLLKSLSEQLEVCQKSLSEYLDTKRCAFPRFYFISDDELLSILGTSDPTSVQEHMLKLFDNCAALVFGRGNK---TITGMVSSEKEGFEFRNVVPIEGAVELWMTNVEAEMRKTLYQITKEGIFFYAKTP-RTKWISENLGMVTLVGSQIWWTWETEDVFRRVRDGNKHSMKEFAAKLTGQLSELTSMVRSDLSNEVRKKVNTLIIIDVHARDIIDTYVRDSIVDAREFAWESQLRFYWDRQQDDILIRQCTGLFKYGYEYMGLNGRLVITALTDRCYMTLTTALTYRLGGAPAGPAGTGKTETTKDLAKSMALLCVVFNCGEGLDYKAMGSIFSGLVQCGAWGCFDEFNRIEAEVLSVVSSQIKNIQEALKNDLTRFQFEGKEISIDPRTGIFITMNPGYAGRTELPDNLKALFRPVTMVVPDLEQICEIMLFSEGFDSAKVLAKKMTVLYKLSREQLSKQHHYDFGLRALKSVLVMAGSLKRGAPDMSEQLVLMRALRDMNLPKFIFDDVPLFLGLINDLFPGMDCPRVRYPQFNDVVEADLADQGFKVLTEPSEQVDKVVQLYEVMMTRHTTMVVGQTGGGKTVILNTLARAQTKLGKKTHLYTINPKAISVAELYGVLDKDTRDWTDGLLSNIFREMNKPLPAERDEARYLVFDGDVDAVWVENMNSVMDDNKLLTLPNGERIRLQNHCKLLFEVFDLQYASPATISRCGMVYVDSRNLGYKPYIYTWLNSRAKQAEVDILRGLFEKYAVPSVDWILEGIDGEELVRRPKQAVPVTNLNMITQLCNLLNATITDHPRMSDPQILEAIFIFCTIWSLGAAIVQRPESPDRDRFDAFVKHIASMGLVDGER--VAATQLPAR--SLYEYCFDTNE--GVWKSWRSYLQPYEPPADGAFAKILVPTVDVVRSTWLLNTVVAAGKPCLFVGESGTAKSVTIANYLAHLDSTINIVLNVNFSSRTSSLDVQRAIEDSTEKRTKDTYGPPMGKRLLMFIDDLNMPRVDTYGTQQPIALLKLFIERKGLYDRGKELSWKNMKDVQVVGAMGPPGGARNPVDPRFISLFSVFEIQFPSNENLRTIYQAILSRHLAKLPTDEIRDQLGERLTDVTLELYNFIIDKLPPTPSRFHYIFNLRDLSRIYEGLLLTVGDVFKTPEQFLRLWRNECLRVLHDRLISTDDKRVMTERLEALVQQKFPNLAAHTLASPVLFGDFKNVINELQGEGEVAP-RMYDDLGDYNSIKPLFEDVMTNFYNRKRKPMNLVFFEDALEHLTRIHRTLRLPQGNCLLVGVGGSGKQSLSKLAAFTAGCEVFEITLTRGYDELAFREDLKRLYAMLGSDNKRVMFLFTDAHVADEGFLELINNMLTSGMVPALYDGAEKDGLIGSVRAEVEKKGLLATKESCWSYYVDKCRNNLHVVLAMSPVGETLRSRCRNFPGMVNNTVIDWFEPWPEQALTSVASVFLAEEA--LPEALRPQIVEHMVTVHQSVRTFSTRFLEELRRYNYVTPKNYLDFINNYKRALATNRRTIEDTVTRLSGGLEKLIQAAVEVDAMQKELSQAQVVVAQATKECNELLEVISTNTVDVETKAKAAAIKEAQLKVDSEQIAIEKAEAEAALEEAIPALEEAAAALQDLSKDHITEIRSYAKPPEQVQKVCECVVILRNIKDVSWLGAKSMMADGNFLRSLVEFDKDSLTDKQVKKVKEYFKDPKAPLTYDSLRAISTAGAGLLKWVLAMVNYNNVARTVEPKRKKVAESEKNLRIAQKDLASTKLELQSLNDQLGKLRTQFEEKTAEQQDLKAKADLMERRLIAASKLIAGLGSERERWTRDIADLESRRDRLIGDCLLTSSFLSYTGAFTATYRHAMVYEMWQDDVKARGVPVTQPFRLEALLTSDVETTGWASEGLPSDELSIQNGILTVRANRWPLCIDPQMQAVNWIKSREGKMLEGKVKTFNDSDFLKQLELSIQYGFPFLFENLDEYIDPVIDPVLEKNLVPGDGKFVIKLGDKEVEWDSNFRLYMTSKLSNPHYGPEISGKTMIINYGVTQQGLTEQLLNVTLRHERSDLEEAREALIKQMSENKATLQALEDTLLRELSNAQGNILDNSELIATLESAKLKAVEIAEKLEASKVTAAEIEETRVRYSPAAKRGAILFFVIAGLSAITNMYEYSLASFLVVFNGSLHSSRRDASIEGRLRNIIDTLTYDVYAYTCLGLFERHKLMFSFQMTCKILEGDTPLDPQLLDFFLKGNLSLEKAARRKPFDWFPDAGWQDLMRLVELGQKKIGADGRMHALGSLANDVESDEAAWRTWYDLEAPEEAELPCGYQSFLSDFEKLCLMRCLRMDRVTVGITRFVIGVMGEKYVQPPVLEYRSIYKQSTETTPIVFVLSPGADPAFDVFKLGEEMGFRPGAKLKYMALGQGMGPKAQELIETGATRGLWIMLQNCHLLPTWLKTLEKILEKITKPHADFRLWLTTELTDRFPLGVLQRSLKVVTEPPNGLKLNMRQSYSKITEEVLADCPHQAFRPLVYVLGFFHAVVQERRKYGKLGWNVPYDFNETDFRISMALISTYLTKAWDAQDDLIPWGTLRYLIGEAMYGGRVSDSYDRRILTTYLDEYLGDFLFDTFQPFRFYACKDYEIAIPQTGSRDTYLKAVEALPLVQSPEAFGLNANADISYYTSATKAIWTDLVDLQPRTGGGGGGVAREEFIGGVARDIAAKIPEPFDLPQLRKELGTP-SPTQVVLLQELERWNSVLGVMVSSLRDLQRALSGEIGFSSRLEELASSLYNGKLPAMWARLNPATEKALGAWMLWFGRRYRQYKDWTEHGEPKVIWLSGLHIPETYIAALVQAACRDKGWPLDKSTLYTKVTKFTDPYQVSERPKYGCYMSGLYLEGAAWDLEASQLRKQDPKVLVNELPILQVIPIEANKLKLANTFRAPVYVTQARRNAMGVGLVFDADLASAEHSSHWVLQGVALVLNID 4624          
BLAST of Dynein heavy chain 10, axonemal vs. UniProt
Match: sp|P0C6F1|DYH2_MOUSE (Dynein heavy chain 2, axonemal OS=Mus musculus OX=10090 GN=Dnah2 PE=1 SV=1)

HSP 1 Score: 2325.05 bits (6024), Expect = 0.000e+0
Identity = 1404/4067 (34.52%), Postives = 2254/4067 (55.42%), Query Frame = 1
Query: 1900 WSNFMEDFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEVESIDQLFKTNMNNPPLYHFKSCVAGGISWERHLFYNIKRPILRFLTMDEMMQSDNGKRIRTKYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILALANSENFVSENVPEETIDKMDDDLRVDFGFEINEIITETRNLELLGYKVPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISDY-IEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFKLQSGNKFLKCKEFFEFMESERTSDFEHLGRKYSTIGPLITKLQGEIIGDRDVNPFEKFQPFYEFWEKRIFDRVYNMVLK-NLQDYQNMLRDEN--FPTCLFEVDLMLAGTDVIGNPQTTEIYKLAIQDLRDAVE--ATRVF--IRWKRNSCIETTGMKIDGQDELFYFTFYLDIGNSVEITYFCEQIANYYRNIIGKLRKYQDKWKKHKRVFIPNKQAQIDKWLTKDPTVMDF------YERIRDTIDRKEELLNQPVIRKIGFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDLSLIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSNHPIDQEEIEESDKLRQ---LFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVK-----AMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSS-DCECVQEHMIKMFDNISSLRFTK--GTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEA-VFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLH-------TKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTRE-GMNQD-------TIEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQ-YVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSENAKSDKDYAMTD--PILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEY--SEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEV-AKRKKPYL-WLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLT--KPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTAFPS----LVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQ-TGKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGEPNVM-WLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMG-VGLVVEADLATTEHPS-HWVLQGVCLILNTD 13926
            W      FR  +  +E    + I + F  +R  E    +L  F  + +R+AI +   +K  D+   +  E+  +++  + N   P L  + +  +G   W R L   I R +        +     G+     Y  + + +     K F EW   +DK   + +R+  ++L          + +E +  +D    V+F   +  +  E    E L ++ P    NVA + E    + E LL +   Y+ +I  L   E  +  + I+ + + I PGL++LNW   G S + I +C +     +  V      T+ I  K +E+    L  + +G +  +  EF E     R +  + L + +  +  ++T    E+  + D    ++    Y      + +    + +K +L +    +  +    P  LF V L++   DV G     E +   +Q L   V    + +F  I   R+     T  K++ +        Y+ +    +I     QI++   N    L+ Y   W  ++ ++  NK + I ++   +P V  F      Y  + + + ++E +LN      I F+ ++   L   +  H   W++ +   L E A   LA + + ++ +   +S  P  LEEL   L  + T+Q      E++I  + E++ +L     P+    +E  + L      F  +  +S+ +   L   K KF         DF K   N  + F+ +GP +        L  + +    L  +      L +   +F +      +L  ++KE+  L Q++E+    +++   W    ++ L  + ++    G  +   ++ +E K      + T R+   K+++FK  +PL SDL++ ALRERHW ++  +  + FD   ++FTL  +  + +++  + IAEI  SA+KEL+IE G++ + +TW + +  + PY   G  R   L   +EV Q L+DN + L +M ASRF+  F   V +WE+ LSLI EV+++ + VQR+WMYLE IF+G DIR QLP E+  FD ++  +K IM    K     ++   P  L  L  ++  LE  QKSL+ YL++KR+ FPRF+F+S+D+LL ILG S + E VQ H+ K FDNI  L+  K  G+S +  A  M S + E ++F  PVL+EG VE W+  +E  MR T R + +   V   +    R +W+ D+ G V +  +QI WT +V       K+     +   + L  N+  E +   R  L+K  R K+  ++ I++HARD+++   +  +MD   F+W SQLRFYW ++ D+  I+Q   QF YGYEY+G +GRLVITPLTDR Y+TLT AL ++ GG+P GPAGTGKTET KDL KALG+  +V NC EG+DY+S+G++++GL Q GAWGCFDEFNRI + VLSV++ Q+ +I + L   L+RF+FEG EI L    GIFITMNPGYAGRTELPE++K+ FRP+ ++VPD   I EI+LF +GF + K+LAKK+ TLY L+ +QLS+Q+HYDFGLRAL S+L  AG+ RR  PDLS+++VL+ ++RDMN+ K    D PLF  ++QDLFP ++ P + Y    D++E+ + E    +      K++QLYET  +RH+TM+VG TG  K+   KIL AS T L           +  P+NPK  S+ ELYG  D NT +WTDG+LS++ R +    +K + +++LFDG VD LW+E+MNSVMDDNK+LTL NGERI +    +LLFEV +L  ASPATVSRCGMVY D  +LG+ P+ Q WL K+  K E + L  +++K+I   +             +    ++P+   + +  LC +     T E G+N          +E  F+ S+ WS+   + ED + K D +++ +               G  P++  T+++YY +   + + W  +   +P+ + + P   F +I+VPT+DTVR  +L++  +  Q PVLLVG  GT KT+++Q+ L++    ++  L +N S++TTS ++Q  +ES VEKRTK  Y P  GK ++ F+DD+NMP  D +G+Q P+ +++L ++    YDR K  + K ++D+  +AAMG PGGGR  + PR  S F++ N TFP++S +  I+ ++++   Q F +E+K    ++T+ T+ +YN ++ +  PTP+K HY+FNLRD+S+++QGM +   D         R+W HE  RV  DRL++  D       + ++L         +   +  P +FGD+     + E ++YED+++    K   +  + EY  S +V PM+LVLF +A++H+TRI R I    G+ LLVG+GGSG+QSL +LA+     + F+I +++ Y +++ R+++K LY + G+E ++T F+F D  + +E FLE INN+LSSG VP L+  DE E I + + ++A +  +  S +S++ Y + +  +NLHIVLC+SPVG+  R   R +P +VN TTI+WF  WP +AL  VA  +I   +    ++   ++ + FV +H SV +YS++ + + RR NYVTP NYL+ ++ Y KLL +K +    Q ++L+ GL K+ E   ++  ++ +L   K  V E    CE  L  I  + + A E+++     S+ + ++  + +     A+  L EALP LE+A  AL+ L K D+ EI+S+ +PP  V++V + + + +   E  W  AK  + + +F++SL   D DNI+ K    +     +     D +  VS A   L  +V A+  Y  + R ++PKR ++        + +  L + + ++ ++  +L+ L ++Y+  + +++ L+++++ M+ +L  A  L++GL+ E  RW   +Q L++    L+GDCL+ +AFLSY+G F   +R E++   W   + E ++P S  F +++ LTN  ++  WN +GLP D  S +NGI+ TR +R+ L IDPQ QAL WI   E +  LK       D+L+ LE AI++G P L ++V EY+DP ++ VL K++    GR  + +GDKEV+++PNFR YL TKLSNP Y P    K+ ++N+ V  +GLE QLL ++V+ ER ELEEQ++ L+   +  KR LK+LED +LR L  +TG++LD+ +L+NTL+ +K  A+EV+E+L+    T   ID  R+ YR  A+R ++LFFVL +M  I+ MYQ+SL AY+ +F  S+ KS     L+ R++ +    T  VY Y C  +FE+HKLLF+F +  K+    G L  DE +FF++G   ++   +   P   WL+D  W ++T+L ++    F  L+   E+    W  W  + +PE A LP ++ N     Q++ ++R  R DR+   +T +++  +G  ++ PP+LN + + + STP SP+VFILSPG DP S +++LAE +G    +   +S+GQGQ   A  LL   + +GHW+ L NCHL + W+  L+K +E+L    PHP FRLWL++ P   FPI ILQ S+K+ TEPP GLK N+   Y+   L +   F H + P+    L+F L FFH+++ ER+K+ ++GWNI Y FN+SDF V   +L  YL +  +      PW +LKYLI  V YGG   DD+DRR+L TY+++YF D    T  PF +  S   TY IP+  +     +YI  LP  + PE FG H NA++    + A+ ++  L+ +QPQ T      QSR+E + E A+ +K K+P++ D +  RK   LD SP  VVLLQE++R+N L+  +  SL  L + + G + MS  L+++   +++  +P +W ++ P   K LA+W      R  Q+  W     P V+ WLSG   P  +LTA++Q+  R+N   +D S  +  +      + +      G +V GLYLEGAGWDR   CLV  +P QL+  +P I   P E+ +   +  +  P Y    R  +      V+  DL +    S HW+ +G  L+++ D
Sbjct:  488 WHEDYNKFRGGIKDLEVMTQNLITSAFELVRDVEHGVLLLDTFHRLATREAIMRTYEKKAVDLYMLFNSELALVNR--ELNKKWPYLEPYMTQYSGQAHWVRILRRRIDRVMNCLSGAHFLPHIGTGEESIHTYQQMAQAIDEMVRKTFQEWTATLDK---DCIRRLDMSLLR--------ISQEKVGMLD----VNFDKTLLILFAEIDYWERLLFETPHYVMNVAERAEDLRILRENLLLVARDYNRIIAMLSPDEQALFKERIRFLDKKIHPGLKKLNWALKGASAFFITECRMHASKVQMIVNDFKASTLTIGWKAQEMSELLLVHI-TGKQVYRDLEFEEAQREHRMAAQQKLVKLHQDVVNIMTN-SYEVFKN-DGPEIQQQWLLYTIRLDHMMEDALRLNVKWSLLELSKAINGDGKTTPNPLFRV-LVILQNDVRGGGSQVE-FSPTLQTLASVVNDIGSHLFATISVFRHLPDILTKRKMNRE------PIYVLVERDEDIRKIQAQISSGMTNNASLLQNYLKTWDMYREIWEINKDSFIRRYQRLNPPVSSFDADIARYTEVANNVQKEETVLN------IQFVMLDCSHLKFSLVQHCNEWQNKFTTLLKEMAAGRLADLHSYLKDNAEKISHPPQTLEELGVSLQLMDTLQHDLPNLETQIPPIHEQFTILEKYEVPVPDTVLEMLESLNGEWLTFQQILLDSEQM---LKKHKEKFKTGLIHAADDFKKKAHNLLEDFEFKGPFTSTVGHTAALDQIAQMRAMLMAMRDEENNLRSNLGIFKIEQPVSKDLQILEKELDALQQVWEITRDWEESWNQWKMGCFQTLQTEAMESMAHGLFRRLTRLAKEYKDRNWEIIETTRS---KIEQFKRTMPLISDLRNPALRERHWDQVKEEVQREFDQESESFTLEQIVKLGMDQHVEKIAEISASATKELAIEVGLQNIAKTWDSTQLDIVPYKDKGHHR---LRGTEEVFQALEDNQVALSTMKASRFVKAFEKDVDHWERCLSLILEVIEMVLTVQRQWMYLENIFLGEDIRKQLPNESALFDQVNNNWKAIMDRMNKDNNALRSTHYPGLLETLIEMNAILEDIQKSLDMYLETKRHIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKLLKIQKVGGSSSKWEAVGMFSGDGEYIDFLHPVLLEGPVESWLGDVERAMRMTLRDLLRNCRVALKKFLNKRDKWVKDWAGQVVITASQIQWTADVTKCLMTAKERSDKKILKVSIL--NKYSEAI---RGNLTKIMRLKIVALVTIEIHARDVLEKLYKSGLMDVSSFDWLSQLRFYWEKDVDDCIIRQTNTQFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGIYVIVVNCSEGLDYKSMGRMYSGLAQSGAWGCFDEFNRINIEVLSVVAQQILSILSALTANLTRFYFEGFEINLVWSCGIFITMNPGYAGRTELPENLKSMFRPIAMVVPDSTLIAEIILFGEGFGNCKILAKKVYTLYSLAVQQLSRQDHYDFGLRALTSLLRYAGKKRRLQPDLSDEEVLLLSMRDMNIAKLTSVDVPLFNAIVQDLFPNIELPVIDYGKLRDTIEQEIREMGLQITPFTLTKVLQLYETKNSRHSTMIVGGTGSSKTTSWKILQASLTSLCRAGEPNYNIVREFPLNPKALSLGELYGEYDLNTNEWTDGILSSVMR-VACADEKPDEKWILFDGPVDTLWIESMNSVMDDNKVLTLINGERIAMPEQVSLLFEVENLAVASPATVSRCGMVYTDYVDLGWKPYVQSWLEKRP-KTEVEPLQRMFEKFINKILSF---------KKDNCNELVPVPEYSGIISLCKLYTVLATPENGVNPADAENYSFMVEMTFVFSMIWSVCASVDEDGRKKIDSYLREI--------------EGSFPNK-DTVYEYYVNP--KMRTWTSFEEKLPKSWRYPPNAPFYKIMVPTVDTVRYNYLVSTLVANQNPVLLVGPVGTGKTSIAQSVLQSLPSSQWSVLVVNMSAQTTSNNVQSIIESRVEKRTKGVYVPFGGKSMITFMDDLNMPAKDMFGSQPPLELIRLWIDYGFWYDRVKQ-SIKHIRDMFLMAAMGPPGGGRTVISPRLQSRFNIINMTFPTESQIIRIFGTMINQKLQDFEEEVKPIGNVVTEATLDVYNTVVQRFLPTPAKIHYLFNLRDISKVFQGMLRANKDFHDTKASITRLWIHECFRVFSDRLVDTADMEAFMGILSDKLGTFFDLTFHHLCPNKRPPIFGDF-----LKEPKVYEDLVDLTVLKTAMETALNEYNLSPSVVPMQLVLFREAIEHITRIVRVIGQPRGNMLLVGIGGSGRQSLARLASSICDYNTFQIEVTKHYRKQEFRDDIKRLYRQAGVELQTTSFLFVDTQIADESFLEDINNILSSGEVPNLYKSDEFEEIQNHIIDQARAEQIPESSDSLFAYLIERVRNNLHIVLCLSPVGDPFRNWIRQYPALVNCTTINWFSEWPREALLEVAEKYIIGVDLGTQENIHRKVAQIFVTMHWSVAQYSQKMLLELRRYNYVTPTNYLELVSGYKKLLGEKRQELLDQANKLRTGLFKIDETREKVEVMSLELEDAKKKVAEFQKQCEEYLVIIVQQKREADEQQKAVTANSEKIAIEEVKCQALADNAQKDLEEALPALEEAMRALESLNKKDIGEIKSYGRPPAQVEIVMQAVMILRG-NEPTWAEAKRQLGEQNFIKSLINFDKDNISDKVLKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAAMAQLQEKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEETVQGLEEDLGYLVGDCLIAAAFLSYMGPFLTNYRDEIINQIWIRKIRELQVPCSPRFAIDNFLTNPTKVRDWNIQGLPSDAFSTENGIIVTRGNRWALMIDPQGQALKWIKNMEGNQGLKIIDLQMHDYLRVLEHAIQFGFPVLLQNVQEYLDPTLNPVLNKSVARIGGRMLIRIGDKEVEYNPNFRFYLTTKLSNPHYNPETSAKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIAAGKRKLKELEDEILRLLNEATGSLLDDVQLVNTLQTSKITATEVTEQLETSETTEINIDLAREAYRPCAQRASVLFFVLNDMGRIDPMYQFSLDAYIGLFILSIDKSHRSNKLEDRIEYLNDYHTYAVYRYTCRTLFERHKLLFSFHMCAKILETSGKLNMDEYNFFLRGGVVLDREGQMDNPCTSWLADAYWDNITELDKL--TNFHGLMNSFEQYPRDWHLWYTNSSPEKAMLPGEWENACNEMQRMLIVRSLRQDRVAFCVTSFIVSNLGSRFIEPPVLNMKSVMEDSTPRSPLVFILSPGVDPTSALLQLAEHTGMA-HRFHALSLGQGQAPIAARLLREGVNQGHWVFLANCHLSLSWMPNLDKLVEQLQVEDPHPSFRLWLSSSPHPDFPISILQASIKMTTEPPKGLKANMTRLYQ---LMTEAQFTHCSKPAKYKKLLFALCFFHSILLERKKFLQLGWNIIYGFNDSDFEVSENLLSLYLDEYEE-----TPWDALKYLIAGVNYGGHVTDDWDRRLLTTYINDYFCDLSLTT--PF-YRLSVLDTYYIPKDGSLASYKEYISMLPSMDPPEAFGQHPNADVASQITEARTLFETLLSLQPQITPTRVGGQSREEKVLELAADVKQKIPEMIDYEGTRKLLALDPSPLNVVLLQEIQRYNKLMKTILFSLTDLEKGIQGLIVMSTSLEEIFNCIFDAHVPPLWGKVYPSQ-KPLASWTRDLAVRVEQFETWASRARPPVLFWLSGFTFPTGFLTAVLQSAARQNNISVD-SLSWEFIVSTVDDSNLVYPPKDGVWVRGLYLEGAGWDRKNSCLVEAEPMQLVCLMPTIHFRPAESRKKSAKGMYSCPCYYYPNRAGSTDRASFVIGIDLRSGSMTSDHWIKRGTALLMSLD 4455          

HSP 2 Score: 72.4034 bits (176), Expect = 1.375e-10
Identity = 54/201 (26.87%), Postives = 106/201 (52.74%), Query Frame = 1
Query:  901 RDEFLISLKKFTSIVDQTIIQIASEVKLEIPDLDLFENDKENLSDKEIMEMIESTVLKWDQQITGTLESLQKIVPHGPS--PLAEIDFWRERNAXXXXXXXXXXXPKVKRILNLYSLAEGPV---FDTQNNELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIA 1488
            R+ F+  L +F + +  T  ++     L IP   +  + +  + DKE+++ +E++++ W +QI   L S Q+ V  G +  PL EI+FW  R   LS++ +QL    VK I ++  LA+      F     ++     +A+ N  FLS++   ++ +A+ +    +++ +P ++  +R+IW+ S HYN  ER+  L  ++ 
Sbjct:  229 RNHFVSHLHRFLASLTDTRYKLEGHTVLYIPAEAVQMDPEVVVKDKELVQRLETSMIHWTRQIKEVL-SAQESVETGENLGPLEEIEFWHNRCMDLSSISKQLVKKGVKHIESILFLAKSSYLTPFRKLAQQIQDGSRQAQSNLTFLSILREPYQELAF-MKPKDISEKLPKLISLIRIIWVNSPHYNTRERLTALFRKVC 427          
BLAST of Dynein heavy chain 10, axonemal vs. UniProt
Match: sp|Q9P225|DYH2_HUMAN (Dynein heavy chain 2, axonemal OS=Homo sapiens OX=9606 GN=DNAH2 PE=1 SV=3)

HSP 1 Score: 2285.37 bits (5921), Expect = 0.000e+0
Identity = 1403/4071 (34.46%), Postives = 2228/4071 (54.73%), Query Frame = 1
Query: 1900 WSNFMEDFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEVESIDQLFKTNMNNPPLYHFKSCVAGGISWERHLFYNIKRPILRFLTMDEMMQSDNGKRIRTKYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILALANSENFVSENVPEETIDKMDDDLRVDFGFEINEIITETRNLELLGYKVPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISDY-IEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFKLQSGNKFLKCKEFFEFMESERTSDFEHLGRKYSTIGPLITKLQGEIIGDRDVNPFEKFQPFYEFWEKRIFDRVYNMVLK-NLQDYQNMLRDEN--FPTCLFEVDLMLAGTDVIGNPQTTEIYKLAIQDLRDAVEATRVFIRWKRNSCIETTGMKIDGQDELFYFTFYLDIGNSV-----EITYFCEQIANYYRNIIGKLRKYQDKWKKHKRVFIPNKQAQIDKWLTKDPTVMDFYERIRDTIDRKEELLNQPVIRKIGFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDLSLIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSNHPIDQEEIEESDKLRQ---LFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKN-----LDIKVLDEGIEGFLKEWRKMPREVK-----AMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSS-DCECVQEHMIKMFDNISSLRFTK--GTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVFFYRES-KVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIK-KGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLH-------TKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTRE-GMNQ-------DTIEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQ-YVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSE--NAKSDKDYAMTDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEY--SEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVA-SVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEA--SVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEV-AKRKKP-YLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLT--KPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTA-FPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQ-TGKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGEPNVM-WLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQR-----RNAMGVGLVVEADLATTEHPSHWVLQGVCLILNTD 13926
            W      FR  +  +E    + I + F  +R       +L  F  + SR+AI +   +K  D+   +  E+  +++  + N   P L  + +  +G   W   L   I R +        + +   GK     Y  + + +     K F EW   +DK     L   +L ++           +E    +D    V+F   +  +  E    E L ++ P    NVA + E    + E LL +   Y+ +I  L   E  +  + I+ + + I PGL++L+W   G S + I +C +     +  V      T+ I  + +E+    L ++ SG +  +  EF E     R +  + L   +  +  ++T    E+  + D    ++    Y     R+ +    + +K +L +    +  +    P  LF+V L++   D+ G+    E +   +Q L   V           N    T  +     D L     + +   +V     +I     QI++   N    L+ Y   W  ++ ++  NK + I ++   +P V  F   I    +    +  +  +  I F+ ++   L   +  H   W++ +   L E A   L  +   ++ +   +S  P  LEEL   L  +  ++      E++I  + E++ +L     P++   +E  D L     +F     +SK +   L   K KF         DF K      + F+ +G  +        L  + +    L  +      L A   +F +   P  +L N++KE+  L QI+E+    +   ENW E  WK      L  + ++    G  +   K+ +E K      + T R+   K+++FK  +PL SDL++ ALRERHW ++  +  + FD   ++FTL  +  + +++  + I EI  SA+KEL+IE  ++ + +TW   +  + PY   G  R   L   +EV Q L+DN + L +M ASRF+  F   V +WE+ LSLI EV+++ + VQR+WMYLE IF+G DIR QLP E+  FD ++  +K IM    K     ++   P  L  L  ++  LE  QKSL+ YL++KR+ FPRF+F+S+D+LL ILG S + E VQ H+ K FDNI  LR  K  G S +  A  M S + E ++F   V +EG VE W+  +E  MR T R + +      R+    R +W+ ++ G V +  +QI WT +V       K +  K  LK   K   + +++    +R  L+K  R K+  ++ I++HARD+++   +  +MD   F+W SQLRFYW ++ D+  I+Q   QF Y YEY+G +GRLVITPLTDR Y+TLT AL ++ GG+P GPAGTGKTET KDL KALG+  +V NC EG+DY+S+G++++GL Q GAWGCFDEFNRI + VLSV++ Q+  I + L   L+ FHF+G EI L    GIFITMNPGYAGRTELPE++K+ FRP+ ++VPD   I EI+LF +GF + K+LAKK+ TLY L+ +QLS+Q+HYDFGLRAL S+L  AG+ RR  PDL++++VL+ ++RDMN+ K    DAPLF  ++QDLFP ++ P + Y    ++VE+ + +           K+ QLYET  +RH+TM+VG TG GK+   +IL AS + L           +  P+NPK  S+ ELYG  D +T +WTDG+LS++ R      +K + +++LFDG VD LW+ENMNSVMDDNK+LTL NGERI +    +LLFEV DL  ASPATVSRCGMVY D  +LG+ P+ Q WL K+  K E + L  +++K I           M     +  K ++PL   + +T LC +     T E G+N          +E  F+ S+ WS+   + E+ + + D +++ +               G  P++  T+++Y+ D   + + W  + + +P+ + + P   F +I+VPT+DTVR  +L++  +  Q P+LLVG  GT KT+++Q+ L++    ++  L +N S++TTS ++Q  +ES VEKRTK  Y P  GK ++ F+DD+NMP  D +G+Q P+ +++L ++    YDR K    K ++++  +AAMG PGGGR  + PR  S F++ N TFP+KS +  I+ ++++   Q F +E+K    ++T+ T+ +YN ++ +  PTP+K HY+FNLRD+S+++QGM +   D         R+W HE  RV  DRL++  D       I ++L    +           P +FGD+     + E ++YED+ +    K + +  + EY  S +V PM+LVLF +A++H+TRI R I    G+ LLVG+GGSG+QSL +LA+       F+I +++ Y +++ R+++K LY + G+E K+T F+F D  + +E FLE INN+LSSG VP L+  DE E I S + ++A    +  S +S++ Y + +  +NLHIVLC+SP+G+  R   R +P +VN TTI+WF  WP++AL  VA    IG +     +  R ++ + FV +H SV +YS++ + + RR NYVTP  YL+ ++ Y KLL +K +   +Q ++L+ GL K+ E    VQ+  L  + A +KVA  +K   CE  L  I  + + A E+++     S+ + V+  + +     A+  L EALP LE+A  AL+ L K D+ EI+S+ +PP  V++V + + + +   E  W  AK  + + +F++SL   D DNI+ K    +     +     D +  VS A   L  +V A+  Y  + R ++PKR ++        + +  L + + ++ ++  +L+ L ++Y+  + +++ L+++++ M+ +L  A  L++GL+ E  RW   +Q L++    L+GDCL+ +AFLSY+G F   +R E+V   W   + E ++P S  F +++ L N  ++  WN +GLP D  S +NGI+ TR +R+ L IDPQ QAL WI   E    LK       D+L+ LE AI +G P L ++V EY+DP ++ +L K++    GR  + +GDKEV+++ NFR Y+ TKLSNP Y P    K+ ++N+ V  +GLE QLL ++V+ ER ELEEQ++ L+   +  KR LK+LED +LR L  +TG++LD+ +L+NTL  +K  A+EV+E+L+    T    D  R+ YR  A+R +ILFFVL +M  I+ MYQ+SL AY+ +F  S+ KS     L+ R+  +    T  VY Y C  +FE+HKLLF+F +  K+    G L  DE +FF++G   ++   +   P   WL+D  W ++T+L ++    F  L+   E+    W  W  +  PE A LP ++ N     Q++ ++R  R DR+   +T ++I  +G  ++ PP+LN + + + STP SP+VFILSPG DP S +++LAE  G    +   +S+GQGQ   A  LL   + +GHW+ L NCHL + W+  L+K +E+L    PHP FRLWL++ P   FPI ILQ S+K+ TEPP GLK N+   Y+ ++    +  +  A +  L+F+L FFH+V+ ER+K+ ++GWNI Y FN+SDF V   +L  YL +  +      PW +LKYLI  + YGG   DD+DRR+L TY+++YF D    T  PFH   S   TY IP+  +     +YI  LP  + PE FG H NA++    + A+ ++  L+ +QPQ T      Q+R+E + E A+ +K K+P++ D +  +K   LD SP  VVLLQE++R+N L+  +  SL  L + + G + MS  L+++   +++  +P +W +  P + K LA W      R  Q+  W     P V+ WLSG   P  +LTA++Q++ R+N   +D S  +  +      + +      G +V GLYLEGAGWDR   CLV  +P QL+  +P I   P E+ +   +  +  P Y    R     R +  +G+ + +   T   P HW+ +G  L+++ D
Sbjct:  453 WHEDYNKFRAGIKDLEVMTQNLITSAFELVRDVPHGVLLLDTFHRLASREAIKRTYDKKAVDLYMLFNSELALVNR--ERNKKWPDLEPYVAQYSGKARWVHILRRRIDRVMTCLAGAHFLPRIGTGKESVHTYQQMVQAIDELVRKTFQEWTSSLDKDCIRRLDTPLLRIS-----------QEKAGMLD----VNFDKSLLILFAEIDYWERLLFETPHYVVNVAERAEDLRILRENLLLVARDYNRIIAMLSPDEQALFKERIRLLDKKIHPGLKKLHWALKGASAFFITECRIHASKVQMIVNEFKASTLTIGWRAQEMSEKLLVRI-SGKRVYRDLEFEEDQREHRAAVQQKLMNLHQDVVTIMTN-SYEVFKN-DGPEIQQQWMLYMIRLDRMMEDALRLNVKWSLLELSKAINGDGKTSPNPLFQV-LVILKNDLQGSVAQVE-FSPTLQTLAGVVNDIG-------NHLFSTISVFCHLPDILTKRKLHREPIQTVVEQDEDIKKIQTQISSGMTNNASLLQNYLKTWDMYREIWEINKDSFIHRYQRLNPPVSSFVADIARYTEVANNVQKEETVTNIQFVLLDCSHLKFSLVQHCNEWQNKFATLLREMAAGRLLELHTYLKENAEKISRPPQTLEELGVSLQLVDALKHDLANVETQIPPIHEQFAILEKYEVPVEDSVLEMLDSLNGEWVVFQQTLLDSKQM---LKKHKEKFKTGLIHSADDFKKKAHTLLEDFEFKGHFTSNVGYMSALDQITQVRAMLMAMREEENSLRANLGIFKIEQPPSKDLQNLEKELDALQQIWEI---ARDWEENWNE--WKTGRFLILQTETMETTAHGLFRRLTKLAKEYKDRNWEIIETTRS---KIEQFKRTMPLISDLRNPALRERHWDQVRDEIQREFDQESESFTLEQIVELGMDQHVEKIGEISASATKELAIEVALQNIAKTWDVTQLDIVPYKDKGHHR---LRGTEEVFQALEDNQVALSTMKASRFVKAFEKDVDHWERCLSLILEVIEMILTVQRQWMYLENIFLGEDIRKQLPNESTLFDQVNSNWKAIMDRMNKDNNALRSTHHPGLLDTLIEMNTILEDIQKSLDMYLETKRHIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKLLRIQKVGGPSSKWEAVGMFSGDGEYIDFLHSVFLEGPVESWLGDVEQTMRVTLRDLLRNCHLALRKFLNKRDKWVKEWAGQVVITASQIQWTADVTKCLLTAKERADKKILKVMKKNQVSILNKYSEAIRGNLTKIMRLKIVALVTIEIHARDVLEKLYKSGLMDVNSFDWLSQLRFYWEKDLDDCVIRQTNTQFQYNYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGIYVIVVNCSEGLDYKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAHQILCILSALAAGLTHFHFDGFEINLVWSCGIFITMNPGYAGRTELPENLKSMFRPIAMVVPDSTLIAEIILFGEGFGNCKILAKKVYTLYSLAVQQLSRQDHYDFGLRALTSLLRYAGKKRRLQPDLTDEEVLLLSMRDMNIAKLTSVDAPLFNAIVQDLFPNIELPVIDYGKLRETVEQEIRDMGLQSTPFTLTKVFQLYETKNSRHSTMIVGCTGSGKTASWRILQASLSSLCRAGDPNFNIVREFPLNPKALSLGELYGEYDLSTNEWTDGILSSVMRTACA-DEKPDEKWILFDGPVDTLWIENMNSVMDDNKVLTLINGERIAMPEQVSLLFEVEDLAMASPATVSRCGMVYTDYADLGWKPYVQSWLEKRP-KAEVEPLQRMFEKLI---------NKMLAFKKDNCKELVPLPEYSGITSLCKLYSALATPENGVNPADGENYVTMVEMTFVFSMIWSVCASVDEEGRKRIDSYLREI--------------EGSFPNK-DTVYEYFVDP--KIRSWTSFEDKLPKSWRYPPNAPFYKIMVPTVDTVRYNYLVSSLVANQNPILLVGPVGTGKTSIAQSVLQSLPSSQWSVLVVNMSAQTTSNNVQSIIESRVEKRTKGVYVPFGGKSMITFMDDLNMPAKDMFGSQPPLELIRLWIDYGFWYDRTKQ-TIKYIREMFLMAAMGPPGGGRTVISPRLRSRFNIINMTFPTKSQIIRIFGTMINQKLQDFEEEVKPIGNVVTEATLDMYNTVVQRFLPTPTKMHYLFNLRDISKVFQGMLRANKDFHDTKSSITRLWIHECFRVFSDRLVDAADTEAFMGIISDKLGSFFDLTFHHLCPSKRPPIFGDF-----LKEPKVYEDLTDLTVLKTVMETALNEYNLSPSVVPMQLVLFREAIEHITRIVRVIGQPRGNMLLVGIGGSGRQSLARLASSICDYTTFQIEVTKHYRKQEFRDDIKRLYRQAGVELKTTSFIFVDTQIADESFLEDINNILSSGEVPNLYKPDEFEEIQSHIIDQARVEQVPESSDSLFAYLIERVQNNLHIVLCLSPMGDPFRNWIRQYPALVNCTTINWFSEWPQEALLEVAEKCLIGVDLGTQENIHR-KVAQIFVTMHWSVAQYSQKMLLELRRHNYVTPTKYLELLSGYKKLLGEKRQELLAQANKLRTGLFKIDETREKVQVMSLELEDAKKKVAEFQKQ--CEEYLVIIVQQKREADEQQKAVTANSEKIAVEEIKCQALADNAQKDLEEALPALEEAMRALESLNKKDIGEIKSYGRPPAQVEIVMQAVMILRG-NEPTWAEAKRQLGEQNFIKSLINFDKDNISDKVLKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAALAQLREKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEETVQGLEEDLGYLVGDCLLAAAFLSYMGPFLTNYRDEIVNQIWIGKIWELQVPCSPSFAIDNFLCNPTKVRDWNIQGLPSDAFSTENGIIVTRGNRWALMIDPQAQALKWIKNMEGGQGLKIIDLQMSDYLRILEHAIHFGYPVLLQNVQEYLDPTLNPMLNKSVARIGGRLLMRIGDKEVEYNTNFRFYITTKLSNPHYSPETSAKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIAAGKRKLKELEDEILRLLNEATGSLLDDVQLVNTLHTSKITATEVTEQLETSETTEINTDLAREAYRPCAQRASILFFVLNDMGCIDPMYQFSLDAYISLFILSIDKSHRSNKLEDRIDYLNDYHTYAVYRYTCRTLFERHKLLFSFHMCAKILETSGKLNMDEYNFFLRGGVVLDREGQMDNPCSSWLADAYWDNITELDKL--TNFHGLMNSFEQYPRDWHLWYTNAAPEKAMLPGEWENACNEMQRMLIVRSLRQDRVAFCVTSFIITNLGSRFIEPPVLNMKSVLEDSTPRSPLVFILSPGVDPTSALLQLAEHMGMA-QRFHALSLGQGQAPIAARLLREGVTQGHWVFLANCHLSLSWMPNLDKLVEQLQVEDPHPSFRLWLSSIPHPDFPISILQVSIKMTTEPPKGLKANMTRLYQLMSEPQFSRCSKPAKYKKLLFSLCFFHSVLLERKKFLQLGWNIIYGFNDSDFEVSENLLSLYLDEYEE-----TPWDALKYLIAGINYGGHVTDDWDRRLLTTYINDYFCDQSLST--PFH-RLSALETYFIPKDGSLASYKEYISLLPGMDPPEAFGQHPNADVASQITEAQTLFDTLLSLQPQITPTRAGGQTREEKVLELAADVKQKIPEMIDYEGTQKLLALDPSPLNVVLLQEIQRYNTLMQTILFSLTDLEKGIQGLIVMSTSLEEIFNCIFDAHVPPLWGKAYP-SQKPLAAWTRDLAMRVEQFELWASRARPPVIFWLSGFTFPTGFLTAVLQSSARQNNVSVD-SLSWEFIVSTVDDSNLVYPPKDGVWVRGLYLEGAGWDRKNSCLVEAEPMQLVCLMPTIHFRPAESRKKSAKGMYSCPCYYYPNRAGSSDRASFVIGIDLRSGAMT---PDHWIKRGTALLMSLD 4426          

HSP 2 Score: 75.0998 bits (183), Expect = 2.125e-11
Identity = 55/201 (27.36%), Postives = 104/201 (51.74%), Query Frame = 1
Query:  901 RDEFLISLKKFTSIVDQTIIQIASEVKLEIPDLDLFENDKENLSDKEIMEMIESTVLKWDQQITGTLESLQKIVPHGPS--PLAEIDFWRERNAXXXXXXXXXXXPKVKRILNLYSLAEGPV---FDTQNNELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIA 1488
            R+ F   L KF + +  T  ++     L IP   +    +  + DKE+++ +E++++ W +QI   L S Q+ V  G +  PL EI+FWR R   LS + +QL    VK + ++  LA+      F     ++     +A+ N  FLS+++  ++ +A+ +    ++  +P ++  +R+IW+ S HYN  ER+  L  ++ 
Sbjct:  194 RNHFASHLHKFLACLTDTRYKLEGHTVLYIPAEAMNMKPEMVIKDKELVQRLETSMIHWTRQIKEML-SAQETVETGENLGPLEEIEFWRNRCMDLSGISKQLVKKGVKHVESILHLAKSSYLAPFMKLAQQIQDGSRQAQSNLTFLSILKEPYQELAF-MKPKDISSKLPKLISLIRIIWVNSPHYNTRERLTSLFRKVC 392          
BLAST of Dynein heavy chain 10, axonemal vs. UniProt
Match: sp|P23098|DYHC_TRIGR (Dynein beta chain, ciliary OS=Tripneustes gratilla OX=7673 PE=1 SV=1)

HSP 1 Score: 2274.59 bits (5893), Expect = 0.000e+0
Identity = 1446/4408 (32.80%), Postives = 2389/4408 (54.20%), Query Frame = 1
Query: 1015 DKENLSDKEIMEMIESTVLKWDQQITGTL--ESLQKIVPH-GPSPLAEIDFWRERNAXXXXXXXXXXXPKVKRILNLYSLAEG---PVFDTQNNELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIAWNLSDRVARLIDVNTIFNLPLEHVLKDTAEAEKMLRVWNDTYFEVRASIEASGRDAR----WEFDRKRLFEKTNYMADICHDLNEIAMILQEFYNIFGPELKSVTNE--AKRIXXXXXXXXXXXXPLKEMPFNPFNLMKHKYDWSNFMEDFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEVESIDQLFKTNM------NNPPLYHFKSCVAGGISWERHLFYNIKRPILRFLTMDE------MMQSDNGKRIRTKYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILALANSENFVSENVPEETIDKMDDDLRVDFGFEINEIITETRNLELLGYK-VPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISDYIEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFKLQSGNKFLKCKEFFEFMESERTSDFEHLGRKY---STIGPLITKLQGEIIGDRDVNPFEK-FQPFYEFWEKRIFDRVYNMVLKNLQDYQNMLRDENFPTCLFEVDLMLAGTDVIGNPQ-----TTEIYKLAIQDLRDAVEATRVFIRWKRNSCIETTGMKIDGQDELFYFTFYLDIGNSVEITYFCEQIANYYRNIIGKLRKYQDKWKKHKRVFIPNK-------------------QAQIDKWLTKDPTVMDFYERIRDTIDR----KEELLNQPVIRKIGFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDLS--LIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSNHPIDQEEIEESDKLRQLFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGG-DIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDCEC-VQEHMIKMFDNISSLRFTK---GTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTID--RVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTREGMNQDT----IEAIFIQSIYWSLGGCLIEDSQVKFD-QFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQ--MFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSENAKS-----DKDYAMTDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVF-----KNYKEINWKVAKGMMAD-PSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERK--IPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKN-IKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKRKKPYLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKF--ISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLT-KPHPDFRLWLTTEPTEA-----FPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNH---------TAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTG--KSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVEN-GEPNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMGVGLVVEADLATTEHPSHWVLQGVCLIL 13917
            +K++  D+ ++  IES ++ W  QI   L  +S Q ++    P P+ EI+FW+ +   L  + +QL+ PKV+++  L    +    P F+    ++     EA+D   +L  +    +S+   + F  +T  + P++  + +IW  S +YN   R++ L++ I   L D     +D + IF L  E  L+    A  +L+ W D Y E RA ++   +D R    WEF    +F + +        +  +     EF  +   E+ S+     ++++E++ ++ +E  +   E P++   L     ++ +  E+F +KV  ++ +    +   F      E  F ML  +  +  R  I      K+  ++  Y+ E++   +++  +M       N PL      VAG + W   L   I +P+     M+       +++S++ K +  KY  +   +  +E+K F  W   VD+V    L ++++                T D+    ++++F  ++  ++ E + L++ G + +PE A ++  + E   K V  L      Y+ V  ++  +E  ++  ++ ++   ++     LNW S  + +YI++    +H  E +V         I++ + E     LF+     K LK +      + +     + L ++Y   ST G  I  L  E +G    +     ++ + ++ +  + D  +N +   L          +    LFE  L L   D+I NP          Y L    + D  +   +  R   ++  E     ++G D+L       D+ N          + +  + I+ K ++Y++ +  +  +++ ++                   +A  +  + + P  +D ++   DT ++     +E+  + V     +  V+ K   + + +  K+W  ++   L +    +L+ ++  I+   + L+  +   D   L   +  +  ++      +     +++   +L   +  + +E   +  +L + +++    +  V  ++ P++     I + + + F      F ++F++E P       +     L + H E+  +E     L  +  LF + +  Y +L   ++E++ L  +++L    + + E+W  T W  ++++ ++   + F K+ R + +E++A      L   +K    +L   S+L++ A+RERHW++LM  T   F ++ +T TLS + A+ L+ F+D +  IV  A KE+ +EK ++E+  TW ++ F  +P+ + G     +L + +E+++ L+DN + LQ++  S+ I  FL  V  W+K LS    V+ +W  VQR W +LE IFIG  DIR+QLPE++K+FD ID  FK++ +E  K P + +A         L  +   L  C+K+L +YL++KR AFPRF+F+S  +LL IL   +    VQ H+ K+FDN++ L+F +   G   ++ A  M S E E ++F       G+VE W+ ++   MR T R    +AV  Y E K R QW++DY   VAL T Q+WWT EV   F ++++G + ++KDY K    Q++ ++  +   L+K DR K+ T+  IDVHARD+V   V   + +A+ F+W SQLR  W  +        C  QF Y YEY+G   RLVITPLTDR Y+TLTQ+L + + GAPAGPAGTGKTETTKDL +ALG++  V NC E MDY+S G I+ GL Q GAWGCFDEFNRI V VLSV++ Q+K +Q+ +  K  RF+F G+EI L   VGIFITMNPGYAGRTELPE++KA FRP  ++VPD + ICEIML ++GFL A++LA+K  TLY L KE LSKQ+HYD+GLRA+KSVLV+AG L+R DP   ED+VLMRALRD N+PK + +D P+F+GLI DLFP LD PR R  DF   V++   + K         K+VQL E +  RH+  V+G  G GKS V+K+L  + + ++    L+ +NPK  +  EL+GI++P TR+W DGL S I R+++  T     ++++ DGD+D +W+E++N+VMDDNK+LTLA+ ERI L     LLFE+  L+ A+PATVSR G++Y++P +LG+NP    W++ +E + E   L  L+ KY+P  +D  RV           + K IIP+   ++V  LC +L+C LT E    D      E  F+ +  W+ GG + +D  V +  +F K               K  + P++  T+FDY+ D  +E ++++PW+  VP +  +PE     +LV T +T R+ + +   ++  RPV+LVG  G  K+ +    L N   D  +   + F+  TTS  +QR LE  +EK+   +YGPP  K+L+ FIDDMNMP+VD YGT QP  +++  ++ +  YDR K L  K++    +++ M  P  G   ++ R    F VF  +FP + +L +IY+SILS H      S+ ++   P +   T+ ++ ++     PT  KFHY+FNLRDLS ++QG+  +  D       F R+W HE  RV  D++IND D     +A E+ + E AK      D++     P +   +   +   +   Y  + N+     +  E ++ Y+E  + M LVLF+DA+ H+ RI+R +    G+ALLVGVGGSGKQSL +LA+Y  S ++F+I L +GY   DL+ +L T+  K G++N  TVF+  D  V +E FL LIN++L+SG +P LF DDE E II  VRNE    G+  ++E+ W++F+++    L  VLC SPVG TLR R R FP VVN T+IDWF  WP++AL +V+  F+  E  L+  D +  I +    VH+SV E SK ++   RR NY TPK++L+ I  Y  LL  K K   ++ +RL+ GL KL   + Q+ +L  KLA Q+V + +K    + L++ +   T+  +++K IA ++ + V + ++E+ K+  +    L +A P L  A+ AL+ L KN++ E++SF  PP  V  V+  + V      K  K+ +WK AK +M    +FL SL   D +NI       +++ L+  +   + ++  S A  GL  +V  ++ + +V  +++PKR  + +        + +L  +K +I +L++ L +L  ++E A  ++ + Q+E +   R +  A++L+ GL+SEN RW   +   K Q+  L GD L+ +AF+SY+G F+  +R ++    W   +  +K  IP+++   +  +LT+D +I+ WN+EGLP D +S +N  + +   R+PL IDPQ Q + WI QK   ++L+        +L  +E AI  G   L ++++E IDPV+D VL +N IK  +GR ++ +GDKEV+++P+FRL L TKL+NP Y P +  ++ +IN+TVT  GLEDQLL+ +V  ER +LE+ +  L ++ +D K +LK+LED+LL  L+++ GN L +T L+  LE TK  A+E+S K++    T  +I++ R+ YR AA R ++L+F+L +++ IN +YQ+SL A+  VF   + ++ P  ++++R+ N++  +T +V+ Y   G+FE  KL+FT Q+  ++ + K  + Q+ELDF ++    + +     P  +L++ +W  +  L+ M    F  L  DIE     WK+++  E PE    P+++ NK  + QKLC++R  R DR+  A+  ++ E++G +YV    + F + ++++ P +P+ FILSPG DP  DV  L ++ GF      F  +S+GQGQE  A+  +D A   GHW+ILQN HL+ KWL  LEK LE+ +   H  +R++++ EP  +      P GIL+ S+K+  EPP G+  NL          +L NFN            F  ++F L +FHAVV ER+K+G  GWN  Y FN  D  + + +L  YL     + +SK+PW  L+YL GE+MYGG   DD+DRR+ RTY++EY    + D       Y +    + +P         +YI+ +    +P ++GLH NAEIG+ T+ +  ++  ++++QP+      G   SR+E I      I  KLP+ F++  +  K   D +P +VV  QE ER N+L   + +SL  L   L GE+ ++ +++D++ +L+  QIP  W + A  +L  L +W      R  +  QW  +   PNV+WL G   P+S+LTA++Q+  RKN WPLDK  L   VT+     + +    +G +VHGL++EGA WD     +   + K+L  ++PVI +  I   +   +N +  PVY T QR    G   V   +L + E  + W L GV L+L
Sbjct:  180 EKDDSYDRSLVHAIESVIIDWTHQIRDVLKRDSAQPLLEGLNPGPMVEINFWKAKCENLDCIFQQLRDPKVRKMKELLERTQSSYLPSFNNIERDVEAALTEAQDINCYLKPLIYQVESLD-ELEFPDMTPRLAPILHTVCLIWSNSDYYNTAPRIIVLLQEICNLLIDLCRTFLDPSEIFKLEPEESLEKVRGALAVLKAWRDLYDEHRAKLKDYFKDGREVKGWEFASPLVFTRMDNFTSRIETIQSLFETNVEFSKLEKTEMGSMKGRMLSQQVEKIHEEFQECAKVFTERPYD--GLDPQCQEFLDDYEEFEKKVFDLDRRLGSILCQGFDDCCGLEAVFKMLDCYGPLLDRPVIRNDFECKYPVVLMLYDLELDQAKEIYDEHMRVEENDGNAPLNKNMPDVAGQLKWSAQLRDRISKPMGSLKHMEHPTGVRRILESEDAKVVFQKYEEMINLLNKYEQKVFENWTKGVDEVCKTNLDQSLI----------------TRDESTKLIKINFDPKLVAVLREVKYLQIRGEESIPESAASIYEKHETLRKYVANLDLTQAWYNKVRNTVLEVEFPLIEGQLADLDTRLKQAESELNWTSDSVWEYIQETRDQVHDLEKRVQQTKDNVDRIKKIMAEWTKQPLFE----RKELKKESLLALDDRQ-----DRLKKRYAEISTAGEKIHSLIKENLGLFKADASSDIWKAYVDYVDDMVIDGFFNCIHCTLSYLLENTDPRHCAAPLFEARLELQVPDMIFNPSLDYGVADGFYDLVEMLISDTYKMASLVSRLAEHNGQEHYQADLEGMDDLS------DVRND---------LMDRVQTIMTKAQEYRNSFDNYAYLYVDDRKEFMRQFLLYNHVLTTEEIEAHAEDGVPECPPTLDQFKEQVDTYEKIYSEADEIEPEQVFD--AWFRVDSKPFKAALLNIIKKWSFMFKQHLIDHVTNSLSELQEFIKVGNSGLTKTVEEGDYNGLVECMGHLMAVKERQAATDEMFEPIKQTIELLKTYDQEMSEEVHTQLQELPEQWNNTKKIAITVKQQVAPLQANEVAIIRRKCTSFDVRQHEFRERFRKEAPFIFT--FEGPYQCLDRCHSEIYEMEEHMANLQESAGLFEVNMPDYKQLKACRREVRLLKALWDLIMIVRTSIEDWKTTPWLEINVEQMEMDCKKFAKDIRSLDKEMRAWDAYNGLDATVKNMLTSLRAVSELQNPAIRERHWQQLMAATKVKFTMDKET-TLSDLLALNLHNFEDEVRNIVDKAVKEMGMEKVLKELNTTWSSMDFEYEPHSRTGIS---LLKSNEELIETLEDNQVQLQNLMTSKHIAHFLEEVSGWQKKLSTTDSVITIWFEVQRTWSHLESIFIGSEDIRNQLPEDSKRFDGIDTDFKELASEMEKTPNVVEATNRARLYDRLEAIQGSLVVCEKALAEYLETKRLAFPRFYFVSSADLLDILSQGNNPSQVQRHLSKLFDNMAKLKFKQDDEGNDTKL-ALGMYSKEGEYVDFDKECECTGQVEVWLNRVMDAMRSTVRSQFADAVVSYEE-KPREQWLYDYPAQVALATTQVWWTTEVNISFARLEEGHENSMKDYNKKQIQQLNTLIGLLIGKLTKGDRQKIMTICTIDVHARDVVAMMVLKKVDNAQAFQWLSQLRHRWADDDKHCYANICDAQFKYSYEYLGNTPRLVITPLTDRCYITLTQSLHLVMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKSCGNIYKGLSQTGAWGCFDEFNRISVEVLSVVAVQVKCVQDAIRDKKERFNFMGEEISLIPSVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLDARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDPQRPEDQVLMRALRDFNVPKIVSDDTPVFMGLIGDLFPALDVPRRRDMDFEKVVKQSTLDLKLQAEDSFVLKVVQLEELLAVRHSVFVIGNAGTGKSQVLKVLNKTYSNMKRKPVLVDLNPKAVTNDELFGIINPATREWKDGLFSVIMRDMSNITHDGP-KWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPSMRLLFEISHLKTATPATVSRAGILYINPSDLGWNPIVTSWIDTREVQSERANLTILFDKYLPTLLDTLRV-----------RFKKIIPIPEQSMVQMLCYLLECLLTPENTPADCPKELYELYFVFASIWAFGGSMFQDQLVDYRVEFSKWWIT---------EFKTIKFPNQ-GTVFDYFID--QESKKFLPWSEKVPVFELDPEIPMQAVLVHTNETTRVRFFMDLLMERGRPVMLVGNAGLGKSVLVGDKLSNLGEDSMVA-NVPFNYYTTSEMLQRVLEKPLEKKAGRNYGPPGTKKLVYFIDDMNMPEVDTYGTVQPHTLIRQHMDYKHWYDRQK-LTLKEIHKCQYVSCMN-PTAGSFTINSRLQRHFCVFALSFPGQDALSTIYNSILSQHLANISVSNALQKLSPTVVSATLDLHKKVAQSFLPTAIKFHYVFNLRDLSNVFQGLLYSGPDLLKAPIDFARLWMHECQRVYGDKMINDQDI----EAFEKLVLEYAKKFFEDVDEEALKAKPNIHCHFATGIGDPK---YMQVPNWPELNKILVEALDTYNEINAVMNLVLFEDAMQHVCRINRILESPRGNALLVGVGGSGKQSLARLASYISSLEVFQITLRKGYGIPDLKLDLATVCMKAGLKNIGTVFLMTDAQVSDEKFLVLINDLLASGEIPDLFADDEVENIIGGVRNEVKGMGLQDTRENCWKFFIDRLRRQLKTVLCFSPVGTTLRVRSRKFPAVVNCTSIDWFHEWPQEALVSVSMRFLD-EVELLKGDIKKSIAEFMAYVHVSVNESSKLYLTNERRYNYTTPKSFLEQIKLYESLLSMKSKELTAKMERLENGLTKLQSTAQQVDDLKAKLASQEVELAQKNEDADKLIQVVGVETEKVSKEKAIADDEEKKVAIINEEVSKKAKDCSEDLAKAEPALLAAQEALNTLNKNNLTELKSFGSPPSAVLKVAAAVMVLLAPNGKIPKDRSWKAAKVVMNKVDAFLDSLINYDKENIHENCLKSIKEYLNDPEFEPEYIKGKSLAAGGLCSWVVNIVKFYNVYCDVEPKRIALQKANDELKAAQDKLALIKAKIAELDANLAELTAQFEKATSDKLKCQQEAEATSRTITLANRLVGGLASENVRWGEAVANFKIQEKTLPGDVLLITAFVSYIGCFTKTYRVDLQERMWLPFLKSQKDPIPITEGLDVLSMLTDDADIAVWNNEGLPSDRMSTENATILSNCQRWPLMIDPQLQGIKWIKQK-YGDDLRVIRIGQRGYLDTIENAISSGDTVLIENMEESIDPVLDPVLGRNTIK--KGR-YIKIGDKEVEYNPDFRLILQTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLANVVAQERPDLEKLKSDLTKQQNDFKIILKELEDNLLSRLSSAEGNFLGDTALVENLETTKRTAAEISVKVEEAKVTEVKINEARELYRPAAARASLLYFILNDLNKINPIYQFSLKAFNTVFSLPIARAEPCEDVKERVVNLIDCITYSVFIYTTRGLFEADKLIFTTQVAFQVLLMKKEIAQNELDFLLRFPIQVGLT---SPVDFLTNSAWGAIKSLSAM--EDFRNLDRDIEGSAKRWKKFVESECPEKEKFPQEWKNK-SALQKLCMMRALRADRMSYAVRNFIEEKLGSKYVEGRQVEFAKSYEETDPATPVFFILSPGVDPLKDVEALGKKLGFTFDNNNFHNVSLGQGQEIVAEQCMDLAAKEGHWVILQNIHLVAKWLSTLEKKLEQYSVGSHDSYRVYMSAEPAGSPEAHIIPQGILESSIKITNEPPTGMFANLH--------KALYNFNQDTLEMCAREAEFKVILFALCYFHAVVCERQKFGPQGWNRSYPFNTGDLTISVNVLYNYL-----EANSKVPWQDLRYLFGEIMYGGHITDDWDRRLCRTYLEEYMAPEMLDG----ELYLA--PGFPVPPNSDYKGYHQYIDEILPPESPYLYGLHPNAEIGFLTTESDNLFKIVLELQPRDAGGGGGGGSSREEKIKSLLDEIVEKLPEEFNMMEIMAKVE-DRTPYVVVAFQECERMNMLTSEIRRSLKELDLGLKGELTITPDMEDLSNALFLDQIPATWVKRAYPSLFGLTSWYADLLQRIKELEQWTADFALPNVVWLGGFFNPQSFLTAIMQSMARKNEWPLDKMCLQCDVTK-KNKEDFSSAPREGSYVHGLFMEGARWDTQTNMIADARLKELAPNMPVIFIKAIPVDKQDTRNIYECPVYKTKQR----GPTFVWTFNLKSKEKAAKWTLAGVALLL 4464          
BLAST of Dynein heavy chain 10, axonemal vs. TrEMBL
Match: gnl|BL_ORD_ID|18327842 (tr|A0A267GW52|A0A267GW52_9PLAT Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016204g1 PE=4 SV=1)

HSP 1 Score: 6109.64 bits (15849), Expect = 0.000e+0
Identity = 3034/4493 (67.53%), Postives = 3635/4493 (80.90%), Query Frame = 1
Query:  577 TLCFFLVRTTDDMVVLPSNINEANSELPSYFESGTLKG-DMLLLLSQLIHSVYDYMLSYHQHRVTSDLGMSRAST--PASQGRIPKKSQSDGDKIE--SIDEKVHETRAAVQARDEFLISLKKFTSIVDQTIIQIASEVKLEIPDLDLFENDKENLSDKEIMEMIESTVLKWDQQITGTLESLQKIVPHGPSPLAEIDFWRERNAXXXXXXXXXXXPKVKRILNLYSLAEGPVFDTQNNELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIAWNLSDRVARLIDVNTIFNLPLEHVLKDTAEAEKMLRVWNDTYFEVRASIEASGRDARWEFDRKRLFEKTNYMADICHDLNEIAMILQEFYNIFGPELKSVTNEAKRIXXXXXXXXXXXXPLKEMPFNPFNLMKHKYDWSNFMEDFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEVESIDQLFKTNMNNPPLYHFKSCVAGGISWERHLFYNIKRPILRFLTMDEMMQSDNGKRIRTKYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILALANSENFV------------------SENVPEETI-------------DKMDDDLRVDFGFEINEIITETRNLELLGYKVPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISDYIEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFKL---QSGNKFLKCKEFFEFMESERTSDFEHLGRKYSTIGPLITKLQGEIIGDRDVNPFEKFQPFYEFWEKRIFDRVYNMVLKNLQDYQNMLRDENFPTCLFEVDLMLAGTDVIGNPQTTEIYKLAIQDLRDAVEATRVFIRWKRNSCIETTGMKIDGQDELFYFTFYLDIGNSVEITYFCEQIANYYRNIIGKLRKYQDKWKKHKRVFIPNKQAQIDKWLTKDPTVMDFYERIRDTIDRKEELLNQPVIRKIGFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDLSLIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSNHPIDQEEIEESDKLRQLFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTREGMNQDTIEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQ-SNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSENAKSDKDYAMTDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKRKKPYLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALP---KDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLTKPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTGKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGEPNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMGVGLVVEADLATTEHPSHWVLQGVCLILNTD 13926
            T C++L+R ++ MV LP+++ EA   LP YF+SG +   + L +L+QLI +VY  +LSYHQH+ TS    S +    P   G        DG  IE  ++++++ E+R A  ARDEF I++ KF + + +T+ QI  +VKLE+P+LDL ++DKENL +K++M  IE+TV++W+  ++  +E LQK  P G  PL EIDFWRERNA LSAL+EQ KLPKVKRILNLY LAEG   ++Q  +L K + EAKDN KFLSLVERHFK++ +G NF +V ++I PMMQALRMIWIISRHYN+DERMVPLMERIAW L+DRVAR+IDV T++ +PLE V   T++A+K+L  W+  Y+EVRA IEASGRDARWEFD+ +LF KT++++ IC +L +IA  L+EF NIFGPELK+VT+E KRIEEVL++VE LV PLKE+ ++PF+L  ++ +W  FM+ F+  V  IE +A  FINNCF TLRSAE AF+ML++F+HIRSR+ I+ L+ QKFNDI+ QYEKE+ ++++LF+   ++PP + ++S +AG I+WERHLFY IKRPIL+F   +EMM SD GK +R  YL VG++MR +EE+   EW   V+  L +LL+KN+L  A   +                    S + P                 +  D+   VDF  ++ EII ET+ LELLGY VPELARNVALQ+E Y   V+ L  MV  YH+VI SL++ E ++L + ++ +KR I+PG +R+NWNSLG++DY+  CN  +  FE+KV TI K + DIE KLK+ID A LF+    +     +  K FFE M+  R +DF+ L RKY+ IGPL+TK++G ++ + +    +K   +YE WEKRIF+ VY MV++NLQ+Y  +L+++   + LF +DL L+GTDVIG PQ  E+ K A+QDLRDA+E T  F RWKR SC+    +K +G+DE F ++F+LDI +S E+      I+ +Y  +  +++++QD+WK++K +F PNK  Q DKW  K P ++D+Y+ I +  +R EEL  QP  R I F+ + L +L+ ++ DHF++W  +Y   L E+++  L  +K  I+    DL ++P  LE LK +L TI+ IQ +SL+ E ++ D++ER+RV+ L    I +E+ +   ++R  ++ L F+SK+ + RL   K KF   T + I +FG+ L+ FA++F+ EGPG++G+DLD GL +LK + +EL  +E ++  L AAE+LF+LPITPYPEL  VQKEMK +D IY +Y+ QKKARE W+ETLWK+L+++VL +GIE F K+ RK PRE++ M   + L EK+KEFK++LPLF DLKHEALRERHWKELM KTGQ FDINP+TFTL+SVF+MELNRFQD IAEIVT A+KELSIEKGVREVEETW  LKF+VQ Y+KG   RG+ILG+++EV+Q LDDNAMNLQSMSASRFIGPF  +VQNWEK+LS ISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFD IDKTFKKIM ET+K P IK AC   NRLSDL NLS GLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSD ECVQEHMIKMFDN++SL+F    + +  A  M+SSE E+M+FR     +GRVEDWMT +E EMR+TNR+ITKEAVF+YR  K R QWMFDYQGMV L  NQIWWTWEVEDVF+KI+KG KTALKDYAK LH QIDEIV  VRSPLSKNDR+K+TTVLIIDVHARDI+DSFVRDSIMDA+EFEWESQLRFYW++E DE+ ++QCTG+FGYGYEYMGLNGRLVITPLTDRIYLTLTQALSM LGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDY++VGKI +GLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQ+ LI+K +RF FEGQEIK+DSRVG+FITMNPGYAGRTELPESVKA FRPVVVIVPDLQQICEIMLFSQGF +AKVLAKKMTTLY+L++EQLSKQ+HYDFGLRALKSVLVMAG+LRR  PDLSEDKVLMRALRDMNLPKF+FED PLFLGLIQDLFPGLDCPRVRYPDFND+VE  LA   Y+ L  QADK+VQLYETMKTRHTTM+VGPTGGGKSVVI+ L  +QT L L TK+  MNPKDRSV+ELYG+LDP TRDWTDGLLSNIFREINKPTDKNERRY+LFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQ HCALLFEVGDLQYASPATVSRCGMV+VDPKNLGY PFW+ WLN +ENK E + LA +YKKY+P  ++ +IEG+++G+  EKLK IIPLTNLN+V QLC MLD  L +E    D IEA F+Q++YW LGG L+E+ +VK DQ++K +C+M   ++EE   A+AGE+P   PTLF+Y+FD   +K+EWIPW  LVP+YVH P  KF++ILVPTIDTVR TWLL + + +Q PVLLVGETGTSKT+VSQ FLR  D +KY+ L  NFSSRT+SLD+QRNLE+NVEKRTKD+YGPP+GKRLLVFIDDMNMPQVD YGTQQPIA+LKL++E++G YDRGKDLNW+KMQDIGF AAMGKPGGGRNDVDPRFISLF+VFN TFP++ SLFSIY+SIL+GH   FSDEI+  VP I  MTM++YNQII+QLPPTPSKFHYIFNLRDLSRI+ G+C TT++RFTK D   RVWR+E  RVI DRLI+ +DK  V   ++  L EN K   +Y M  PILFGDYR AL+ AE RLYED+ +YEAAK LFQEI+EEY+E+ + M LVLFDDAL+HLTRIHR IRMD GHALLVGVGGSGKQSLT+LAA+T  C+IFEI LSRGYSEKD RENLKTLYNKLGIEN+  VF+FGDQHV EEGFLELINNML+SGIVPALF DDE+E I+SQ+R EA SAG+ P++E++WQ+FVNKCASNLHIVL MSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFI P+N L+ +  R  IV HFVMVH SV EYSKEF+Q  RR NYVTPK+YLDFINTYLKLLE KDK+   QC+RLQGGLQKLAEA+VQL +LN KLA+QKVAVTEKT ACE LL+EI + T  A EKK+ A+EK + +E+QSKEI KEK EAE AL EALP LEQARLALDDL+KNDV EIRSFAKPP  VQ VSECI V K  KE++WK AKGMM+D +FL SL+ MDVD+IT KQS  VR+ LDK KIT+DEM++VSKAGYGLLKFV AVLGY DVAREIKPKR+KVARLEKTF   KR+L+K + ++ +LE ELK LN RYE A+ ER +LQEETDIM+RRL AADKLI+GLSSEN RW  DL  LKDQ++RL GDCL+ SAFL YVGAFS EFRK+MVY  W  D+ E++IP+S P+RLE ILTNDVEISKW SEGLPPDELSIQNGILTT ASRFP+CIDPQQQALNWI +KEE NNLK  TFND DFLKQLELAIK+G PFLF+DVDEYIDPVIDNVLEKNIKGDQGREFV+LGDKEVD+DPNFRLYLNTKL+NP+YGPN+FGKSMVINY+VTL+GLEDQLLSVIVKFER+ELEEQRERLIQETS+NK+LLKDLEDSLLRELATSTGNMLDN EL++TLE TK+KASEVSEKLKLGA+T+ +IDK RDGYR AAKRGAILFFVLA++STI++MYQYSL+AYL+VF+FSL+KSLPD  LQKRL N+M TLT N+Y YGCTGIFEKHKL+++FQIT+KLE+D+  L Q EL+FFIKGN ++E A+RKKP  W+ +  WQDV  L +  P +F  +L+DIE+ +  WK W + E+PE A  P   KDYS+    F KL +LRCFR+DR+YRAI +YV   MGE+YVTPPI++FE I DQS+P SPIVFILSPG++PA+D+ KLAERSGFG  +LKF+S+GQGQE  A  LL+ AI+RGHWL+LQNCHLLVKWLRELEK+LE+LTKPHPDFRLWLTTEPT+AFPIGILQRSLKVVTEPPNGLKLNLRSTY KI    L +  HT+FP+LVFTLAFFHAVVQERRKYGKIGWNI YDFNESDF+VC+QIL TYL KA D GD+KIPWGSLKYLIGEVMYGGRAID+FDRR+L TYMDEYFGDF+FDTFQPFHFY ++   Y IP+    D    YIE+LPL NTPEVFGLH NAEIGYYT+AAK+MW+KLI++QPQTG++    SRDE I   A  I  +L + FDL+++RK  GLDI PT VVLLQELERFN+L++RM +SL TL RAL GEVGMSAELDDVAK L+NGQ+P+IW++LAP TLKSLANW+ HF  RY QYSQWV   EP VMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYT+VTQ+A   +V E+AHQGCFV GLYLEGA WD     L++ +PKQLI  LPV+KVIPIEAHRLK QNTF TPVYVTSQRRNAMGVGLV EADLAT+EH SHWVLQGVCLILNTD
Sbjct:  209 TKCYYLIRNSEGMVPLPNSLAEARQTLPQYFQSGFIDASEPLKMLAQLITNVYSPLLSYHQHKSTSRSKSSDSKDSRPTGVGASSNAGDRDGVLIEGKTLEQEIRESRNAANARDEFSITIDKFKNTLQKTMQQIQGDVKLEVPELDLVDDDKENLKNKKLMAEIETTVMQWNHLVSEMIERLQKRKPVGNGPLPEIDFWRERNAQLSALVEQFKLPKVKRILNLYKLAEGSDVESQLTDLQKLYTEAKDNVKFLSLVERHFKNLTFGANFTSVNETILPMMQALRMIWIISRHYNRDERMVPLMERIAWVLTDRVARVIDVRTLYEMPLEEVKTITSDAKKVLDTWSRAYYEVRAEIEASGRDARWEFDKSKLFHKTDHISSICQNLYDIAQTLEEFNNIFGPELKAVTSETKRIEEVLEQVENLVAPLKEIFYDPFSL-SNQVEWKKFMDRFKMDVEIIEGEAKSFINNCFKTLRSAESAFEMLMKFKHIRSRKTISDLLMQKFNDILDQYEKEITNVNRLFEDGRDDPPCHQYQSRIAGSINWERHLFYTIKRPILKFQREEEMMGSDRGKIVRAHYLKVGKSMRDYEEQLHREWTKSVEDNLDQLLKKNLLCPAAGADPAAVVASGAVAASTTGAAPSSSHPPRSAALTPGSAMLAPAFQEGKDERYVVDFDPKLREIIQETKYLELLGYAVPELARNVALQEEKYLVYVDNLNAMVRRYHAVIDSLDAAETELLDEHLRHLKRVIQPGAKRMNWNSLGVNDYVNNCNKEIGEFEAKVHTIKKTSADIESKLKQIDAACLFRAPPKREDGTLVNGKVFFESMQQARNTDFDVLSRKYAAIGPLLTKIEGAVV-NTNSGRAKKMVKYYEHWEKRIFNCVYQMVIRNLQNYLAVLQED---SPLFAIDLRLSGTDVIGIPQAREVSKFAVQDLRDAIETTTQFRRWKRESCLLCDDIKEEGKDEPFIYSFFLDIKDSSEVQKMVADISQHYFKVESQVKRFQDRWKRYKNIFTPNKSNQADKWSAKSPKLIDYYDTITELKNRWEELKKQPPDRGIRFVQLRLGSLIKNISDHFQQWVKIYGTKLTETSQQALHQLKELIDNRTKDLEIVPESLELLKQVLQTIKDIQDMSLDVERQLLDIEERFRVIELHEISIPEEDWDLHLRIRSQWEELLFKSKDTDARLVSDKRKFIATTNQSIHEFGRVLQEFAERFRNEGPGAVGQDLDKGLALLKAYKEELAQVEEQKASLGAAEKLFDLPITPYPELLQVQKEMKGMDSIYGIYEEQKKARELWSETLWKDLNVQVLSDGIESFAKQLRKQPREIRQMSVGKALDEKMKEFKESLPLFMDLKHEALRERHWKELMEKTGQKFDINPETFTLASVFSMELNRFQDTIAEIVTCATKELSIEKGVREVEETWSNLKFTVQAYMKGTSNRGFILGSVEEVVQTLDDNAMNLQSMSASRFIGPFFQAVQNWEKSLSHISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDQIDKTFKKIMNETSKNPNIKMACHATNRLSDLENLSTGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDPECVQEHMIKMFDNVASLKFVTVNNKDKFAAGMVSSEGEMMDFRQSRAADGRVEDWMTNVEEEMRKTNRLITKEAVFYYRHKKSRTQWMFDYQGMVVLAGNQIWWTWEVEDVFQKIRKGGKTALKDYAKKLHGQIDEIVVQVRSPLSKNDRAKMTTVLIIDVHARDIIDSFVRDSIMDAREFEWESQLRFYWVKEPDELMVRQCTGEFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMQLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDYKAVGKILSGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQSALILKTNRFQFEGQEIKMDSRVGVFITMNPGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSQGFRTAKVLAKKMTTLYKLAREQLSKQHHYDFGLRALKSVLVMAGDLRRGSPDLSEDKVLMRALRDMNLPKFVFEDVPLFLGLIQDLFPGLDCPRVRYPDFNDAVERALAALDYVPLEQQADKVVQLYETMKTRHTTMIVGPTGGGKSVVIRALADAQTSLGLTTKIHTMNPKDRSVVELYGVLDPTTRDWTDGLLSNIFREINKPTDKNERRYILFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQAHCALLFEVGDLQYASPATVSRCGMVFVDPKNLGYEPFWEKWLNGRENKHEREVLAEMYKKYVPAVVEMIIEGIVDGKQGEKLKMIIPLTNLNIVIQLCYMLDALLVKETDKNDVIEAFFLQALYWGLGGALVEEGRVKLDQYVKYICSMSSPADEERNHARAGEMPQLEPTLFEYFFDG--DKEEWIPWKELVPKYVHQPGMKFNDILVPTIDTVRTTWLLEQMVGVQHPVLLVGETGTSKTSVSQNFLRQLDGEKYLLLMTNFSSRTSSLDVQRNLEANVEKRTKDTYGPPVGKRLLVFIDDMNMPQVDTYGTQQPIALLKLLIEKKGVYDRGKDLNWRKMQDIGFTAAMGKPGGGRNDVDPRFISLFTVFNVTFPAEESLFSIYNSILAGHTAQFSDEIREMVPNIVNMTMSLYNQIIIQLPPTPSKFHYIFNLRDLSRIFSGLCLTTVERFTKRDHMLRVWRNECCRVINDRLISTEDKDGVNALVKATLEENFKDHVEYVMRSPILFGDYRTALDEAEPRLYEDIQDYEAAKALFQEILEEYNESNTVMPLVLFDDALEHLTRIHRVIRMDKGHALLVGVGGSGKQSLTRLAAFTAGCEIFEITLSRGYSEKDFRENLKTLYNKLGIENRKMVFLFGDQHVAEEGFLELINNMLTSGIVPALFGDDEKEGILSQIRAEAQSAGVAPAREAVWQFFVNKCASNLHIVLAMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFISPDNQLVQESHRDSIVAHFVMVHQSVGEYSKEFLQTLRRYNYVTPKHYLDFINTYLKLLEQKDKYILGQCERLQGGLQKLAEAAVQLEDLNAKLAVQKVAVTEKTKACETLLEEIKTSTASANEKKETAKEKEKEIEIQSKEIGKEKKEAEEALAEALPALEQARLALDDLDKNDVTEIRSFAKPPPAVQTVSECIVVLKGIKEVSWKSAKGMMSDTNFLTSLRNMDVDSITGKQSGTVREYLDKRKITLDEMKAVSKAGYGLLKFVIAVLGYCDVAREIKPKRDKVARLEKTFNMTKRDLDKTQKDLARLEEELKSLNARYEEAMAERMKLQEETDIMERRLVAADKLISGLSSENVRWTNDLADLKDQRIRLTGDCLLSSAFLCYVGAFSSEFRKKMVYEDWLGDIQEKEIPISLPYRLETILTNDVEISKWTSEGLPPDELSIQNGILTTNASRFPMCIDPQQQALNWIKKKEEKNNLKICTFNDSDFLKQLELAIKFGFPFLFQDVDEYIDPVIDNVLEKNIKGDQGREFVMLGDKEVDYDPNFRLYLNTKLANPRYGPNVFGKSMVINYSVTLRGLEDQLLSVIVKFERRELEEQRERLIQETSENKKLLKDLEDSLLRELATSTGNMLDNVELVDTLENTKTKASEVSEKLKLGAKTASDIDKLRDGYRPAAKRGAILFFVLADLSTISTMYQYSLAAYLEVFQFSLRKSLPDAVLQKRLSNIMDTLTHNIYNYGCTGIFEKHKLMYSFQITVKLELDRERLKQTELEFFIKGNIALEKAERKKPNKWMPEEGWQDVVALAQRFPEQFGEILDDIEQHDRDWKHWYDGESPEAAQYPLKYKDYSD----FYKLMILRCFRVDRVYRAIEIYVTNAMGEKYVTPPIISFEAIFDQSSPISPIVFILSPGTEPANDLTKLAERSGFGLNRLKFLSLGQGQEKAAMALLETAISRGHWLMLQNCHLLVKWLRELEKELEKLTKPHPDFRLWLTTEPTDAFPIGILQRSLKVVTEPPNGLKLNLRSTYHKIHAQQLVDCPHTSFPALVFTLAFFHAVVQERRKYGKIGWNIAYDFNESDFKVCMQILNTYLVKAFDLGDTKIPWGSLKYLIGEVMYGGRAIDNFDRRVLNTYMDEYFGDFIFDTFQPFHFYVNEEVDYHIPEDGPKDSYTDYIETLPLTNTPEVFGLHPNAEIGYYTNAAKDMWAKLIELQPQTGEASGGISRDEFIGGVAGDILKRLHEEFDLEKIRKALGLDIGPTTVVLLQELERFNLLINRMRRSLTTLQRALAGEVGMSAELDDVAKCLFNGQLPEIWRKLAPATLKSLANWMNHFEKRYQQYSQWVNEEEPRVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTTVTQWARDEDVNEKAHQGCFVSGLYLEGADWDIENGHLIKQRPKQLITQLPVLKVIPIEAHRLKLQNTFRTPVYVTSQRRNAMGVGLVFEADLATSEHSSHWVLQGVCLILNTD 4690          
BLAST of Dynein heavy chain 10, axonemal vs. TrEMBL
Match: gnl|BL_ORD_ID|23864802 (tr|V4BRT3|V4BRT3_LOTGI Uncharacterized protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_122204 PE=4 SV=1)

HSP 1 Score: 5868.89 bits (15224), Expect = 0.000e+0
Identity = 2904/4460 (65.11%), Postives = 3538/4460 (79.33%), Query Frame = 1
Query:  589 FLVRTTDDMVVLPSNINEANSELPSYFESGTLKGDMLLLLSQLIHSVYDYMLSYHQHRVTSDLGMSRASTPASQGRIPKKSQSDGDKIESIDEKVHETRAAVQARDEFLISLKKFTSIVDQTIIQIASEVKLEIPDLDLFENDKENLSDKEIMEMIESTVLKWDQQITGTLESLQKIVPHGPSPLAEIDFWRERNAXXXXXXXXXXXPKVKRILNLYSLAEGPVFDTQNNELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIAWNLSDRVARLIDVNTIFNLPLEHVLKDTAEAEKMLRVWNDTYFEVRASIEASGRDARWEFDRKRLFEKTNYMADICHDLNEIAMILQEFYNIFGPELKSVTNEAKRIXXXXXXXXXXXXPLKEMPFNPFNLMKHKYDWSNFMEDFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEVESIDQLFKTNMNNPPLYHFKSCVAGGISWERHLFYNIKRPILRFLTMDEMMQSDNGKRIRTKYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILALANSENFVSENVPEETIDKMDDDLRVDFGFEINEIITETRNLELLGYKVPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISDYIEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFKL---QSGNKFLKCKEFFEFMESERTSDFEHLGRKYSTIGPLITKLQGEIIGDRDVNPFEKFQPFYEFWEKRIFDRVYNMVLKNLQDYQNMLRDENFPTCLFEVDLMLAGTDVIGNPQTTEIYKLAIQDLRDAVEATRVFIRWKRNSCIETTGMKIDGQDELFYFTFYLDIGNSVEITYFCEQIANYYRNIIGKLRKYQDKWKKHKRVFIPNKQAQIDKWLTKDPTVMDFYERIRDTIDRKEELLNQPVIRKIGFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDLSLIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSNHPIDQEEIEESDKLRQLFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQA----------DKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKE-NKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTREGMNQDTIEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSENAKSDKDYAMTDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKRKKPYLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLTKPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTGKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGEPNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMGVGLVVEADLATTEHPSHWVLQGVCLILNTD 13926
            + +R T  MV LP+++ EA+  LP YFE G L G  L++L Q+I  VY  +LS++QH+       SR  T  +Q      +  +  KI      V E+RA    RDEFLIS++KF++ +++T+ QI  EV+LEIP+L++  N  E L++ ++M  I     +W +Q+   L+S  K   H   PLAEIDFWRERNA LSAL EQLK+PKVK+ L +YS  +   FD   +EL K+  EAKDN +FLS +ERHFK+IA+G  F  V ++IP MM ALRM+WIISRHYNKDERMVPLMERIAW L++RVA++IDV  IF+   + V   TAEA KML  W ++YFEVR  IEASGRD RWEFDRK+LFE+T+YM  IC DL+EIA +L+EFYNIFGPELKSVT + KRIE+V+ +V+ LV P++++ F+PF+  K ++ W     +F+++V  IE +A  FI+  F TLRSAEGAFDMLL F+HIRSR+AIN  M QKF DI++QY KEV+++D LF+   ++PPL       +G I WER LF+ IK  I+RF TMDEMM + +GK  R KYL VG+ M+ FE+ ++ +WR +V+++L  LLR+N+L   +           ++    +    VDF  +++EII ET+ +E LG+ VPELARNVALQ+E Y K V+GL  M+  YH ++ SL+  EV +L D +K+++R +RPG +RLNWNSLGI+DY+ KC  A+  FES V  I K   DI ++L  I+++ +FK    +  +    CKEFFE +ESER  DFE L RKY  IGPL+TK++G ++   +     K   +Y +WEKR+++ +  +V++NL+ + + L  +     LF+V+ +L   DV+ +P T EI KL +Q +RD VE T++F+RW   +CIE    K++G+DE   F+F+ DI N+ EI   C  I    R  +  L +Y  +WKK+K ++  +KQ   DKW +K P+V++F ++++      +E+   P +++  FI +++  L + V+ H K+W D   N LH SAK +L  + N ++    DL   P  LE+LK++LSTI  I+ +SLE E+++ D+QERYR L + N  + + E +   +L +++  L  +SKNV+  L  VK KFT+IT++EI +F K+L+ FA+ FK EGPG++G DLD+GL  +KKF  E+   E +R EL  AE+LF+LPIT YP+L  V K+MK L+ IY LY+ Q  ARE WAETLW NL++++L +GIEGFLK  RK P++V+++  AR L EK+KEF+D+LPLF DLKHEALRERHWK+LM+KTGQ FDINP+TFTL++VFAMEL+RFQ+ I EIVT ASKE+ IEKGVREVEETW  +KF+VQ Y+KG   RGYILGA+D++LQILDD+AMNLQSMSASRF+GPFL SVQNWEK LSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFD IDKTFKKIM +T K P IK AC   NRL+DL NLS GLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSD ECVQEHMIKMFDNISSL+F KG + EM  TAM+S+E E+M++R+ V  EGRVEDWMT +  EMRR+NR+ITKEA+F Y  +  RV WM  YQGMV L  NQ+WWTWEVEDVFRK+KKG+KTALKDYAK LH QID++V  VRSPL+KNDR K  +VLIIDVHARDI+D FVRDSIMDA+EFEWESQLRFYW +E DE+ I+QCTG FGYGYEYMGLNGRLVITPLTDRIYLTLTQALSM LGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMD+++VGKIF+GLCQCGAWGCFDEFNRI+VSVLSVISTQLKTIQNGL++KL RFHFEGQEI LDSRVGIFITMNPGYAGRTELPESVKA FRPVVVIVPDLQQICEIMLFS+GFL AKVLAKKMT LY+L+KEQLSKQ HYDFGLRALKSVLVMAGEL+R  PDLSED VLMRALRDMNLPKF+FED PLFLGLI DLFPGLDCPRVRYP+FND+VE  + E+ YI L  Q           DK+VQ+YETM TRHTTM+VGPTGGGKSVVI  L  +Q++L + TKL  +NPKDRSVIELYGILDP TRDWTDGLLSNIFREINKPTDKNE++Y++FDGDVDALWVENMNSVMDDN+L+TLANGERIRLQ HCALLFEV DLQYASPAT+SRCGMVYVDPKNLGY P+W  W+N +   K E D L  LY+KY+P  ID V+EG++ G+  EK+KTI+PLTNLN+VTQL  ML+  LT+E    + +EA+F+Q++YWS+G  L+E  + KFD ++K L ++    ++D+ A  GELP     L++YY+D   E+++WIPWA LVP+Y+HNPE KF+EILVPTIDTVR TWL+   ++I+RPV+L+GETGTSK+A +  FLR  D D ++ L +NFSSRTTSLD+QRNLE+NVEKRTKD+YGPPMGKRL++F+DDMNMPQVD YGTQQPIA+LKL+LER G YDRGKDLNWK ++DIG++AAMGK GGGRN+ DPRF+SLFSVFN TFPS+ SL+SIY SIL GH Q F  EI++ V  ITKMTMT+Y  I+ +LPPTPSKFHYIFNLRDLSRIY G+C TT DRF K +QF RVWR+E  RVI DRLIN+ DK  V   ++  L EN  S  ++ + DP LFGDYR ALE +E RLYED+ +Y+A+K LFQEI+EEY+E+ +PM LVLFDDAL+HLTRIHR +RMD GH+LLVGVGGSGKQSL +LA++T  C++FEI LSRGYSE   R++LK LYN LG ENK   F+F DQHVVEEGFLELINNML+SG+VPAL+ DDE+E IIS +R+EA   G   ++ESIWQYFVNKCA+NLH+V+ MSPVG+TLRTRCRNFPG+VNN +IDWFFPWPEQALYAVASVFI PEN+LIPD+ R  +V H V+VH SV  YSK F+Q+ RR NYVTPKNYLDFINTYLKLLE+KD++  SQC+RL GGL K+A+AS  LA L+DKLA+Q+VAV EKT AC+ LL+EI   T+ ATEKK++AQ+K + +E Q+K I  EK EAE AL EALP LE AR+AL+DLEK+DV EIRSFAKPPK VQ V ECI V +  +E++WK AKGMM++ +FL+SL  MDVD IT KQ+  V+  L ++  T  +M++VS+AG GLLKFV AV+GY  VAREIKPKREKVA+LE+++ Q KR+L+K+  EI  LESEL  LNQ+YE A+ E++ LQEE +IM+RRL AADKLI+GL SEN RW+ +L+ LK+++VRLLGDCL+ SAFLSYVGAFSWEFR ++VY  WK+D+ ER+IP+SDPF+LED+LTNDVEISKW SEGLPPD+LSIQNGILTTRASRFP+CIDPQQQAL WI +KEE+NNLK  TFNDPDFLKQLELAIKYG PFLF+DVDEYIDPVIDNVLE+NIKG QGREFV+LGDKEVD+DPNFRLYLNTKL+NPKYGPN+FGKSMVINYTVTLKGLEDQLLSVIVK+ERKELEEQRERLIQETS NKRLLKDLEDSLLRELATS GNMLDN EL+ TLEETK+KASEVS KLK GA T+ +I+K RDGYR AAKRGAILFFVLAEMS +N+MYQYSL++YLDVF+FSLKKSLPD  L KRL+N+M TLT NVY YGCTGIFEKHKLLF+ QIT+KLE D+ +L Q+ELDFFIKGN ++E +KRKKP+ WL D  W+D T+L      KF  LL+DIE++E +WK+W + +TPE+   P  Y   L +FQ+L LLRCFR+DRIYRA+T Y+   MGE+YVTPPI++FE I +QSTP SPIVFILSPGSDPASD++KLAER  FGT KLK++SMGQGQE  A  LL+ AIARG WL+LQNCHLLV WL ELEK LE+L KPHPDFRLWLTT+PT  FPIGILQRSLKVVTEPPNGLKLNLRSTY KI  ++L+   H AF SL+F LAFFHAVVQERRKYGKIGWN+ YDFNESDFRVC+QIL TYL K+ DQGDSKIPW SLKYLIGEVMYGGRAIDDFDRR+LRTYMDEY GDF+FDTFQPFHFY ++   Y IP+    D+ + ++ESLPL NTPEVFGLH NAEIGYYT AA++MWS L+++QPQTG+SG   SR+E I++ A+ + +KLP+ FDLD++RKK+G+DISPT VVLLQELERF+ L+ RM +SL TL RAL GEVGMS+ELD+VA++L+NGQIP IW+RLAPDTLKSL NW+ HF  R+ QY+ WV   EP VMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQ+ TA +VTERAH GCFV GLYLEGA WDR + CL+R KPKQLIQ LPV+K+IPIE+HRLK QNT  TPVYVTSQRRNAMGVGLV EADLATTEH SHWVLQG CLILNTD
Sbjct:   24 YFLRNTPGMVPLPNSVEEADEMLPGYFEFGVLNGHSLVMLEQIITQVYMPLLSFNQHKNAG----SRQDTGTTQSSE-SSTPEESSKI-----NVAESRAKALLRDEFLISMQKFSASINRTLQQIEGEVRLEIPELEVGSNIDEILANNDLMWQIREICGEWRKQVQEALDSQLKKGHHSNGPLAEIDFWRERNASLSALSEQLKIPKVKQFLKIYSQVDSD-FDDLISELTKYDTEAKDNVRFLSTLERHFKNIAHGATFQVVIETIPSMMNALRMVWIISRHYNKDERMVPLMERIAWELAERVAKVIDVREIFDDGTDEVKTKTAEASKMLTTWRESYFEVRGMIEASGRDQRWEFDRKKLFERTDYMTSICDDLHEIAQVLEEFYNIFGPELKSVTGDPKRIEDVVYRVDALVFPIQQITFDPFS-QKEQHQWHRLKANFKKEVEEIEGEAKMFIDESFKTLRSAEGAFDMLLNFKHIRSREAINNQMMQKFKDILNQYGKEVDTMDHLFREFQDSPPLNKNNPPTSGTIFWERSLFHRIKHTIIRFQTMDEMMLTADGKDTRAKYLKVGKDMKRFEDIKYEQWRDHVEQILPSLLRRNLLLKPHHA---------QSGSLFEIKYLVDFDPQLHEIIAETKYMEQLGFSVPELARNVALQEEKYIKYVDGLQNMLSRYHRLLGSLDPAEVTLLDDHMKDLRRVLRPGAKRLNWNSLGINDYMSKCQSAIAKFESLVNQIQKNARDINQRLSMIEHSNMFKHLPPKYDDILPSCKEFFEHIESERHRDFELLARKYRAIGPLLTKMEGLVV-HTNTGKSPKLSQYYAYWEKRVYESLTKLVIRNLKSFHHALIGDK---ALFQVETLLVAPDVVLHPHTNEINKLILQCVRDGVEGTKLFVRWMNGTCIECPPQKVEGEDEPHVFSFFSDISNNSEILEVCSSIHQSVRRTLTSLARYLIRWKKYKSIWKVDKQPIADKWFSKGPSVVEFDDKLQYYYKTIDEVAALPTVKEQDFIKLHMGPLATDVKKHAKQWIDCLGNILHTSAKESLDQLWNMMDDKSDDLDQSPGVLEDLKSVLSTISDIKTMSLEVETQMRDIQERYRTLAMYNVEVPEAERDLQARLPEIWADLVLKSKNVDASLIVVKKKFTEITQDEIKEFRKNLEKFAETFKIEGPGAVGNDLDLGLEKMKKFRQEVAQYEGQRNELANAEKLFDLPITMYPDLVQVTKDMKGLEMIYALYEEQLAAREQWAETLWANLNVQILQDGIEGFLKTLRKFPKDVRSLPVARTLEEKMKEFRDSLPLFVDLKHEALRERHWKDLMSKTGQKFDINPETFTLANVFAMELHRFQETIGEIVTCASKEMGIEKGVREVEETWSNMKFTVQAYMKGTSNRGYILGAVDDILQILDDSAMNLQSMSASRFVGPFLNSVQNWEKGLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDQIDKTFKKIMNDTFKVPTIKTACHAQNRLADLQNLSSGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDPECVQEHMIKMFDNISSLKFQKGANNEMVVTAMVSAEGEMMDYRTTVSAEGRVEDWMTSVLDEMRRSNRLITKEAIFTYCNNIKRVDWMMQYQGMVCLAGNQVWWTWEVEDVFRKVKKGKKTALKDYAKQLHGQIDDLVVKVRSPLTKNDRLKFNSVLIIDVHARDIIDGFVRDSIMDAREFEWESQLRFYWEKEPDELLIRQCTGDFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMNLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDFKAVGKIFSGLCQCGAWGCFDEFNRIDVSVLSVISTQLKTIQNGLLLKLKRFHFEGQEINLDSRVGIFITMNPGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLLAKVLAKKMTVLYKLAKEQLSKQYHYDFGLRALKSVLVMAGELKRGSPDLSEDVVLMRALRDMNLPKFVFEDVPLFLGLIGDLFPGLDCPRVRYPNFNDAVEAVIQENNYIELPQQVRDFSLIGFRVDKVVQMYETMLTRHTTMIVGPTGGGKSVVINTLSQAQSRLGIQTKLFTINPKDRSVIELYGILDPATRDWTDGLLSNIFREINKPTDKNEKKYIVFDGDVDALWVENMNSVMDDNRLMTLANGERIRLQKHCALLFEVYDLQYASPATISRCGMVYVDPKNLGYKPYWDKWVNVRNCGKSEKDDLNRLYEKYVPNLIDMVVEGVVEGRQQEKIKTIVPLTNLNMVTQLSMMLNALLTKEIPEFEELEALFLQALYWSIGAGLLEAGRTKFDAYVKYLASLTMITDDDQQAGPGELPQS-SLLYEYYWDG--EQKKWIPWAKLVPKYIHNPEVKFNEILVPTIDTVRTTWLIKLMVEIKRPVVLIGETGTSKSATTANFLRGMDQDAHLLLNMNFSSRTTSLDVQRNLEANVEKRTKDTYGPPMGKRLIIFVDDMNMPQVDTYGTQQPIALLKLLLERGGIYDRGKDLNWKNLKDIGYIAAMGKAGGGRNETDPRFVSLFSVFNMTFPSEESLYSIYYSILKGHTQAFPQEIQDIVSSITKMTMTLYGMIVKELPPTPSKFHYIFNLRDLSRIYNGLCLTTPDRFQKPEQFLRVWRNECLRVIGDRLINEQDKEIVNVTMKGLLEENFNSSTEFVLRDPCLFGDYRTALEESEPRLYEDVQDYDASKALFQEILEEYNESHTPMNLVLFDDALEHLTRIHRVLRMDRGHSLLVGVGGSGKQSLCRLASFTAGCEVFEITLSRGYSESSFRDDLKVLYNMLGTENKKVSFLFTDQHVVEEGFLELINNMLTSGMVPALYADDEKEGIISGIRDEAIKNGAAHARESIWQYFVNKCANNLHVVMAMSPVGDTLRTRCRNFPGMVNNASIDWFFPWPEQALYAVASVFISPENNLIPDEHRENLVTHIVLVHTSVGHYSKMFLQRLRRNNYVTPKNYLDFINTYLKLLEEKDQYILSQCERLAGGLSKIADASDMLAVLSDKLAVQEVAVREKTAACQELLEEIAIGTKQATEKKEMAQKKGKEIEEQNKIIVVEKKEAEDALAEALPALEMARIALEDLEKSDVTEIRSFAKPPKAVQTVCECIVVMRGIREVSWKSAKGMMSEANFLKSLTEMDVDGITPKQTAAVKGLLKEMDTTPADMKAVSRAGAGLLKFVEAVMGYCSVAREIKPKREKVAKLERSYHQAKRDLDKITKEISALESELSKLNQKYEEAMSEKKALQEEAEIMERRLRAADKLISGLGSENVRWVKNLEELKNKRVRLLGDCLLNSAFLSYVGAFSWEFRNDLVYQEWKNDLKEREIPLSDPFKLEDLLTNDVEISKWTSEGLPPDDLSIQNGILTTRASRFPMCIDPQQQALKWIKKKEEANNLKVCTFNDPDFLKQLELAIKYGFPFLFQDVDEYIDPVIDNVLERNIKGGQGREFVMLGDKEVDYDPNFRLYLNTKLANPKYGPNVFGKSMVINYTVTLKGLEDQLLSVIVKYERKELEEQRERLIQETSVNKRLLKDLEDSLLRELATSQGNMLDNVELVETLEETKTKASEVSIKLKQGAETAIDIEKLRDGYRPAAKRGAILFFVLAEMSLVNTMYQYSLASYLDVFEFSLKKSLPDSILHKRLRNIMETLTHNVYNYGCTGIFEKHKLLFSLQITIKLEQDQSHLGQEELDFFIKGNIALEKSKRKKPFGWLPDEGWEDCTRLATEFSDKFGTLLDDIEKNENAWKEWYDHDTPESQPFPGRYEQSLAAFQRLMLLRCFRVDRIYRAVTEYITSVMGEKYVTPPIISFEAIFEQSTPMSPIVFILSPGSDPASDLMKLAERLEFGTNKLKYLSMGQGQEQVALQLLETAIARGQWLMLQNCHLLVNWLLELEKHLEKLNKPHPDFRLWLTTDPTPRFPIGILQRSLKVVTEPPNGLKLNLRSTYHKIPATALSECPHPAFSSLIFVLAFFHAVVQERRKYGKIGWNVSYDFNESDFRVCMQILNTYLTKSTDQGDSKIPWASLKYLIGEVMYGGRAIDDFDRRVLRTYMDEYMGDFIFDTFQPFHFYHNEEVDYKIPEPGPRDNYIDFLESLPLSNTPEVFGLHPNAEIGYYTQAARDMWSHLVELQPQTGESGGGISREEFIDKIATDVLNKLPEEFDLDKIRKKFGIDISPTTVVLLQELERFDKLIIRMRRSLTTLQRALAGEVGMSSELDEVARALFNGQIPSIWRRLAPDTLKSLGNWMIHFERRFKQYNFWVNESEPPVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQYQTADDVTERAHSGCFVTGLYLEGAAWDRKEMCLIRQKPKQLIQELPVLKIIPIESHRLKLQNTLRTPVYVTSQRRNAMGVGLVFEADLATTEHISHWVLQGACLILNTD 4455          
BLAST of Dynein heavy chain 10, axonemal vs. TrEMBL
Match: gnl|BL_ORD_ID|23898163 (tr|K1R5R4|K1R5R4_CRAGI Dynein heavy chain 10, axonemal OS=Crassostrea gigas OX=29159 GN=CGI_10024887 PE=4 SV=1)

HSP 1 Score: 5834.99 bits (15136), Expect = 0.000e+0
Identity = 2904/4494 (64.62%), Postives = 3544/4494 (78.86%), Query Frame = 1
Query:  574 DTLCFFLVRTTDDMVVLPSNINEANSELPSYFESGTLKGDMLLLLSQLIHSVYDYMLSYHQHR----VTSDLGMSRASTPASQGRIPKKSQSDGDKIESIDEKVHETRAAVQARDEFLISLKKFTSIVDQTIIQIASEVKLEIPDLDLFE-NDKENLSDKEIMEMIESTVLKWDQQITGTLESLQKIVPHGPSPLAEIDFWRERNAXXXXXXXXXXXPKVKRILNLYSLAEGPVFDTQNNELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIAWNLSDRVARLIDVNTIFN-----LPLEHVLKDTAEAEKMLRVWNDTYFEVRASIEASGRDARWEFDRKRLFEKTNYMADICHDLNEIAMILQEFYNIFGPELKSVTNEAKRIXXXXXXXXXXXXPLKEMPFNPFNLMKHKYDWSNFMEDFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEVESIDQLFKTNMNNPPLYHFKSCVAGGISWERHLFYNIKRPILRFLTMDEMMQSDNGKRIRTKYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNIL-------------------------------------ALANSENFVSENVPEETIDKMDDDLRVDFGFEINEIITETRNLELLGYKVPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISDYIEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFK---LQSGNKFLKCKEFFEFMESERTSDFEHLGRKYSTIGPLITKLQGEIIGDRDVNPFEKFQPFYEFWEKRIFDRVYNMVLKNLQDYQNMLRDENFPTCLFEVDLMLAGTDVIGNPQTTEIYKLAIQDLRDAVEATRVFIRWKRNSCIETTGMKIDGQDELFYFTFYLDIGNSVEITYFCEQIANYYRNIIGKLRKYQDKWKKHKRVFIPNKQAQIDKWLTKDPTVMDFYERIR---DTIDRKEELLNQPVIRKIGFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDLSLIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSNHPIDQEEIEESDKLRQLFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVFFY-RESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTREGMNQDTIEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDKP-AKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSENAKSDKDYAMTDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSL-DK-LKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKRKKPYLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLTKPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTGKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGEPNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMGVGLVVEADLATTEHPS 13884
            DT   + +R T  MV LP++  EANSELP YFE G L G  L++L Q+I  VY  +LSY+QHR          +SRA T A++  +  +   + +K +     V E+RA    RDEFLI+++KF S +++TI QI  EV+LEIP+++L +   +E L+D ++M +I+ +  +W +Q+ G L++  K  P G  PLAEIDFWRERNA LSAL EQLKLP V +++ +Y+  E    D +  ELNK+++EAKDN +FLS +ERHFK+I +G  F  V ++IP MM ALRM+WIISRHYNKDERMVPLM RIAW L++RV+++I++ TI+         E V   T+EA++ML VW + YFEVRA IEASGRD RWEFDRK+LFE+T++MA IC +L ++A +L+EFYNIFGPELK+VT + KRIEEVL +V+ LV+PL+E+ F+PF + ++K  W + ME F ++V SIE +A  FI+  F +LRSAEGAFDMLL F+HIRSR+AIN  M QKF DI+ QYEKEV ++D+LF+   +NPPL+     VAG I WER LF+ IK  I+RFLTM++MMQS+ GK  R KYL+V R M+ +E++++ EWR  V++ L  LL++N+L                                     A    EN  ++   +++   +     VDF  ++ EI++ET+ +E LG+ VPELARNVALQ+E Y   VEGL  M+  YH+++ SL+  E  +L D +++++R IRPG +RLNWNSLGI+D++ KC  A+  FES V  I K   DI ++L  I+   LFK    +  +    CKE+FE +E ER  DFE L RKY  IGPL+TK++G ++   +     K   +Y +WEK+++D +  +++ NL+ ++  LR       LF+V+ +LA  DV+ +PQ  E+YKL +Q +RD VE T++F+RW + +CIET   K++G+DE + F F+ DI  + EI  + + I    +N +  + +Y ++WKK++ ++  +KQA  DKW  K PTV+ F ++++    TID  E L   P+++    I +++  L S V++H K+W       L +SAK +L  +++ ++    DL   P  LE+LK +L+TI  I+ +SL+ E+RI DVQERYR L++ +  +  EE E   KL Q++D L ++SKN +  LT VKTKFT+IT+ +I DF KDL+ F++KF + GPG++G DL+ GL ++K F  E+  +E  RQEL  AE+LF+LPIT YP L  VQK+MK L+ +Y LY+ QK ARE WAETLW NL+++VL +GIEGFLK  RKMPREVK+M  AR +  K+KEF+D+LPLF DLKH+ALRERHWKELM KTGQ FDINP+TFTL++VF+MEL+RFQ+ I EIVT ASKE+ IEKGV+E++E W  +KF+V  Y+KG   RG+ILGA+DE+LQILDD++MNLQSMSASRF+GPFL SVQNWEK+LS ISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFD IDK FKKIM +  K P+IK  C  PNRL DL  LS GLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSD  CVQEHMIKM+DNI++LRF +G + E  A+AMIS+E E+MEFR  V  EGRVEDWMT +  EMR TNR+ITKEA+FFY  + K RV WM  YQGM+ L  NQ+WWTWEVEDVFRK+KKG KTALKDYAK  H QI ++V  VRSPLS NDR K  +VLIIDVHARDI+D FVRDSIMDAKEFEWESQLRFYW +E DE+ ++QCTG+FGYGYEYMGLNGRLVITPLTDRIYLTLTQALSM LGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMD+++VGKI++GLCQCGAWGCFDEFNRI+VSVLSVISTQLKTIQN LI+KL RFHFEGQEI LD RVGIFITMNPGYAGRTELPESVKA FRPVVVIVPDLQQICEIMLFS+GFL+AKVLAKKMT LY+L+KEQLSKQ HYDFGLRALKSVLVMAG+L+R  PDL ED VLMRALRDMNLPKF+FED PLFLGLI DLFPGLDCPRVRYP+FND+VE  L ++ Y +L  Q DK+VQLYETM TRHTTMVVGPTGGGKSVVI  L  +QTKL + TKL  +NPKDRSVI+LYGILDP TRDWTDGLLSNIFR+INKPTDKNER+Y+++DGDVDALWVENMNSVMDDNKLLTLANGERIRLQ HCA+LFEV DLQYASPATVSRCGMVYVDPKNLGY+PFW  ++N ++NK E D L  LY KY+   ID VIEG+ +G+  +K+KTI+PLTNLN+VTQL  MLD  L +E    D +EA F+Q++YWS+G  L+ED ++KFD  IK+L AM  +++++K  AKAGELPS  PTL++Y++D   E ++W+PW+  VP+YVH+PE+KF+EILVPT+DTVR TWLL   + I+ PV+LVGETGTSKTA +  FLR    + ++ L +NFSSRT+SLD+QRNLE+NVEKRTKD+YGPP G+RLL+FIDDMNMPQVD+YGTQQPIA+LKL+LER G YDRGKDLNWK M+DIG++AAMGK GGGRN+ DPRFISLF VFN TFPS  +LF IY+SIL+GH Q F  EI++ VP +TKMTM +Y+ I+  LPPTPSKFHYIFNLRDLSRIY GMC TT DRF+K + F RVWR+E  RVI DRLI+D DK  V    +E L EN K   + AM  PIL+GDYR ALE +E RLYED+ +Y+A K LFQEI+E+Y+E  +PM LVLFDDAL+HLTRIHR IRMD GHALLVGVGGSGKQSL KLA+Y   CD+FEI LSRGY E   R++LK LYNKLG+ENK TVF+F DQHV EEGFLELINNML+SG+VPAL+ DDE+E+I+  +R EA++AG    KE IWQYFVNKCA+NLHIVL MSPVG+ LRTRCRNFPG+VNN  IDWFFPWPEQALYAVASVFI P+N LIP+D+R E+V H VMVHL V + SK F Q+ RR NYVTPKNYLDFIN+YLKLLE+KDK+  + C+RLQGGLQK+AEAS QLA LND+LA+QKVAV EK+ ACE +L+EI++ T  ATEKK +A+ K + +E Q+  I KEK +AE +L EALP LE ARLAL+DL+K DV EIRSFAKPP  VQ V ECI VFK  +E++WK AKGMM++ +FL+SL  MDVD+IT +Q+  V+  + DK L +T++ M+S+SKAG GLLKFV AV+GY  VAREIKPKREKVARLEK F Q KR+L+K+ NEI+KLE+ELK+L  +YE A+ E+Q+L+EE  IM+RRL AADKLI+GL+SENKRW +DL  LK +++RLLGDCLV SAFLSYVGAFSWEFR +MVY+ W +D+ +R++P+S+PF+LE++LTN+VE+SKW SEGLPPDELSIQNGILTTRASRFP+CIDPQQQALNWI +KEE NNLK  TFND DFLKQLELAIKYG PFLFKDVDEYIDPVIDNVLEKNIKGD+GREF++LGDKEVD+DPNFRLYLNTKL+NPKY PN+FGKSMVINYTVTLKGLEDQLLSVIVKFER+ELEEQRERLIQETS NK+LLKDLED+LLRELA S GNMLDN ELI TLEETK+KA+EVSEKLKLGA+T+ +IDK RDGYR AA+RGAILFF+LA++STIN+MYQYSL AYL VF+ SLKKS+PD  LQKRL+N+M TLT N+Y YGCTGIFEKHKLLF+FQIT+KLE D+ ++TQ+ELDF+IKGN ++E ++RK PY W  +  W+D  +L E  P KFS L++DIER E  WK+W + +TPE  A P  Y   L +FQ+L LLRC R+DRIYRA+  YV + MGE+YV PPI++FE I DQSTP SPIVFILSPGSDPASD++KLAER  FG+ KLKF+SMGQGQE  A   L+ AIARG WL+LQNCHLLVKWLRELEK+LE+LTKPHPDFRLWLTTEPT++FPIGILQRSLKVVTEPPNGLKLNLR TY KI+  +L+   H AFPSLVFTLAFFHAVVQERRKYGKIGWNI YDFNESDFRVC QIL TYL KA +QGD KIPW SLKYLIGEVMYGGRAIDDFDRR+LRTYMDEY GDF+FDTFQPFHFY ++   Y IP+    D+   YIESLP  NTPEVFGLH NAEIGYYTSAA++MWS L+++QPQTG SGS  SR+E I + A  + +KLP  +++D++RKKYGLDI PT VVLLQELERFN L+ RM +SL TL +AL GEVGMS+ELD+V+++L+NGQIP IW+RLAP TLKSL NW+ HF  R  QY+ WV  GEP VMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQ+ +A +VTERAHQGCF+ GLYLEGA WDR   CL+R  PKQLIQ LPV+KVIPIEAHRLK QNTF TPVYVTS+RRNAMGVGLV EADLATTEH S
Sbjct:  223 DTKSVYFLRNTPGMVPLPNSSEEANSELPGYFEMGILNGHSLVMLEQIISQVYMPLLSYNQHRNGERKPEARAVSRADTKATEASMAGEEGEEEEKPKV---NVAESRAKAMLRDEFLINMQKFASGINRTIQQIEGEVRLEIPEIELGDLKLEEILADNDLMTVIKDSCSEWAKQVRGALDAELKKTPQGKGPLAEIDFWRERNASLSALTEQLKLPIVAQMIEIYNQVEVDFTDLKP-ELNKYYVEAKDNVRFLSTLERHFKNITHGATFQVVIETIPSMMNALRMVWIISRHYNKDERMVPLMSRIAWELAERVSKVINIRTIYGGEGPVTNTEEVKVKTSEAKRMLEVWKEQYFEVRAKIEASGRDQRWEFDRKKLFERTDHMAVICQNLYDVAQVLEEFYNIFGPELKAVTGDPKRIEEVLLRVDNLVKPLQEVGFDPFEI-QYKNSWKSQMEHFYKQVESIEGEAKMFIDESFQSLRSAEGAFDMLLNFKHIRSRKAINDQMMQKFKDILVQYEKEVTTMDELFQAQKDNPPLHKNHPPVAGAIFWERSLFHRIKHTIVRFLTMEDMMQSEMGKHARAKYLSVARQMKFYEDQKYEEWRQSVEQHLPSLLKRNLLIKPHHAAEEMRAAAQKEADEAAHQHHANINPDQEHHGAKTEGENQEADQSADQSNQAVQLKYLVDFDPQLTEIVSETKYMEQLGFSVPELARNVALQEEKYINYVEGLRFMLSRYHALLSSLDQAETSLLEDHMRDLRRVIRPGSKRLNWNSLGINDFVLKCRNAIGKFESLVNQIQKNAKDINQRLHMIECCNLFKPPPQKFPDTLPSCKEYFEHVERERGKDFEILARKYRAIGPLLTKMEGLVV-HTNSGRSPKLSAYYSYWEKKVYDALTKLIMSNLRRFEVALRTSK---PLFQVETLLAAPDVVLHPQANEVYKLTLQSVRDCVEGTKLFVRWMQGTCIETAPQKMEGEDEPYVFCFFTDISANPEIIDYVQTIQTDIKNTLTNMTRYLNRWKKYRSIWKVDKQAIADKWYQKGPTVVAFDDKLQYYYKTIDEVETL---PLVKDQDCIRLHMGPLASSVKEHAKQWIGHLGKILRDSAKESLYKLRDQLDDKSDDLEQTPSSLEDLKFVLTTISDIKSMSLDVETRIRDVQERYRTLSMYSIEVTDEEKEIQAKLPQIWDELVYKSKNTDAGLTVVKTKFTEITQTQIQDFKKDLEKFSEKFYDFGPGAVGTDLEKGLELMKTFRVEVGDLEAARQELANAEKLFDLPITMYPNLLEVQKQMKGLEMVYTLYEEQKAAREQWAETLWSNLNVQVLQDGIEGFLKSLRKMPREVKSMQAARAVESKMKEFRDSLPLFVDLKHDALRERHWKELMNKTGQKFDINPETFTLANVFSMELHRFQETIGEIVTMASKEMGIEKGVKEIDEQWSNMKFTVHAYMKGTSNRGWILGAVDEILQILDDSSMNLQSMSASRFVGPFLNSVQNWEKSLSHISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDQIDKMFKKIMNDVYKNPVIKICCHAPNRLQDLEALSLGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDPACVQEHMIKMYDNIAALRFQQGPNGETLASAMISAEGEVMEFRENVPAEGRVEDWMTSVLEEMRCTNRLITKEAIFFYCADGKTRVDWMMGYQGMICLAGNQVWWTWEVEDVFRKVKKGHKTALKDYAKKQHKQIGDLVVTVRSPLSSNDRKKFNSVLIIDVHARDIIDGFVRDSIMDAKEFEWESQLRFYWEKEPDELVVRQCTGEFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMNLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDFKAVGKIYSGLCQCGAWGCFDEFNRIDVSVLSVISTQLKTIQNALILKLKRFHFEGQEISLDLRVGIFITMNPGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLTAKVLAKKMTVLYKLAKEQLSKQYHYDFGLRALKSVLVMAGDLKRGSPDLPEDVVLMRALRDMNLPKFVFEDVPLFLGLIGDLFPGLDCPRVRYPNFNDAVEAVLEDNGYKMLDVQVDKVVQLYETMMTRHTTMVVGPTGGGKSVVINTLSQAQTKLGVPTKLFVINPKDRSVIDLYGILDPVTRDWTDGLLSNIFRDINKPTDKNERKYIVYDGDVDALWVENMNSVMDDNKLLTLANGERIRLQKHCAMLFEVFDLQYASPATVSRCGMVYVDPKNLGYDPFWYKYVNSRQNKQERDDLNRLYDKYVNSLIDMVIEGIHDGRQGDKMKTIVPLTNLNMVTQLAAMLDTLLIKEMGEPDELEAFFLQALYWSIGAALLEDGRIKFDAQIKNLAAMSTASDDEKNFAKAGELPSALPTLYEYFYDG--ELKQWVPWSKKVPKYVHDPERKFNEILVPTVDTVRATWLLELMVGIKHPVVLVGETGTSKTATTANFLRTLSTETHMLLNMNFSSRTSSLDVQRNLEANVEKRTKDTYGPPPGRRLLIFIDDMNMPQVDKYGTQQPIALLKLLLERGGMYDRGKDLNWKNMKDIGYIAAMGKAGGGRNETDPRFISLFCVFNMTFPSDDALFLIYNSILAGHTQPFPKEIQDAVPTLTKMTMALYSSIVNDLPPTPSKFHYIFNLRDLSRIYHGMCLTTPDRFSKVENFVRVWRNECLRVIGDRLISDVDKEIVNNKTKELLEENFKPYAENAMRSPILYGDYRTALEESEPRLYEDIQDYDACKALFQEILEDYNEGHTPMNLVLFDDALEHLTRIHRVIRMDQGHALLVGVGGSGKQSLCKLASYAAGCDVFEITLSRGYGESSFRDDLKILYNKLGMENKKTVFLFTDQHVAEEGFLELINNMLTSGMVPALYADDEKESIVGSIRQEATAAGCPHIKEMIWQYFVNKCANNLHIVLAMSPVGDALRTRCRNFPGMVNNANIDWFFPWPEQALYAVASVFISPDNQLIPEDKRQEVVSHIVMVHLDVVKSSKLFQQRLRRNNYVTPKNYLDFINSYLKLLEEKDKYILALCERLQGGLQKIAEASEQLAVLNDRLAVQKVAVAEKSEACEIMLEEISTGTVQATEKKSLAESKGKEIEEQNVVIAKEKADAEESLAEALPALEAARLALEDLDKGDVTEIRSFAKPPPEVQRVCECIVVFKGIREVSWKSAKGMMSEANFLKSLMEMDVDSITQRQTQAVKGLMSDKNLNLTLEAMKSISKAGSGLLKFVEAVMGYCVVAREIKPKREKVARLEKNFHQAKRDLDKITNEINKLENELKELGMKYEQAMSEKQQLEEEAAIMERRLIAADKLISGLTSENKRWQLDLNDLKQKRIRLLGDCLVSSAFLSYVGAFSWEFRNDMVYTDWVEDLHKREVPLSEPFKLEELLTNEVEVSKWTSEGLPPDELSIQNGILTTRASRFPMCIDPQQQALNWIKRKEEQNNLKVCTFNDHDFLKQLELAIKYGFPFLFKDVDEYIDPVIDNVLEKNIKGDKGREFILLGDKEVDYDPNFRLYLNTKLANPKYSPNVFGKSMVINYTVTLKGLEDQLLSVIVKFERRELEEQRERLIQETSTNKKLLKDLEDALLRELAQSQGNMLDNMELIQTLEETKTKATEVSEKLKLGAKTAIDIDKLRDGYRPAARRGAILFFILADLSTINTMYQYSLDAYLGVFELSLKKSMPDAILQKRLKNIMDTLTHNIYNYGCTGIFEKHKLLFSFQITIKLEQDQSHVTQEELDFYIKGNLALEKSRRKCPYSWFPEAGWEDAIRLAEEFPDKFSSLIDDIERHEKVWKKWFDSDTPEADAFPLKYEEGLSAFQRLMLLRCIRVDRIYRAVEEYVTKCMGEKYVNPPIISFESIFDQSTPVSPIVFILSPGSDPASDLMKLAERIEFGSNKLKFLSMGQGQEKLALQYLETAIARGQWLMLQNCHLLVKWLRELEKELEKLTKPHPDFRLWLTTEPTDSFPIGILQRSLKVVTEPPNGLKLNLRGTYHKISAQALSECPHNAFPSLVFTLAFFHAVVQERRKYGKIGWNIAYDFNESDFRVCQQILNTYLTKAFEQGDPKIPWASLKYLIGEVMYGGRAIDDFDRRVLRTYMDEYMGDFIFDTFQPFHFYHNEEVDYKIPEDGPRDNYTDYIESLPHANTPEVFGLHPNAEIGYYTSAARDMWSHLVELQPQTGDSGSGISREEFIGKIAKDVLAKLPPEYEMDKIRKKYGLDIPPTTVVLLQELERFNNLIIRMRRSLQTLQKALAGEVGMSSELDEVSRALFNGQIPAIWRRLAPATLKSLGNWMIHFERRLRQYNAWVNEGEPPVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQWQSADDVTERAHQGCFIDGLYLEGAAWDRENCCLIRQSPKQLIQDLPVMKVIPIEAHRLKLQNTFRTPVYVTSERRNAMGVGLVFEADLATTEHLS 4702          
BLAST of Dynein heavy chain 10, axonemal vs. TrEMBL
Match: gnl|BL_ORD_ID|22568284 (tr|A0A2C9JWZ8|A0A2C9JWZ8_BIOGL Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106071343 PE=4 SV=1)

HSP 1 Score: 5834.22 bits (15134), Expect = 0.000e+0
Identity = 2874/4472 (64.27%), Postives = 3523/4472 (78.78%), Query Frame = 1
Query:  568 AEDTLCFFLVRTTDDMVVLPSNINEANSELPSYFESGTLKGDMLLLLSQLIHSVYDYMLSYHQHRVTSDLGMSRASTPASQGRIPKK-SQSDGDKIESIDEKVHETRAAVQARDEFLISLKKFTSIVDQTIIQIASEVKLEIPDLDLFENDKENLSDKEIMEMIESTVLKWDQQITGTLESLQKIVPHGPSPLAEIDFWRERNAXXXXXXXXXXXPKVKRILNLYSLAEGPVFDTQNNELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIAWNLSDRVARLIDVNTIFNLPLEHVLKDTAEAEKMLRVWNDTYFEVRASIEASGRDARWEFDRKRLFEKTNYMADICHDLNEIAMILQEFYNIFGPELKSVTNEAKRIXXXXXXXXXXXXPLKEMPFNPFNLMKHKYDWSNFMEDFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEVESIDQLFKTNMNNPPLYHFKSCVAGGISWERHLFYNIKRPILRFLTMDEMMQSDNGKRIRTKYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILALANSENFVSENVP-EETIDKMDD--------------DLRVDFGFEINEIITETRNLELLGYKVPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISDYIEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFKL---QSGNKFLKCKEFFEFMESERTSDFEHLGRKYSTIGPLITKLQGEIIGDRDVNPFEKFQPFYEFWEKRIFDRVYNMVLKNLQDYQNMLRDENFPTCLFEVDLMLAGTDVIGNPQTTEIYKLAIQDLRDAVEATRVFIRWKRNSCIETTGMKIDGQDELFYFTFYLDIGNSVEITYFCEQIANYYRNIIGKLRKYQDKWKKHKRVFIPNKQAQIDKWLTKDPTVMDFYERIRDTIDRKEELLNQPVIRKIGFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDLSLIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSNHPIDQEEIEESDKLRQLFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTREGMNQDTIEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSENAKSDKDYAMTDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKRKKPYLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLTKPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTGKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGEPNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMGVGLVVEADLATTEHPSHWVLQGVCLILNTD 13926
            + D+ C + +R T  MV LP++I EA+  LPSYFE G L G  LL+L Q+I  VY  +LS++QHR  S  G +  S   S  R+    S S  D  + +D    E+++    RDEF+I+++KF S + +T+ QI  EV+L++P++D+ +N  E L ++ I+E I    L W +QI   LE+LQ     G  PLAEID+WRERNA LSAL EQLK+PKV R++ ++  A+G   +TQ+ ELNK+++EAKDN +FLS +ERHFK+I YG +F  V ++IP MM ALRM+WIISRHYNKD+RMVPLMERIAW L+DRV+++I+V  +F+LP E V + T++A +ML  W   Y EVR  IE SGRD RWEFD+K+LFEKT++M  IC DL  IA +L+EFYNIFGPELK+VT +  RIEEVL +V++LV+P + M F+PF+L K    W   +++F ++VV IEN+A  FI+  F +LRSAEGAFDMLL F+H+RSR+AIN  M QKF DI+ QY KEV+++DQLF      PP+       AG I W R LF+ IK  ++RF T++EM+ +D GK +R KYL+V R MRAFE+  +  W+  V+  L  LL++N+LA  + +  +  N     + DK DD                 VDF   + EII ET+ +E LG+ VPELARNVALQ+E Y + V+GL  M+  YH+++ SL+  E  +L D  K+++R +RPG +R+NWNSLGI+DYI KC  A+  FES V  I K   DI+++L  I++A LFK    +       CKE+FE++E ER  D E + RKY  IGPL+TK++G ++   +     K   +Y FWE+R+++ +  M++ NL  +     D    + LFEV+ +LA  DV+ +PQ  E+YKL +Q +RD VE +++F+RW   SC+E +  K++G+DELF F+F+ D+  + EI    +++ N  +  +  LR+Y  KWKK+K V+  +KQA  DKWL K+P+ ++  +R++      EE+      R    I + +  L   V++H K W       L ESAK  L ++   ++    DL   P  L++LK++LSTI  I+ +SL+  + I+D+QERYR L + N P+D ++ E   +L Q++D L  +SKN++  L  VK KFT+IT+++IS+F K L +F+D+F  EGPG++G DLD G+ ++K F +E+  +E  +QEL  AE+LF LPIT Y EL  VQKEM  L+ IY++Y+ QK ARE W+ETLW NL++++L +GIE FLK+ RK+PREV+ M  AR L +K+KEF+D+LPLF DLKHEALR+RHWKELM KTGQ F++NPDTFTL+++FAMEL+R++D IAEIVT ASKE+ IEKGVREVEETW  +KF+VQ Y+KG   RG+ILG+++EVLQ LDD++MNLQSMSASRFIGPFL +VQNWEK+LS ISEVL+VWM+VQRKWMYLEGIFIGGDIRSQLPEEAKKFD IDKTFKKIM +T K P+IK +C  PNRL DL  LS GLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSD ECVQEHMIKMFDNI++L+F KG + EM AT M+S+E+E M+FR+ V  +GRVEDWMT +  EMR TNR+ITKEA+F+Y   K RV WM DYQGMV L  NQ+WWTWEVEDVFRK+KKG KTA+K+YAK LH QID++V  VRSPLSKNDRSK  +VLIIDVHARDI+D FVRDSIMD++EFEWESQLRFYW +E D++ I+QCTG+FGYGYEYMGLNGRLVITPLTDRIYLTLTQALSM LGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDY++VGKI +GLCQCGAWGCFDEFNRI+VSVLSVISTQLKTIQN L++ L  FHFEGQEI LDSRVG+FITMNPGYAGRTELPESVKA FRPVVVIVPDLQQICEIMLFS+GFL AKVLAKKMT LY+L+KEQLSKQ HYDFGLRALKSVLVMAGEL+R  PDL+ED VLMRALRDMNLPKF+FED PLFLGLI DLFPGLDCPRVRYP+FND+VE+ L ++ Y++L  Q DK+VQ+YETM TRHTTM+VGPTGGGKSVVI  L  +Q++L + TKL  +NPKDRSVIELYGILDP TRDWTDGLLSNIFR+INKPTDKNER+Y+++DGDVDALWVENMNSVMDDNKLLTLANGERIRLQ HCA+LFEV DLQYASPAT+SRCGMVYVDPKNLGY P+WQ W++ +  K E D L  LY+KY+P  ID VIEG+ +G+ VEKLKTI+PLTNLN+V QL  ML+  L +E      +EA F+Q + WS+G  L+ED +V+FD ++K L ++ Q  EE+K A  GELP    TL++Y++D   E+++WIPW+ +VP Y HNP+ KF EILVPT+DTVR TWLL   ++I+RPV+L+GETGTSKTA    FLR  D ++++ L +NFSSRTTS+D+QRN+ESNVEKRTKD+YGPP GKRL++FIDDMNMPQVD YGTQQPIA+LKL+LER G YDRGKDLNWK M+D+G++AAMGK GGGRN+ DPRF+SLFSVFN TFP   SLF IY+SIL GH Q FS E++     IT MTM +Y+  + +LPPTPSKFHYIFNLRDLSRIY G+C +T DRF+K +QF R+WR+E  RVI DRLIND DK  + K I   L +N KS  ++ M +PIL+GDYR AL+  E RLYEDM +YEA K +FQEI+EEY+E+ +PM LVLFDDAL+HL+RIHR +RMD GHALLVGVGGSGKQSL +LA+Y   C +FEI LSRGY+E   RE+LK LYNKLG EN+   F+F DQHVVEEGFLELINNML+SG+VPAL+ DDE+E ++ Q+R+EA  AG G +KE IWQYF+NKCA+NLHIVL MSPVG+TLRTRCRNFPG VNN +IDWFFPWPEQALYAVASVFI PEN LIP ++R +IV H VMVH S+  YS +F+Q+ RR NYVTPKNYLDFINTY+KLL+++DKF  SQC+RL GGLQK+A+AS  LA LN+KLA+QKVAVTEKT ACE LL EI + T+ ATEKK  A+ K + +  QSK IE EK +AE AL EALP LE ARLALDDL+K DV EIRSFAKPP+ VQ V ECI V KN ++++WK A+GMM++ +FL++L+ MDVDNI+ KQ   V+  +  + +T+++M+S+SKAG GLLKFV AV+GY  VA+EI+PKREKVA+LEK F Q KR+LEKV  E+  LE EL++LN++YE A+ E+Q L+ E  IM+RRL AADKLI+GL SEN RW  DL+ LK ++V+LLGDCLV SAFLSYVGAFSWEFR ++VY  W +D+ ER +P+SDPFRLED+LTNDVEISKW SEGLPPDELSIQNGILTTRASRFP+CIDPQQQALNWI +KEE NNLK  TFNDPDFLKQLELAIKYG PFLF+DVDEYIDPVIDNVLEKNIKG QGREFV+LGDKEVD+DPNFRLYLNTKL+NPKYGPN+FGKSMVINYTVTLKGLEDQLLSVIVKFERKELEEQRERLI ETS NK+LLKDLEDSLLRELA S GNMLDN EL+ TLEETK+KA+EVSEKLKLGA+T+ +I+K RDGYR AAKRGAILFFVLAEMS +N+MYQYSL++YL+VF  SLKKSLPD  LQKRL+N+M TLT N+Y YGCTGIFEKHKLLF+FQI +KLE DK  +TQDELDFFIKG  ++E +KRKKP+ W  D  W+D  +L    P+ FS LL+DIER+E +WK+W + + PE+   P +Y  +L  FQ L LLRCFRIDRIYRA+T YV + MGE+YVTPPI++FE +++QSTP SPIVFILSPGSDPASD++KLA+R  FG+ KLKF+SMGQGQE  A  LL+ AI+RG WL+LQNCHLLV+WLREL+K LE++TKPHPDFRLWLTTEPT +FPI ILQRSLKVVTEPPNGLKLN+RSTY KI+ ++L +  H AF SLVFTLAFFHAVVQERRKYGKIGWN+ YDFNESDFRVC+QIL TYL KA   G++KIPW SLKYLIGEVMYGGRAIDDFDRRILRTYMDEY GDF+FD FQPFHFY  +   Y IP+    D  + YIESLPL NTPEVFGLH NAEIGYYT AA++MW+ L+D+QPQTG+S S  SR++ I++ A  + +KLP  FDLD++RK  G+DISPT VVLLQELERFN+L+ RM +SL TL RAL GEVGMS+ELDDVA+S++NGQIP IW+RLAPDTLKSL NW+ HF +RY QY+ WV   EP VMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVT++ +A +VTER   GCFVHGLYLEGAGWD  +  L+  +PKQLIQ LPV+K+IPIE+HRLK QNTF TPVY TSQRRNAMGVGLV EADLAT EH SHWVLQGVCLILNTD
Sbjct:  120 SADSDCIYFLRNTSGMVPLPASITEADETLPSYFEYGVLNGHSLLMLEQIITLVYMPLLSHNQHR--SSGGENLKSQSRSVSRVDTNVSLSKEDVNKQVDVVEVESKSKALLRDEFVINMQKFASAITRTLQQIEGEVRLDVPEIDIPDNLDEALKNESILEFIHEKCLDWQKQIQSALENLQHRQRQGNGPLAEIDYWRERNAALSALTEQLKIPKVARMIEIHIAADGDFEETQS-ELNKYYVEAKDNVRFLSTLERHFKNITYGTSFQVVKETIPSMMNALRMVWIISRHYNKDDRMVPLMERIAWELADRVSKVINVQELFHLPTEEVKQKTSDASQMLSAWKTVYLEVRQKIEISGRDQRWEFDKKKLFEKTDHMKTICEDLKRIAEVLEEFYNIFGPELKAVTGDPGRIEEVLLRVDKLVEPFEHMAFDPFSL-KDSVQWERLIKNFDQEVVEIENEAKSFIDESFQSLRSAEGAFDMLLNFRHLRSREAINNQMMQKFKDILVQYGKEVDTMDQLFTEYKEGPPVNKNYPPCAGSIYWTRSLFHRIKHTVIRFQTLEEMISTDMGKSMRAKYLSVARNMRAFEDGSYEHWKENVEATLPGLLKRNLLAKRSHQASLHVNSSVSPSGDKSDDRHSVGEIQVMNTEPKYVVDFDVRLAEIIAETKYIESLGFTVPELARNVALQEEKYIRYVDGLSRMLFRYHALLASLDFAEASLLEDHQKDLRRMLRPGAKRINWNSLGINDYIAKCESAIGKFESLVNQIQKNGRDIKQRLSMIEHADLFKTPKPKFPGHLPSCKEYFEYVEQERVKDMEIMARKYRAIGPLLTKMEGLVV-HTNTGRSPKMARYYAFWERRVYEALMKMIINNLVKFS---MDIKTSSPLFEVESLLAPPDVVLHPQANEVYKLTLQCVRDCVEGSKLFVRWLNGSCLECSPQKVEGEDELFVFSFFTDLAMNQEIIELIQKVQNDMKGTLTDLRRYLTKWKKYKNVWKVDKQATADKWLQKNPSPVELDDRLQYYHKTIEEINAMSDFRDQDCIRLKMTHLSCSVKEHAKEWIKTLGRLLQESAKNLLTNLHKTLDDKSDDLEQTPSTLDDLKSVLSTISDIKSMSLDVLNTISDIQERYRTLAMYNIPVDAKDKELQAQLPQMWDDLVLKSKNIDASLVKVKRKFTEITQDQISEFKKALTDFSDRFLLEGPGAVGEDLDKGVELMKMFKEEIHELESSKQELTNAEKLFELPITMYQELMKVQKEMSGLESIYQIYNEQKIAREQWSETLWANLNVQILQDGIEKFLKDLRKLPREVRQMAVARCLEDKMKEFRDSLPLFGDLKHEALRDRHWKELMVKTGQKFEMNPDTFTLANIFAMELHRYRDTIAEIVTCASKEMGIEKGVREVEETWNNMKFTVQAYMKGTSNRGFILGSVEEVLQSLDDSSMNLQSMSASRFIGPFLTNVQNWEKSLSHISEVLEVWMIVQRKWMYLEGIFIGGDIRSQLPEEAKKFDQIDKTFKKIMGDTYKTPLIKLSCHAPNRLQDLQGLSLGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDPECVQEHMIKMFDNIAALKFQKGPTNEMLATGMVSAEKEEMDFRTNVTADGRVEDWMTSVLAEMRSTNRLITKEAIFYYSYKKSRVDWMLDYQGMVCLAGNQVWWTWEVEDVFRKVKKGIKTAMKEYAKKLHKQIDDLVVKVRSPLSKNDRSKFNSVLIIDVHARDIIDCFVRDSIMDSREFEWESQLRFYWEKEPDQLVIRQCTGEFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMKLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDYKAVGKILSGLCQCGAWGCFDEFNRIDVSVLSVISTQLKTIQNALVLNLKNFHFEGQEIDLDSRVGVFITMNPGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLMAKVLAKKMTVLYKLAKEQLSKQYHYDFGLRALKSVLVMAGELKRGSPDLAEDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRVRYPNFNDAVEQVLQDNGYVLLPHQVDKVVQMYETMLTRHTTMIVGPTGGGKSVVINTLAQAQSRLGITTKLFVINPKDRSVIELYGILDPVTRDWTDGLLSNIFRDINKPTDKNERKYIVYDGDVDALWVENMNSVMDDNKLLTLANGERIRLQKHCAMLFEVFDLQYASPATISRCGMVYVDPKNLGYKPYWQKWVSTRSTKQEQDDLNLLYEKYVPNCIDLVIEGIQDGRQVEKLKTIVPLTNLNMVNQLSQMLNALLVKEVSEPLELEAFFLQCLIWSVGAGLLEDGRVRFDGYVKYLASLTQIQEENKYAGPGELPGT-QTLYEYFYDG--EEKKWIPWSKMVPVYKHNPDLKFYEILVPTVDTVRATWLLQMMVRIKRPVVLIGETGTSKTATIANFLRTLDQEQHLLLNMNFSSRTTSMDVQRNVESNVEKRTKDTYGPPPGKRLIIFIDDMNMPQVDTYGTQQPIALLKLLLERGGLYDRGKDLNWKNMRDMGYIAAMGKAGGGRNETDPRFVSLFSVFNMTFPDVESLFKIYNSILEGHLQAFSAELQALSSKITNMTMDLYSHSVKELPPTPSKFHYIFNLRDLSRIYNGLCLSTPDRFSKEEQFVRLWRNECHRVISDRLINDQDKELIAKKIVSLLEDNFKSHLEFVMREPILYGDYRTALDEGEPRLYEDMQDYEATKAVFQEILEEYNESHTPMNLVLFDDALEHLSRIHRVLRMDRGHALLVGVGGSGKQSLCRLASYAAGCQVFEIMLSRGYNENSFREDLKVLYNKLGTENQKVAFLFTDQHVVEEGFLELINNMLTSGMVPALYADDEKETLVGQLRDEALRAGAGHAKEMIWQYFINKCANNLHIVLAMSPVGDTLRTRCRNFPGTVNNASIDWFFPWPEQALYAVASVFISPENQLIPQEKRQDIVSHVVMVHQSIGVYSIKFLQRLRRNNYVTPKNYLDFINTYVKLLDEQDKFILSQCERLHGGLQKIADASEMLAVLNEKLAVQKVAVTEKTAACEALLAEIAAGTKAATEKKSFAEAKGEEIAEQSKVIEVEKKDAEDALAEALPALEAARLALDDLDKQDVTEIRSFAKPPREVQTVCECIVVLKNIRDVSWKSARGMMSEANFLKTLKEMDVDNISQKQMTTVKGLIKDIDLTLEQMKSISKAGAGLLKFVEAVMGYCAVAKEIRPKREKVAKLEKNFFQAKRDLEKVTKEVQALEEELQELNKKYEQAMTEKQALETEARIMERRLIAADKLISGLGSENIRWSKDLEELKKKRVQLLGDCLVSSAFLSYVGAFSWEFRNDLVYKDWVNDLKERNVPLSDPFRLEDLLTNDVEISKWTSEGLPPDELSIQNGILTTRASRFPMCIDPQQQALNWIKRKEEVNNLKVCTFNDPDFLKQLELAIKYGFPFLFQDVDEYIDPVIDNVLEKNIKGGQGREFVMLGDKEVDYDPNFRLYLNTKLANPKYGPNVFGKSMVINYTVTLKGLEDQLLSVIVKFERKELEEQRERLIMETSVNKKLLKDLEDSLLRELAQSQGNMLDNVELVETLEETKTKATEVSEKLKLGAKTAIDIEKLRDGYRPAAKRGAILFFVLAEMSQVNTMYQYSLASYLEVFGHSLKKSLPDSILQKRLKNIMDTLTHNIYNYGCTGIFEKHKLLFSFQINIKLEQDKQAVTQDELDFFIKGKVALEKSKRKKPFSWFPDEGWEDCNRLAADYPV-FSSLLDDIERNEKAWKKWFDHDAPESQPYPLNYHERLSDFQSLMLLRCFRIDRIYRAVTEYVTKTMGEKYVTPPIISFENVYEQSTPMSPIVFILSPGSDPASDLMKLADRIEFGSNKLKFLSMGQGQEKVALQLLETAISRGQWLMLQNCHLLVRWLRELDKQLEKMTKPHPDFRLWLTTEPTPSFPISILQRSLKVVTEPPNGLKLNMRSTYHKISATALADCEHAAFSSLVFTLAFFHAVVQERRKYGKIGWNVSYDFNESDFRVCMQILNTYLSKAVQNGETKIPWNSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYMGDFIFDKFQPFHFYHDETVDYHIPEDGPRDVYVDYIESLPLANTPEVFGLHPNAEIGYYTQAARDMWTHLVDLQPQTGESASGISREDFIDQIAQDVLNKLPAEFDLDKIRKNLGIDISPTTVVLLQELERFNLLIGRMRRSLVTLKRALAGEVGMSSELDDVARSMFNGQIPSIWRRLAPDTLKSLGNWMIHFENRYKQYNTWVNEAEPPVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTKYPSADDVTERTTSGCFVHGLYLEGAGWDLQESYLLPQRPKQLIQELPVLKIIPIESHRLKLQNTFRTPVYTTSQRRNAMGVGLVFEADLATQEHISHWVLQGVCLILNTD 4579          
BLAST of Dynein heavy chain 10, axonemal vs. TrEMBL
Match: gnl|BL_ORD_ID|15897438 (tr|A0A2C9JWZ0|A0A2C9JWZ0_BIOGL Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106071343 PE=4 SV=1)

HSP 1 Score: 5828.83 bits (15120), Expect = 0.000e+0
Identity = 2874/4487 (64.05%), Postives = 3523/4487 (78.52%), Query Frame = 1
Query:  568 AEDTLCFFLVRTTDDMVVLPSNINEANSELPSYFESGTLKGDMLLLLSQLIHSVYDYMLSYHQHRVTSDLGMSRASTPASQGRIPKK-SQSDGDKIESIDEKVHETRAAVQARDEFLISLKKFTSIVDQTIIQIASEVKLEIPDLDLFENDKENLSDKEIMEMIESTVLKWDQQITGTLESLQKIVPHGPSPLAEIDFWRERNAXXXXXXXXXXXPKVKRILNLYSLAEGPVFDTQNNELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIAWNLSDRVARLIDVNTIFNLPLEHVLKDTAEAEKMLRVWNDTYFEVRASIEASGRDARWEFDRKRLFEKTNYMADICHDLNEIAMILQEFYNIFGPELKSVTNEAKRIXXXXXXXXXXXXPLKEMPFNPFNLMKHKYDWSNFMEDFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEVESIDQLFKTNMNNPPLYHFKSCVAGGISWERHLFYNIKRPILRFLTMDEMMQSDNGKRIRTKYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILALANSENFVSENVP-EETIDKMDD-----------------------------DLRVDFGFEINEIITETRNLELLGYKVPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISDYIEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFKL---QSGNKFLKCKEFFEFMESERTSDFEHLGRKYSTIGPLITKLQGEIIGDRDVNPFEKFQPFYEFWEKRIFDRVYNMVLKNLQDYQNMLRDENFPTCLFEVDLMLAGTDVIGNPQTTEIYKLAIQDLRDAVEATRVFIRWKRNSCIETTGMKIDGQDELFYFTFYLDIGNSVEITYFCEQIANYYRNIIGKLRKYQDKWKKHKRVFIPNKQAQIDKWLTKDPTVMDFYERIRDTIDRKEELLNQPVIRKIGFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDLSLIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSNHPIDQEEIEESDKLRQLFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTREGMNQDTIEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSENAKSDKDYAMTDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKRKKPYLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLTKPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTGKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGEPNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMGVGLVVEADLATTEHPSHWVLQGVCLILNTD 13926
            + D+ C + +R T  MV LP++I EA+  LPSYFE G L G  LL+L Q+I  VY  +LS++QHR  S  G +  S   S  R+    S S  D  + +D    E+++    RDEF+I+++KF S + +T+ QI  EV+L++P++D+ +N  E L ++ I+E I    L W +QI   LE+LQ     G  PLAEID+WRERNA LSAL EQLK+PKV R++ ++  A+G   +TQ+ ELNK+++EAKDN +FLS +ERHFK+I YG +F  V ++IP MM ALRM+WIISRHYNKD+RMVPLMERIAW L+DRV+++I+V  +F+LP E V + T++A +ML  W   Y EVR  IE SGRD RWEFD+K+LFEKT++M  IC DL  IA +L+EFYNIFGPELK+VT +  RIEEVL +V++LV+P + M F+PF+L K    W   +++F ++VV IEN+A  FI+  F +LRSAEGAFDMLL F+H+RSR+AIN  M QKF DI+ QY KEV+++DQLF      PP+       AG I W R LF+ IK  ++RF T++EM+ +D GK +R KYL+V R MRAFE+  +  W+  V+  L  LL++N+LA  + +  +  N     + DK DD                                VDF   + EII ET+ +E LG+ VPELARNVALQ+E Y + V+GL  M+  YH+++ SL+  E  +L D  K+++R +RPG +R+NWNSLGI+DYI KC  A+  FES V  I K   DI+++L  I++A LFK    +       CKE+FE++E ER  D E + RKY  IGPL+TK++G ++   +     K   +Y FWE+R+++ +  M++ NL  +     D    + LFEV+ +LA  DV+ +PQ  E+YKL +Q +RD VE +++F+RW   SC+E +  K++G+DELF F+F+ D+  + EI    +++ N  +  +  LR+Y  KWKK+K V+  +KQA  DKWL K+P+ ++  +R++      EE+      R    I + +  L   V++H K W       L ESAK  L ++   ++    DL   P  L++LK++LSTI  I+ +SL+  + I+D+QERYR L + N P+D ++ E   +L Q++D L  +SKN++  L  VK KFT+IT+++IS+F K L +F+D+F  EGPG++G DLD G+ ++K F +E+  +E  +QEL  AE+LF LPIT Y EL  VQKEM  L+ IY++Y+ QK ARE W+ETLW NL++++L +GIE FLK+ RK+PREV+ M  AR L +K+KEF+D+LPLF DLKHEALR+RHWKELM KTGQ F++NPDTFTL+++FAMEL+R++D IAEIVT ASKE+ IEKGVREVEETW  +KF+VQ Y+KG   RG+ILG+++EVLQ LDD++MNLQSMSASRFIGPFL +VQNWEK+LS ISEVL+VWM+VQRKWMYLEGIFIGGDIRSQLPEEAKKFD IDKTFKKIM +T K P+IK +C  PNRL DL  LS GLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSD ECVQEHMIKMFDNI++L+F KG + EM AT M+S+E+E M+FR+ V  +GRVEDWMT +  EMR TNR+ITKEA+F+Y   K RV WM DYQGMV L  NQ+WWTWEVEDVFRK+KKG KTA+K+YAK LH QID++V  VRSPLSKNDRSK  +VLIIDVHARDI+D FVRDSIMD++EFEWESQLRFYW +E D++ I+QCTG+FGYGYEYMGLNGRLVITPLTDRIYLTLTQALSM LGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDY++VGKI +GLCQCGAWGCFDEFNRI+VSVLSVISTQLKTIQN L++ L  FHFEGQEI LDSRVG+FITMNPGYAGRTELPESVKA FRPVVVIVPDLQQICEIMLFS+GFL AKVLAKKMT LY+L+KEQLSKQ HYDFGLRALKSVLVMAGEL+R  PDL+ED VLMRALRDMNLPKF+FED PLFLGLI DLFPGLDCPRVRYP+FND+VE+ L ++ Y++L  Q DK+VQ+YETM TRHTTM+VGPTGGGKSVVI  L  +Q++L + TKL  +NPKDRSVIELYGILDP TRDWTDGLLSNIFR+INKPTDKNER+Y+++DGDVDALWVENMNSVMDDNKLLTLANGERIRLQ HCA+LFEV DLQYASPAT+SRCGMVYVDPKNLGY P+WQ W++ +  K E D L  LY+KY+P  ID VIEG+ +G+ VEKLKTI+PLTNLN+V QL  ML+  L +E      +EA F+Q + WS+G  L+ED +V+FD ++K L ++ Q  EE+K A  GELP    TL++Y++D   E+++WIPW+ +VP Y HNP+ KF EILVPT+DTVR TWLL   ++I+RPV+L+GETGTSKTA    FLR  D ++++ L +NFSSRTTS+D+QRN+ESNVEKRTKD+YGPP GKRL++FIDDMNMPQVD YGTQQPIA+LKL+LER G YDRGKDLNWK M+D+G++AAMGK GGGRN+ DPRF+SLFSVFN TFP   SLF IY+SIL GH Q FS E++     IT MTM +Y+  + +LPPTPSKFHYIFNLRDLSRIY G+C +T DRF+K +QF R+WR+E  RVI DRLIND DK  + K I   L +N KS  ++ M +PIL+GDYR AL+  E RLYEDM +YEA K +FQEI+EEY+E+ +PM LVLFDDAL+HL+RIHR +RMD GHALLVGVGGSGKQSL +LA+Y   C +FEI LSRGY+E   RE+LK LYNKLG EN+   F+F DQHVVEEGFLELINNML+SG+VPAL+ DDE+E ++ Q+R+EA  AG G +KE IWQYF+NKCA+NLHIVL MSPVG+TLRTRCRNFPG VNN +IDWFFPWPEQALYAVASVFI PEN LIP ++R +IV H VMVH S+  YS +F+Q+ RR NYVTPKNYLDFINTY+KLL+++DKF  SQC+RL GGLQK+A+AS  LA LN+KLA+QKVAVTEKT ACE LL EI + T+ ATEKK  A+ K + +  QSK IE EK +AE AL EALP LE ARLALDDL+K DV EIRSFAKPP+ VQ V ECI V KN ++++WK A+GMM++ +FL++L+ MDVDNI+ KQ   V+  +  + +T+++M+S+SKAG GLLKFV AV+GY  VA+EI+PKREKVA+LEK F Q KR+LEKV  E+  LE EL++LN++YE A+ E+Q L+ E  IM+RRL AADKLI+GL SEN RW  DL+ LK ++V+LLGDCLV SAFLSYVGAFSWEFR ++VY  W +D+ ER +P+SDPFRLED+LTNDVEISKW SEGLPPDELSIQNGILTTRASRFP+CIDPQQQALNWI +KEE NNLK  TFNDPDFLKQLELAIKYG PFLF+DVDEYIDPVIDNVLEKNIKG QGREFV+LGDKEVD+DPNFRLYLNTKL+NPKYGPN+FGKSMVINYTVTLKGLEDQLLSVIVKFERKELEEQRERLI ETS NK+LLKDLEDSLLRELA S GNMLDN EL+ TLEETK+KA+EVSEKLKLGA+T+ +I+K RDGYR AAKRGAILFFVLAEMS +N+MYQYSL++YL+VF  SLKKSLPD  LQKRL+N+M TLT N+Y YGCTGIFEKHKLLF+FQI +KLE DK  +TQDELDFFIKG  ++E +KRKKP+ W  D  W+D  +L    P+ FS LL+DIER+E +WK+W + + PE+   P +Y  +L  FQ L LLRCFRIDRIYRA+T YV + MGE+YVTPPI++FE +++QSTP SPIVFILSPGSDPASD++KLA+R  FG+ KLKF+SMGQGQE  A  LL+ AI+RG WL+LQNCHLLV+WLREL+K LE++TKPHPDFRLWLTTEPT +FPI ILQRSLKVVTEPPNGLKLN+RSTY KI+ ++L +  H AF SLVFTLAFFHAVVQERRKYGKIGWN+ YDFNESDFRVC+QIL TYL KA   G++KIPW SLKYLIGEVMYGGRAIDDFDRRILRTYMDEY GDF+FD FQPFHFY  +   Y IP+    D  + YIESLPL NTPEVFGLH NAEIGYYT AA++MW+ L+D+QPQTG+S S  SR++ I++ A  + +KLP  FDLD++RK  G+DISPT VVLLQELERFN+L+ RM +SL TL RAL GEVGMS+ELDDVA+S++NGQIP IW+RLAPDTLKSL NW+ HF +RY QY+ WV   EP VMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVT++ +A +VTER   GCFVHGLYLEGAGWD  +  L+  +PKQLIQ LPV+K+IPIE+HRLK QNTF TPVY TSQRRNAMGVGLV EADLAT EH SHWVLQGVCLILNTD
Sbjct:  120 SADSDCIYFLRNTSGMVPLPASITEADETLPSYFEYGVLNGHSLLMLEQIITLVYMPLLSHNQHR--SSGGENLKSQSRSVSRVDTNVSLSKEDVNKQVDVVEVESKSKALLRDEFVINMQKFASAITRTLQQIEGEVRLDVPEIDIPDNLDEALKNESILEFIHEKCLDWQKQIQSALENLQHRQRQGNGPLAEIDYWRERNAALSALTEQLKIPKVARMIEIHIAADGDFEETQS-ELNKYYVEAKDNVRFLSTLERHFKNITYGTSFQVVKETIPSMMNALRMVWIISRHYNKDDRMVPLMERIAWELADRVSKVINVQELFHLPTEEVKQKTSDASQMLSAWKTVYLEVRQKIEISGRDQRWEFDKKKLFEKTDHMKTICEDLKRIAEVLEEFYNIFGPELKAVTGDPGRIEEVLLRVDKLVEPFEHMAFDPFSL-KDSVQWERLIKNFDQEVVEIENEAKSFIDESFQSLRSAEGAFDMLLNFRHLRSREAINNQMMQKFKDILVQYGKEVDTMDQLFTEYKEGPPVNKNYPPCAGSIYWTRSLFHRIKHTVIRFQTLEEMISTDMGKSMRAKYLSVARNMRAFEDGSYEHWKENVEATLPGLLKRNLLAKRSHQASLHVNSSVSPSGDKSDDRHSVGEIQGIMKDKNAPTEMALQLMNTEPKYVVDFDVRLAEIIAETKYIESLGFTVPELARNVALQEEKYIRYVDGLSRMLFRYHALLASLDFAEASLLEDHQKDLRRMLRPGAKRINWNSLGINDYIAKCESAIGKFESLVNQIQKNGRDIKQRLSMIEHADLFKTPKPKFPGHLPSCKEYFEYVEQERVKDMEIMARKYRAIGPLLTKMEGLVV-HTNTGRSPKMARYYAFWERRVYEALMKMIINNLVKFS---MDIKTSSPLFEVESLLAPPDVVLHPQANEVYKLTLQCVRDCVEGSKLFVRWLNGSCLECSPQKVEGEDELFVFSFFTDLAMNQEIIELIQKVQNDMKGTLTDLRRYLTKWKKYKNVWKVDKQATADKWLQKNPSPVELDDRLQYYHKTIEEINAMSDFRDQDCIRLKMTHLSCSVKEHAKEWIKTLGRLLQESAKNLLTNLHKTLDDKSDDLEQTPSTLDDLKSVLSTISDIKSMSLDVLNTISDIQERYRTLAMYNIPVDAKDKELQAQLPQMWDDLVLKSKNIDASLVKVKRKFTEITQDQISEFKKALTDFSDRFLLEGPGAVGEDLDKGVELMKMFKEEIHELESSKQELTNAEKLFELPITMYQELMKVQKEMSGLESIYQIYNEQKIAREQWSETLWANLNVQILQDGIEKFLKDLRKLPREVRQMAVARCLEDKMKEFRDSLPLFGDLKHEALRDRHWKELMVKTGQKFEMNPDTFTLANIFAMELHRYRDTIAEIVTCASKEMGIEKGVREVEETWNNMKFTVQAYMKGTSNRGFILGSVEEVLQSLDDSSMNLQSMSASRFIGPFLTNVQNWEKSLSHISEVLEVWMIVQRKWMYLEGIFIGGDIRSQLPEEAKKFDQIDKTFKKIMGDTYKTPLIKLSCHAPNRLQDLQGLSLGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDPECVQEHMIKMFDNIAALKFQKGPTNEMLATGMVSAEKEEMDFRTNVTADGRVEDWMTSVLAEMRSTNRLITKEAIFYYSYKKSRVDWMLDYQGMVCLAGNQVWWTWEVEDVFRKVKKGIKTAMKEYAKKLHKQIDDLVVKVRSPLSKNDRSKFNSVLIIDVHARDIIDCFVRDSIMDSREFEWESQLRFYWEKEPDQLVIRQCTGEFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMKLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDYKAVGKILSGLCQCGAWGCFDEFNRIDVSVLSVISTQLKTIQNALVLNLKNFHFEGQEIDLDSRVGVFITMNPGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLMAKVLAKKMTVLYKLAKEQLSKQYHYDFGLRALKSVLVMAGELKRGSPDLAEDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRVRYPNFNDAVEQVLQDNGYVLLPHQVDKVVQMYETMLTRHTTMIVGPTGGGKSVVINTLAQAQSRLGITTKLFVINPKDRSVIELYGILDPVTRDWTDGLLSNIFRDINKPTDKNERKYIVYDGDVDALWVENMNSVMDDNKLLTLANGERIRLQKHCAMLFEVFDLQYASPATISRCGMVYVDPKNLGYKPYWQKWVSTRSTKQEQDDLNLLYEKYVPNCIDLVIEGIQDGRQVEKLKTIVPLTNLNMVNQLSQMLNALLVKEVSEPLELEAFFLQCLIWSVGAGLLEDGRVRFDGYVKYLASLTQIQEENKYAGPGELPGT-QTLYEYFYDG--EEKKWIPWSKMVPVYKHNPDLKFYEILVPTVDTVRATWLLQMMVRIKRPVVLIGETGTSKTATIANFLRTLDQEQHLLLNMNFSSRTTSMDVQRNVESNVEKRTKDTYGPPPGKRLIIFIDDMNMPQVDTYGTQQPIALLKLLLERGGLYDRGKDLNWKNMRDMGYIAAMGKAGGGRNETDPRFVSLFSVFNMTFPDVESLFKIYNSILEGHLQAFSAELQALSSKITNMTMDLYSHSVKELPPTPSKFHYIFNLRDLSRIYNGLCLSTPDRFSKEEQFVRLWRNECHRVISDRLINDQDKELIAKKIVSLLEDNFKSHLEFVMREPILYGDYRTALDEGEPRLYEDMQDYEATKAVFQEILEEYNESHTPMNLVLFDDALEHLSRIHRVLRMDRGHALLVGVGGSGKQSLCRLASYAAGCQVFEIMLSRGYNENSFREDLKVLYNKLGTENQKVAFLFTDQHVVEEGFLELINNMLTSGMVPALYADDEKETLVGQLRDEALRAGAGHAKEMIWQYFINKCANNLHIVLAMSPVGDTLRTRCRNFPGTVNNASIDWFFPWPEQALYAVASVFISPENQLIPQEKRQDIVSHVVMVHQSIGVYSIKFLQRLRRNNYVTPKNYLDFINTYVKLLDEQDKFILSQCERLHGGLQKIADASEMLAVLNEKLAVQKVAVTEKTAACEALLAEIAAGTKAATEKKSFAEAKGEEIAEQSKVIEVEKKDAEDALAEALPALEAARLALDDLDKQDVTEIRSFAKPPREVQTVCECIVVLKNIRDVSWKSARGMMSEANFLKTLKEMDVDNISQKQMTTVKGLIKDIDLTLEQMKSISKAGAGLLKFVEAVMGYCAVAKEIRPKREKVAKLEKNFFQAKRDLEKVTKEVQALEEELQELNKKYEQAMTEKQALETEARIMERRLIAADKLISGLGSENIRWSKDLEELKKKRVQLLGDCLVSSAFLSYVGAFSWEFRNDLVYKDWVNDLKERNVPLSDPFRLEDLLTNDVEISKWTSEGLPPDELSIQNGILTTRASRFPMCIDPQQQALNWIKRKEEVNNLKVCTFNDPDFLKQLELAIKYGFPFLFQDVDEYIDPVIDNVLEKNIKGGQGREFVMLGDKEVDYDPNFRLYLNTKLANPKYGPNVFGKSMVINYTVTLKGLEDQLLSVIVKFERKELEEQRERLIMETSVNKKLLKDLEDSLLRELAQSQGNMLDNVELVETLEETKTKATEVSEKLKLGAKTAIDIEKLRDGYRPAAKRGAILFFVLAEMSQVNTMYQYSLASYLEVFGHSLKKSLPDSILQKRLKNIMDTLTHNIYNYGCTGIFEKHKLLFSFQINIKLEQDKQAVTQDELDFFIKGKVALEKSKRKKPFSWFPDEGWEDCNRLAADYPV-FSSLLDDIERNEKAWKKWFDHDAPESQPYPLNYHERLSDFQSLMLLRCFRIDRIYRAVTEYVTKTMGEKYVTPPIISFENVYEQSTPMSPIVFILSPGSDPASDLMKLADRIEFGSNKLKFLSMGQGQEKVALQLLETAISRGQWLMLQNCHLLVRWLRELDKQLEKMTKPHPDFRLWLTTEPTPSFPISILQRSLKVVTEPPNGLKLNMRSTYHKISATALADCEHAAFSSLVFTLAFFHAVVQERRKYGKIGWNVSYDFNESDFRVCMQILNTYLSKAVQNGETKIPWNSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYMGDFIFDKFQPFHFYHDETVDYHIPEDGPRDVYVDYIESLPLANTPEVFGLHPNAEIGYYTQAARDMWTHLVDLQPQTGESASGISREDFIDQIAQDVLNKLPAEFDLDKIRKNLGIDISPTTVVLLQELERFNLLIGRMRRSLVTLKRALAGEVGMSSELDDVARSMFNGQIPSIWRRLAPDTLKSLGNWMIHFENRYKQYNTWVNEAEPPVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTKYPSADDVTERTTSGCFVHGLYLEGAGWDLQESYLLPQRPKQLIQELPVLKIIPIESHRLKLQNTFRTPVYTTSQRRNAMGVGLVFEADLATQEHISHWVLQGVCLILNTD 4594          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Cavefish
Match: si:dkeyp-86b9.1 (dynein axonemal heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:2941])

HSP 1 Score: 5183.23 bits (13444), Expect = 0.000e+0
Identity = 2612/4327 (60.37%), Postives = 3276/4327 (75.71%), Query Frame = 1
Query:  976 VKLEIPDLDLFENDKENLSDKEIMEMIESTVLKWDQQITGTLESLQKIVPHGPSPLAEIDFWRERNAXXXXXXXXXXXPKVKRILNLYSLAEGPV---FDTQNNELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIAWNLSDRVARLIDVNTIFNLPLEHVLKDTAEAEKMLRVWNDTYFEVRASIEASGRDARWEFDRKRLFEKTNYMADICHDL-NEIAMILQEFYNIFGPELKSVTNEAKRIXXXXXXXXXXXXPLKEMPFNPFNLMKHKYDWSNFMEDFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEVESIDQLFKTNMNNPPLYHFKSCVAGGISWERHLFYNIKRPILRFLTMDEMMQSDNGKRIRTKYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILALANSENFVSENVPEETIDKMDD---DLRVDFGFEINEIITETRNLELLGYKVPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISDYIEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFKLQSGNK---FLKCKEFFEFMESERTSDFEHLGRKYSTIGPLITKLQGEIIGDRDVNPFEKFQPFYEFWEKRIFDRVYNMVLKNLQDYQNMLRDENFPTCLFEVDLMLAGTDVIGNPQTTEIYKLAIQDLRDAVEATRVFIRWKRNSCIETTGMKIDGQDELFYFTFYLDIGNSVEITYFCEQIANYYRNIIGKLRKYQDKWKKHKRVFIPNKQAQIDKWLTKDPTVMDFYERIRDTIDRKEELLNQPVIRKIGFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDLSLIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSNHPIDQEEIEESDKLRQLFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTREGMNQDTIEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSENAKSDKDYAMTDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKRKKPYLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLTKPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTGKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGEPNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMGVGLVVEADLATTEHPSHWVLQGVCLILNTD 13926
            +KL IP+LDL +  +  L+++E +E++E  V+ W  QIT  LE  QK  P  P PLAEIDFWRER A LSAL EQLKLP VK+IL + + AE       D    ELN + +EA +N  FLS +ERHFK++A GV+F+ + ++IP MM  L+++WIIS HYN DERMVPLMERIAW LS+RVAR++++  +F    E       + +K+L  W   YFEVRA IE SG D RWEFDRK+LFEKT+YMA IC DL N + + L EFYN+FG E+++VT +++RI++V++ V+ LV P++E+ F+PF++ K    W   M+DFR KV        + IN+ F   R                                                    NPP+      VAG + WER LF+ IK PI+RF  + EM+ ++ GK +  KYL VGR MR +E K+   WR   +++L EL+ + +L                T+D   D    L V+F  E+ EII+ET  L+ LGY VPELARNVALQ+  + + V+ L  +V   HS++ SL   E  +LT +++E++R +R G RRLNWNSLGI+++I +   A+  FES V+ I K   D++ KL++I+ A LFK  + +K       KEFFE +E +R  D   L   Y+ IGPL+TK +  +I        E    +Y +WE++++D +  MVLKNLQ +   L      T LF+++ +L+  +++ +P++ ++YKL +Q +RD +E T+ F+RW   +CIE    ++DG+DE F F+FY +I    ++      ++   + ++G L +Y  +WK++  ++  +K   ++K+  K P  + + E+++   +  +E+  QP+++ +  + ++L+ L   V+++ + W       L++SA+ +L +++++++    +L   P  LE+LK +LSTI  I+ +S++ E R  D+QERYR LT+ N  + +EE++ +  +R ++  L  ES+ V+  L   K  FT+ITKE+I  + +++  FA+ F   GPG++G +LD G   L+   +EL  IE  RQ+L  AE+LF+LPIT YPEL NVQ+EM+ L QIYE+Y   K A+  W++TLW NL+I++L EG EGF+K  RK+P++V+AM  A  L  ++KEFK++LPL  DLK+EALR+R                   +     + + L +   +I              +GV+EV +TW  +KFSVQ Y KG +ERGYILG++DE+ Q LDDNA+NLQSM+ SRFIGPFL  +Q WEKNLSLISEV++VWM+VQRKWMYLE IFIGGDIRSQLPEEAKKFD IDK FKKIM++T + P IK+ C VPNRLSDL NLSDGLE+CQKSLNDYLDSKRNAFPRFFFISDDELLSILGSS+  CVQEHMIKM+DNI+SLRF  GT+ E  A A++S+E E+ME + PV  EGRVEDWMT + +EMRRTNR+ITKEA+F+Y + K RV WM DYQGMV L  NQ+WWTWEVEDVF+K+  G+K A+K YAK +H QID +V  +  PL KNDR KL TVLIIDVHARDIVDSFVRDSI DA EFEWESQLRFYW ++ D++ ++QC+ +F YGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTE+TKDLAKALGLLCVVTNCGEGMDY +VGKIF+GL QCGAWGCFDEFNRI+ SVLSVIS+Q++TI+N LI++L RF FEGQEI LDSR+GIFITMNPGYAGRTELPESVKA FRPVVVIVPDLQQICEIMLFS+GFL AKVLAKKMT LY+L++EQLSKQ+HYDFGLRALKSVLVMAGEL+R  PDL+ED VLMRALRDMNLPKF+FED PLFLGLI DLFPGLDCPRVRYP+FND+VE  L E+KY +L +Q DK+VQ+YETM TRHTTMVVGPTGGGKSVVI  LC +QT+L L TK+  +NPK  SVIELYGILDP TRDWTDG+LSNIFR+IN+PTDK ERRY+LFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMV+VDPKNL Y P+WQ W+N +  K + D L  L++KY+P  I+ V+EG+ +G+  EKLKTI+P T+LN+V QL  MLD  L  E ++ + +E  FI+++Y SLG  L+E  + KFD  +K L  +    +E   A  GE+P   PTLFD++FD   +K  W+PW++LV +Y+HNP+ KF +ILVPT+DT R+ WLL + +K++RPV+LVGE+GTSKTA +Q FL N +PD  + L INFSSRTTS+D+QR+LE++VEKRTK++YGPPMGK LLVF+DD+NMP+VD+YGTQQPIA+LKL+L+R G YDRGK+LN K+++D+GF+AAMGK GGGRN+VD RFISLFSVFN  FP + +L  IYSSIL GH + F + I+N    +T  T+ +Y  II  LPPTPSKFHYIFNLRDLSR+Y G+  T  +RF    QF RVWR+E  RV  DRLIN+ DK  VQ  I+  + E+  S+ D AM DPILFGDYR AL  +E R+YED+ +Y+A K LFQEI+EEY+E  + M LVLFDDALDHLTR+HR IRMD GHALLVGVGGSGKQSLTKLAA+T  CD+FEI LSRGYSE + RE+LKTLY KLGIENK TVF+F D HV EEGFLELINNML+SG+VPALFPDDE+E++++Q+R+EA   G G SKES+WQYF+NK ASNLHIVL MSPVG+ LRTRCRNFPG+VNNT IDWF PWP QAL+AVA  F+G E+ +IP      ++ H  MVH SV E+S  F QK RR NYVTPKNYLDFI+TY  LL+DKD+F  +QC RL+GGL KL EASVQLA+LN KLA QKV + EK+ ACE+LL+EI++ T IA EKK++A+EK++ +E Q+K I  EK +AE++L EALP LE AR+AL DL+K+DV EIRSFAKPPK VQVV ECI V + +KEINWK AKGMM++ +FL+SL  MD D+I+  Q   VR  L  L  + +EM+++SKAG G+LKFV AV+GY DVAREIKPKREKVARLEK F Q+KRELEK+++E++ ++ EL  L ++Y  A+ E+Q LQEE  +M+RRL AADKLI+GL SEN+RW  DL+ LK ++VRLLGDCL+ +AFLSY GAF+W+FR EMVY  W+ DV+ER IP+S PFR+E +LT++VEIS+W SE LPPDELS+QNGILTTRASRFP+CIDPQQQALNWI +KEE NNLK ++FNDPDFLKQLE+AIKYG PFLF+DVDEYIDPVIDNVLEKN+KG +GR+ ++LGDKEVD+DPNF+LYLNTKL+NPKY P +FGK+MVINYTVTLKGLEDQLLSVIV FERKELEEQRERLIQETS NKRLLKDLEDSLLRELATSTGNMLDN EL++TLEETKSKA EV EKLKL   TS +IDK RDGYR AAKRGAILFFVLAEM+ +NSMYQYSL+++L+VF +SL+KSLP+  L KRL N+M+TLT NVY YGCTG+FE+HKLLF+F +T+K+E  +G   Q+EL+FF+KGN S+E +KRKKP  WL D  W+D+ +L E+ P +F  L+EDIE++   WK W + ++PE A  P  Y + L  FQKL LLRCFR+DR+YRA++ YV   MGE+YV PP+++FE I +QSTP SPIVFILSPG +PA+D++KLAERSGFGT +LKF++MGQGQE  A  LL+ A++RG WL+LQNCHLLVKWL++LEK LER+TKPHPDFRLWLTT+P   FPIGILQ+SLKVVTEPPNGLKLN+R+TY KI L +L +  H A+ SLV+ LAFFHAVVQERRKYGKIGWN+PYDFNESDF VC++IL TYL KA +QG+  IPWGSLKYLIGEVMYGGRAID FDRRIL  YMDEY GDF+FDTFQPFHF+ +K   Y IP   + +  ++ IESLPL NTPEVFGLH NAEIGYYT AA++MW+ LI++QPQTG SG   SRDE I + A  I++KLP  FDLD +RKK G D+SPT VVLLQELERFN LV RM++SL  L RAL GEVGMS+ELD+VA++L+NGQIP IW++LAPDTLKSL NW+ HF  R+ QYS WVE GEP VMWLSGLHIPESYLTALVQATCR+NGWPLD+STLYT VT + +  EVTE+  QGC+V GLYLEGA WD  Q CLVR KPK+L+  LP++KVIPIEAHRL+ QNT  TPVY TS RRNAMGVGLV EADL TTEH SHWVLQGVCL LN+D
Sbjct:  132 IKLHIPELDLKQEVEALLANQEAVEILEQCVMNWQAQITIVLEEQQKKKPQAPGPLAEIDFWRERAAALSALSEQLKLPVVKKILEVMTRAEPATVQNLDLTVTELNNYLVEAVNNVDFLSTLERHFKNLATGVSFIVILETIPQMMNGLQLVWIISSHYNTDERMVPLMERIAWELSERVARVVNIRLLFKERREVAKAKVLDGKKVLDQWKSCYFEVRARIETSGTDPRWEFDRKKLFEKTDYMASICQDLYNVLQVTLDEFYNVFGSEMRAVTRDSRRIDDVVRWVDSLVVPIEELNFDPFDIRKTG-SWKMVMKDFRSKV--------EVINSMFVEQR---------------------------------------------------ENPPVSKIYPPVAGAVYWERLLFHRIKDPIIRFQELPEMLDNEQGKSVTEKYLEVGRRMRDYEVKKVEGWRKETERMLPELMNRTLLL---------------TVDSSGDRGIRLVVNFAPELKEIISETIYLDRLGYAVPELARNVALQEHRFLRCVDELKNLVKRCHSLMDSLNDAEFLLLTPQVQELRRVLRAGWRRLNWNSLGIAEFIGRSEQAVTKFESLVSQIKKNARDVDAKLQDIETANLFKFPAPDKAGDLPGVKEFFELVEKQRVKDVILLSLMYTAIGPLLTKTES-LIMQTSTGRAESMTQYYAYWERKVYDALTKMVLKNLQVFNTALMGS---TPLFKIETILSAPEIVLHPKSNDVYKLMMQSVRDCLECTKRFVRWMNGTCIECPPQRVDGEDEPFVFSFYSEIYPQPQVNECAVAVSQSAQQLLGSLGRYLGRWKRYHPLWNLDKSIMMEKFAAKKPACVTYDEKLKFYSNIGQEVAQQPLVKDVHVVRLDLEPLAHTVQENVQAWVSSLGRLLNDSAREDLYALRSELQQLSENLKKSPDTLEDLKFVLSTISNIRDMSVDVELRFRDIQERYRTLTMYNIQVPEEELQLAANIRNMWSDLFSESRQVDRSLGRAKKTFTEITKEQIVQYKQEVAIFAESFNMHGPGAVGDNLDKGR--LRYCSEELAKIEAGRQDLVGAEKLFDLPITTYPELLNVQREMRALRQIYEVY---KAAKTEWSQTLWVNLNIQLLQEGTEGFIKSLRKLPKDVRAMPVAFFLEGRMKEFKESLPLLLDLKNEALRDR-------------------YLFLHCYRLYLLKDWSLIGS-----------PQGVKEVVDTWEVMKFSVQRYFKGTQERGYILGSVDEIQQNLDDNAVNLQSMAGSRFIGPFLNVIQQWEKNLSLISEVIEVWMLVQRKWMYLESIFIGGDIRSQLPEEAKKFDHIDKMFKKIMSDTVRDPGIKRCCLVPNRLSDLQNLSDGLERCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSEPACVQEHMIKMYDNIASLRFDSGTNGETVAGALVSAEGEVMELKQPVPAEGRVEDWMTAVLLEMRRTNRLITKEAIFYYCQKKSRVDWMLDYQGMVVLAGNQVWWTWEVEDVFQKMSSGEKQAMKQYAKKMHQQIDNLVRRITQPLKKNDRRKLNTVLIIDVHARDIVDSFVRDSITDAGEFEWESQLRFYWDKKPDDLFVRQCSAEFSYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTESTKDLAKALGLLCVVTNCGEGMDYMAVGKIFSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALILQLKRFQFEGQEISLDSRMGIFITMNPGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLLAKVLAKKMTVLYKLAREQLSKQSHYDFGLRALKSVLVMAGELKRGSPDLNEDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRVRYPNFNDAVETILEENKYSLLPNQVDKVVQMYETMMTRHTTMVVGPTGGGKSVVINTLCQAQTRLGLLTKMYALNPKAMSVIELYGILDPVTRDWTDGILSNIFRDINRPTDKKERRYILFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVFVDPKNLRYAPYWQKWVNSRPPKEQAD-LRKLFEKYVPSIIEMVVEGITDGKQGEKLKTIVPQTDLNMVVQLSMMLDALLEPEDLSSEELECFFIEALYCSLGAALLETGRKKFDDLVKKLSCLVSVQDEKTLAGPGEIPGYLPTLFDFHFDGTTKK--WMPWSSLVAKYIHNPDTKFIDILVPTVDTTRVNWLLEQMVKVKRPVVLVGESGTSKTATTQNFLNNLNPDFTMVLTINFSSRTTSMDLQRSLEASVEKRTKETYGPPMGKSLLVFMDDLNMPRVDEYGTQQPIALLKLLLDRGGMYDRGKELNCKQLKDLGFIAAMGKAGGGRNEVDSRFISLFSVFNIPFPEEEALHLIYSSILKGHTRPFEECIRNMCDKLTFCTLELYKTIIKDLPPTPSKFHYIFNLRDLSRVYNGLTLTNAERFLTEAQFVRVWRNECLRVFYDRLINETDKALVQGHIKSLIQEHFGSELDSAMRDPILFGDYRTALSESEPRVYEDIQDYDACKALFQEILEEYNENKTRMNLVLFDDALDHLTRVHRIIRMDRGHALLVGVGGSGKQSLTKLAAFTAGCDVFEIVLSRGYSESNFREDLKTLYVKLGIENKRTVFLFTDAHVAEEGFLELINNMLTSGMVPALFPDDEKESVLNQIRDEAVKMGSGHSKESVWQYFINKSASNLHIVLGMSPVGDVLRTRCRNFPGLVNNTGIDWFLPWPPQALHAVAQSFLG-ESPMIPAAHSETVIGHVCMVHGSVGEFSTLFQQKLRRSNYVTPKNYLDFISTYSTLLQDKDQFILAQCKRLEGGLDKLEEASVQLADLNKKLAEQKVVLAEKSSACESLLQEISTNTAIAEEKKKLAEEKAKEIEEQNKVILVEKKDAESSLAEALPALEAARIALQDLDKSDVTEIRSFAKPPKQVQVVCECILVMRGHKEINWKTAKGMMSEANFLRSLMEMDCDSISGGQVKTVRGFLKNLNTSSEEMQAISKAGSGMLKFVEAVMGYCDVAREIKPKREKVARLEKNFFQSKRELEKIQSELEAIQKELGALGEKYSAAMGEKQLLQEEAQLMERRLIAADKLISGLGSENQRWTEDLEELKKKRVRLLGDCLISAAFLSYEGAFNWDFRNEMVYEVWQKDVLERGIPLSQPFRIESLLTDEVEISRWGSESLPPDELSVQNGILTTRASRFPMCIDPQQQALNWIKKKEEKNNLKISSFNDPDFLKQLEMAIKYGFPFLFQDVDEYIDPVIDNVLEKNVKGAEGRQVIVLGDKEVDYDPNFKLYLNTKLANPKYSPAVFGKAMVINYTVTLKGLEDQLLSVIVGFERKELEEQRERLIQETSQNKRLLKDLEDSLLRELATSTGNMLDNVELVHTLEETKSKAGEVFEKLKLAETTSADIDKLRDGYRPAAKRGAILFFVLAEMALVNSMYQYSLASFLEVFDYSLRKSLPNSILPKRLSNIMNTLTLNVYNYGCTGLFERHKLLFSFNMTIKIEQAEGRAPQEELEFFLKGNLSLEKSKRKKPCDWLPDQGWEDIVRLNELFPNEFGALIEDIEKNPKEWKNWFDLDSPEQAPFPMKYRDSLTVFQKLLLLRCFRVDRVYRAVSDYVTATMGEKYVQPPVISFEAIFEQSTPNSPIVFILSPGCEPANDLMKLAERSGFGTNRLKFLAMGQGQEKVALQLLETAVSRGQWLMLQNCHLLVKWLKDLEKALERITKPHPDFRLWLTTDPIRDFPIGILQKSLKVVTEPPNGLKLNMRATYFKIQLETLMSCPHPAYRSLVYVLAFFHAVVQERRKYGKIGWNVPYDFNESDFLVCMEILNTYLTKAHNQGEGSIPWGSLKYLIGEVMYGGRAIDSFDRRILTVYMDEYLGDFIFDTFQPFHFFHNKDVDYRIPPDGSKEVYVEEIESLPLANTPEVFGLHPNAEIGYYTQAARDMWTHLIELQPQTGDSGGGISRDEYIAQVARDIQNKLPSAFDLDVIRKKLGPDVSPTSVVLLQELERFNRLVLRMSRSLSELQRALAGEVGMSSELDEVARALFNGQIPAIWRKLAPDTLKSLGNWMIHFRRRHQQYSSWVEVGEPAVMWLSGLHIPESYLTALVQATCRRNGWPLDRSTLYTHVTHYRSEDEVTEKPGQGCYVSGLYLEGADWDVEQGCLVRSKPKELVVQLPILKVIPIEAHRLRLQNTLRTPVYTTSMRRNAMGVGLVFEADLFTTEHHSHWVLQGVCLYLNSD 4340          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Cavefish
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-130530-910])

HSP 1 Score: 2269.58 bits (5880), Expect = 0.000e+0
Identity = 1299/3546 (36.63%), Postives = 2047/3546 (57.73%), Query Frame = 1
Query: 3457 LRKYQDKWKKHKRVFIPNKQAQIDKWLTKDPTVMDF------YERIRDTIDRKEELLNQPVIRKIGFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDLSLIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSNHPID---QEEIEESDKLRQLFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVK-----AMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSS-DCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEA-VFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKK-GQKTALKDYAK----LLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKI----LCASQTKLQLHTKLI---PMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTRE-GMNQD-------TIEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYVHNPEKK-FSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSENAKSDKDYAMTDP----ILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEY--SEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIE--IVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEV-AKRKKPYL-WLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLT--KPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNH-TAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQ---TGKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGEPNVM-WLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMG-VGLVVEADLATTE-HPSHWVLQGVCLILNTD 13926
            L+ Y   W KH+ ++  NK + I ++   +P V  F      Y  + + + ++E +L+      + F+ ++   L   +  H   W+  +   L   A T L  + + ++ +   LS  P  L EL   L  ++T+Q    + ES+I  + E++ +L      ++   Q+ +E  +   Q F  +  +S   +  L   K KF         +F K ++     F   GP       +  L  +     +L  ++     +     +F        ++ N++K++  L Q++E+        + W    + +L  + ++   +   K   K+ RE+K      +  ++N   ++++FK  +P+  DL+  A+R+RHW ++  +  ++FD N   FTL  + A+ L +  + I EI  +A KELSIE+ +  + +TW      + PY   G E         EV Q L+DN + L +M ASRF+  F   V  WE+ LSL+ EV+++ + VQR+WMYLE IF+G DIR QLP E+ +FD I+ ++K IM    K     +    P  L  L+ ++  LE+ QKSL+ YL++KR  FPRF+F+S+D+LL ILG S + + VQ H+ K FDNI SLR  K  + +  A  M S++ E +EF  PVL+EG VE W+  +E  MR T +   +       + +  R +W+ D+ G + +  +QI WT +V       K+   K+ALK   K    +LH   D I    R  LSK  R K+  ++ ++VHARD++D   +    D   F+W  QLR YW ++ D+  I+Q    F YGYEY+G +GRLVITPLTDR Y+TLT AL ++ GG+P GPAGTGKTET KDL K LG+  +V NC +G+DY+S+G++++GL Q GAWGCFDEFNRI + VLSV++ Q+ +I + L   L+ F FEG++I L S  GIFITMNPGYAGRTELP+++K+ FRP+ ++VPD   I EI LF +GF + KVLAKK+ TLY L+ +QLSKQ+HYDFGLRAL S+L  AG+ RR  PD++++++L+ +++DMN+ K    D PLF G+IQDLFP ++ P + Y    +++EE L +    V      K++QLYET  +RH++M+VG TG  KSV  +I    L A   K +    L+   P+NPK  S+ ELYG  D +T +WTDG+LS++ R I    +K + ++++FDG VD LW+E+MNSVMDDNK+LTL NGERI +    +LLFEV DL  ASPATVSRCGMVY D  +LG+ P+ Q W++K++ K E D L  L+ +YI  TI                K ++P+T LN V  LC + D   + E G+N          +E  FI S+ WS+   + ED + K D F++ +               G  P++  T+++YY D+  + + W  + + +P+    P    F +I+VPT+DTVR  +L+   +  Q PVLL G  GT KT+V+Q+ L+  DP K+  L IN SS+TTS ++Q  +ES VEKRTK +Y P  GK++L F+DD+NMP VD +G+Q P+ +L+L ++    YDR   +      D+  LA+MG PGGGR  +  R  S F++ N TFP++S +  I+ ++++   Q F +E+K    I+T+ T+ +Y  I  +  PTP+K HY+FNLRD+S+++QG+ ++  D         R+W HE  RV  DRL++  D       + E+L   +  D  Y    P     +FGD+     + E  +YED+++++A KG  +  +E+Y  +  V PM LVLF DA++H+TR+ R I    G+ LLVG+GGSG+QSL++LAAY     +F++ +++ Y +++ RE++K LY   G++NK TVF+F D  +++E FLE INN+LSSG VP L+  DE E + S + + A    +  + ++++ Y + +  +NLHIVLCMSPVGE  R R R +P +VN TT+DWF  WP+ AL  VA  ++  +  ++ + ++I+  + + FV +H SV ++S+    + +R NYVTP NYL+ ++ Y KLL +K      Q  +L+ GL K+ +   ++  ++ +L   K  V E    CE  L  I  + + A E++      S+ +  +  + +     A+  L EALP LE+A  AL+ L K D+ EI+S+ +PP  V+ V + + + +   E  W  AK  + + +F++ L   D DNI+ +    +     +     + +  VS A   L  +V A+  Y  + R ++PKR ++        + +  L + +N+  ++E +LK L  +Y+  +++++ L+++++ M+ +L+ A KL++GL+ E  RW   ++ L+     L+GDCL+ +AFLSY+G F   +R+E++ + W     + ++P S  F     L+    +  WN +GLP D  S +NG++ TR +R+PL +DPQ QAL WI   E    LK      PDFL+ LE A+++G P L ++V E +DP +  +L K+     GR  + LGDKEV+++P+F+ Y+ TKLSNP Y P I  K+ ++N+ V  +GLE QLL ++V+ ER ELEEQ++ L+   +  KR L++LED +LR L  +TG++LD+ +L+NTL+ +K  A+EVS++L+   +T  +ID  R+ YR  A+R +ILFFVL +M  I+ MYQ+SL AY+D+F  S++KS     L++R+ N+    T  VY Y C G+FE+HKLLF+F +  K+    G L  DE  FF++G   ++   +   P   WL+D +W ++T+L ++    F  L+   E+    W QW     PE A LP ++       QK+ ++R  R DR+   +  ++I  +G  +V PP+L+ + + + ST  +P++F+LSPG DP   +V+LAE SG G +    +S+GQGQ   A  ++   +  GHW+ L NCHL + W+ +L+K +E+L     HPDFRLWL++ P   FPI ILQ  +K+ TEPP G+K N++  Y+ +  S  +  +    +  L+F+L FFH+++ ER+K+ ++GWNI Y FN+SDF V   ++  YL +  +     IPW +LKYLI  V YGG   DD+DRR+L TY+++YF +   +T  PF F  S   TY IP+  + D   +YI  LP    PEVFG H NA+I    S  + ++  L+ +QPQ   T  +G+  SR++ + E ++ ++ K+P+L D +  +K    D SP  VVLLQE++R+N L+  +  SL  L + + G V MS+ L+++ + +++ ++P +W++  P +LK LA+W      R  Q++ W E   P V+ WLSG   P  +LTA++Q++ R++   +D  + +  +        +      G F+ GLYLEGAGWD+   CLV  +P QL+  +P I   P+E  +   +N +  P Y    R    G    VV  DL +      HW+ +G  L+++ D
Sbjct:  943 LQAYLKTWDKHREIWEINKDSFIRRYQHLNPPVSSFDSDIARYSEVANNVQKEETVLS------VQFVLLDCSPLKFSLVQHCNEWQGKFTQLLSLMASTRLKELHSFLQDNAHRLSQPPQTLVELVEGLKLLETLQGDLNKIESQIPPIHEQFAILEKYEVSVEREVQDLLEALNGEWQGFQQVVIDS---DIMLKKHKDKFKSGLFFSAEEFKKKMQTTMQDFNSTGPFGSNVSSEAALEQISVLRAQLESLKEEEGTIRHGLSIFKTEQPTSKDMQNLEKDIDYLLQVWEISQQWDTHWDEWKAGQFASLQTENMESTAQTMYKNLNKLSRELKDKQWEIVEFSKN---RIEQFKRTIPMILDLRDPAMRDRHWNQIKQEMQRSFDHNSAEFTLEKIVALGLEQHAERICEISGAARKELSIEQSLEGIAKTWEETSLDIAPYKDKGTE---------EVFQALEDNQVTLSTMKASRFVRAFEKEVDRWERCLSLVLEVIEMILTVQRQWMYLEIIFLGEDIRKQLPHESTEFDDINSSWKTIMDRLNKDNNALRGTHHPGLLEKLSEMNSKLEEIQKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSRNPDAVQPHLKKCFDNIKSLRINKVRNNKSEAAGMFSADGEFVEFTHPVLLEGPVEAWLCDVERTMRWTLKDTLRNCRTALKKMTGKRDKWVKDWPGQMLITASQIQWTTDVTKCLITGKESADKSALKSMKKKQVSMLHRYSDAI----RGNLSKILRLKIVALVTVEVHARDVIDKLAKAGCCDVNAFDWLCQLRLYWEKDVDDCIIRQTNTHFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKGLGMYVIVVNCSDGLDYKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGLTNFIFEGRDICLVSSCGIFITMNPGYAGRTELPDNLKSMFRPISMVVPDSTLIAEITLFGEGFNNCKVLAKKVFTLYCLAVQQLSKQDHYDFGLRALTSLLRYAGKKRRVRPDIADEEILLMSMKDMNIAKLTSTDLPLFNGIIQDLFPAVETPTIDYGKLKETIEEELHQSGLQVTPFTVTKVIQLYETKNSRHSSMIVGKTGSSKSVTWQILQKALSAMHRKGEPGFNLVHEYPLNPKAVSLGELYGEYDLSTNEWTDGVLSSLMR-IACADEKPDEKWIVFDGPVDTLWIESMNSVMDDNKVLTLINGERIAMPEQVSLLFEVEDLAVASPATVSRCGMVYNDYSDLGWKPYVQSWIDKRQ-KMEVDHLKRLFDRYIKKTISF---------KRTHCKELVPITELNGVISLCRLYDSLASPENGVNPADNENYGRMVELWFIFSLIWSICASVDEDGRKKIDNFLREM--------------EGTFPNK-DTIYEYYVDT--KNKTWASFEDKLPKGWRYPSNAPFYKIMVPTVDTVRYHFLVNSLVCGQYPVLLTGPVGTGKTSVAQSVLQGLDPAKWTMLTINMSSQTTSNNVQAIIESRVEKRTKGTYVPVGGKKMLAFLDDLNMPAVDDFGSQPPLELLRLWIDYGFWYDRQMKM------DMFLLASMGPPGGGRTHISGRLQSRFNLINMTFPAESQIKHIFGTMINQKLQEFQEEVKPIGSILTQATLELYYAISARFLPTPAKIHYLFNLRDISKVFQGLLRSHRDFHDTKQSITRLWIHECFRVFSDRLVDQADTEAFVALLAEKL--GSLFDLTYHNICPNKQQPIFGDF-----LKEPHVYEDLLDFKALKGFMESQLEDYNLTPGVVPMSLVLFRDAIEHVTRVVRVISQPRGNMLLVGIGGSGRQSLSRLAAYICEYMVFQVEVTKQYRKQEFREDIKKLYRLTGVDNKPTVFLFNDTQIIDESFLEDINNILSSGEVPNLYKSDEFEEVQSALSDSARKENVLETADAMFNYLIERVRNNLHIVLCMSPVGEPFRNRIRQYPALVNCTTLDWFSEWPQDALLEVAERYL--DGLILGNVEKIQTKVARIFVTMHQSVAQFSQRMKLELKRHNYVTPTNYLELVSGYKKLLAEKRAELGEQVSKLRNGLFKIDDTRSKVEAMSVELEDAKKKVAEIQKQCEEYLVVIVQQKREADEQQMAVSAHSEKIGAEEIKCKAMAENAQRDLDEALPALEEAMKALESLNKKDMTEIKSYGRPPALVETVMQAVMILRGC-EPTWAEAKRQLGESNFIKQLVHFDKDNISDRVLKKIGQYCTQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIYRVVEPKRARLHGAMTQLAEKQAALAEAENKRREVEEKLKQLKNQYDEKLNQKEDLRKKSEDMELKLDRAGKLVSGLAGERVRWEQTVESLEKDMGYLVGDCLLAAAFLSYMGPFLSNYREELLTNIWMKQFRDLEVPCSPGFNFATFLSKPTAVRDWNIQGLPSDAFSTENGVIVTRGNRWPLMVDPQGQALKWIKNMESKRGLKVIDLQMPDFLRILENAVQFGSPVLLQNVQEELDPSLAPILNKSFTHIGGRVLLKLGDKEVEYNPDFQFYITTKLSNPHYTPEISTKTTIVNFAVKEQGLEAQLLGIVVRRERPELEEQKDSLVINIASGKRKLQELEDEILRLLNEATGSLLDDVQLVNTLQTSKITATEVSDQLETSEQTEIKIDTAREAYRPCAQRASILFFVLNDMGRIDPMYQFSLDAYIDLFNLSIEKSQRSHKLEERIINLNDYHTYAVYRYTCRGLFERHKLLFSFHMCAKILEVAGKLNMDEYSFFLRGGLVLDKEGQMDNPCTSWLADSNWDNITELDKL--ANFHGLMSSFEKYPKDWHQWYTSSEPENAPLPGEWETVCNELQKMLIVRSLRQDRVSFCVNSFIINNLGSRFVEPPVLDMKAVMEDSTTKTPLIFVLSPGVDPTGALVQLAEASGMGPS-FHALSLGQGQAPIATRMIKEGVKNGHWVFLANCHLSLSWMPQLDKLVEQLQVEDSHPDFRLWLSSSPHPEFPIAILQAGIKMTTEPPKGVKSNMKRLYQLVTESQFSRCSRPVVYRKLLFSLCFFHSILLERKKFLQLGWNIVYSFNDSDFEVSENLMSLYLDEYEE-----IPWDALKYLIAGVNYGGHVTDDWDRRLLTTYINDYFCEGAVNT--PF-FKLSSLPTYYIPRDGSQDTYREYIRQLPPVEHPEVFGQHPNADIASQISETRTLFDTLLSLQPQVTSTTATGAGPSREDKVLEISADVRQKVPELVDYESTQKLLQDDPSPLNVVLLQEIQRYNALLHTIRTSLTELEKGIKGLVVMSSSLEEMFQCIHDARVPPLWEKAYP-SLKPLASWTRDLCQRVEQFAHWAETAHPPVLFWLSGFTFPTGFLTAVLQSSARQHNVSVDTLS-WEFIVSTVDDNNLLFPPKDGVFIRGLYLEGAGWDKKNSCLVEAEPMQLVCPMPTIHFRPVENRKKVAKNMYSCPCYYFPVRSGGAGRPSFVVGVDLKSGAVSYEHWIKRGTALLMSLD 4406          

HSP 2 Score: 76.6406 bits (187), Expect = 9.818e-13
Identity = 75/367 (20.44%), Postives = 153/367 (41.69%), Query Frame = 1
Query: 1900 WSNFMEDFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEVESIDQLFKTNMNNPPLYHFKSCVAGGISWERHLFYNIKRPILRFLTMDE--MMQSDNGKRIRTKYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILALANSENFVSENVPEETIDKMDDDLRVDFGFEINEIITETRNLELLGYKVPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISD-YIEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFKLQSGNKFLKCKEFFEFMESERTSDFEHLGRKYSTI 2991
            W +    FR +V  +E    + IN  F T+ S E    +L  FQH+ +R+AI + +++K  D+ +   KEV  +++                       W R +   I+  +   +  +   + Q +N K++R   + + + +     + ++EW   +D+   + L + ++     +  +               L ++F   + ++  E    E L +++P        + E    + E +L +V  Y+ +I +L + EV +  + I+ + + ++PGL +L W+S G S+ +I +C L     +  V       + I +   EI    L +L  G    +  EF E  ++ R S    +   Y  I
Sbjct:  457 WHDSYNRFRAEVKDLEVMMQNLINTAFKTVNSVEEGVQLLDVFQHLSAREAIKRTLSRKTVDVYAMLSKEVYLVNKELSQ-----------------AHWARAMQRRIQGQMQVCVLENAHFLPQIENDKKVREACMQLLQKLDELVRRMYSEWSQSLDRGSLKNLNQPLMIRCKEKAGM---------------LDINFDKNLLKMFNEMYYWERLQFEIPHHVSEAYQRREDLRTMRENVLLVVRDYNRIISALSADEVGLFRERIRFLDKKLQPGLSKLLWSSHGASNFFISECRLHASKVQLIVDEYKAANLAISKHCGEISELLLVRL-DGRTVYRDLEFEEDQQAHRLSQLLRIKTSYQHI 790          

HSP 3 Score: 63.1586 bits (152), Expect = 9.323e-9
Identity = 56/217 (25.81%), Postives = 105/217 (48.39%), Query Frame = 1
Query:  871 VHETRAAVQA------RDEFLISLKKFTSIVDQTIIQIASEVKLEIPDLDLFENDKENLSDKEIMEMIESTVLKWDQQITGTLESLQKIVPHGPS--PLAEIDFWRERNAXXXXXXXXXXXPKVKRILNLYSLAEG---PVFDTQNNELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIA 1488
            +H ++ A+        ++ +   + +F + +  T  ++  +  L IP   L  + +    DKE+++ +E  ++ W +QI   L + Q+ V  G S  PL EIDFW+ R + LS + +QL+ P V  I  +  LA+    P F     ++     +A+ N  FLSL+    + +A  +    V   +  ++   R+IW+ S +YN  ER+  L  ++ 
Sbjct:  182 IHASQVALSTAWPESIKNNYSTHMNRFLTNLTDTRYKLVGKTVLYIPVEALQHSPEVAARDKELVKRMEVVMIHWTRQIKEVLNA-QETVEIGDSSGPLEEIDFWKSRCSDLSGISQQLQKPGVLHIQAILQLAKSSYVPPFCRLAKQIQDGTQQAQSNLSFLSLLREPCEELAL-LKPREVEPKLAHIINVSRVIWVNSVYYNTRERLTTLFRKVC 396          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Cavefish
Match: ENSAMXT00000016172.2 (pep primary_assembly:Astyanax_mexicanus-2.0:4:1379218:1548247:-1 gene:ENSAMXG00000015711.2 transcript:ENSAMXT00000016172.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 2182.53 bits (5654), Expect = 0.000e+0
Identity = 1355/3899 (34.75%), Postives = 2167/3899 (55.58%), Query Frame = 1
Query: 2440 NVPEETIDKMDDDLRVDFGFEINEIITETRNLELLGYK-VPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISDYIEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFKLQSGNKFLKCKEFFEFMESERTSDFEHLGRKYSTIGPLITKLQGEIIGDRDVNPF-EKFQPFYEFWEKRIFDRVYNMVLKNLQDYQNMLRDENFPTCLFEVDLMLAGTDVIGNPQ-----TTEIYKLAIQDLRDAVEATRVFIRWKRNSCIETTGMKIDGQDELFYFTFYLDIGNSVEITYFCEQIANYYRNIIGKLRK-YQDKWKKHKRVFI--------PNKQAQIDKWLTKDPTVMDFYERIRDTIDRKEELLNQ-----PVIRKIGFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDLSLIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSNHPIDQEEIEESDKLRQLFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNF-------ADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGG-DIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGS-SDCECVQEHMIKMFDNISSLRFTKGTSLEMSATA--MISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTREGMNQDT----IEAIFIQSIYWSLGGCLIEDSQVKFD-QFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHC--QMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSENAKSDKDYAMTDPILFGDYRN-ALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVF-----KNYKEINWKVAKGMMAD-PSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMS-----DPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVL-EKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKRKKPYLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKF--ISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLTK-PHPDFRLWLTTEPTEA-----FPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNH---------TAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYI-ESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTGKS--GSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVEN-GEPNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMGVGLVVEADLATTEHPSHWVLQGVCLIL 13917
            N P  + D     + V+F  ++  ++ E + L+    + +P+L  ++    E   + V  L  MVG Y+ VI ++  +E  ++ D+++ +   ++     +NW S GI +YI+    A+H  E ++        +I+  +K   N    +    N  L   E       +R    E    ++ T G  I  L    +     +P  ++++ + E+ ++ + D  +N +  +L+ + +    +     LFE  L L   D++ +P      +   Y L    + D    + +  R   +S        ++   +L      L       +   CE     +RN   +    Y D  K+  R F+           +A  D+ + +DP  +   ER R+ +D  E +  +     PV    G++ V+ +   S + +  K+W  ++   L +    +L+ ++  I+     L  I  +  +   L+  +    L++++     TD  E +  L  +   +   E E  D + +  + L  +  N+  +   VK     +   E+++  +    F        + F++ GP     D+     +L   H ++  +E    +L  +  LF + I  Y +L   +KE+  L +++++    +   E W  T W+ ++++ ++   + F KE R + +E +A      L   +K    +L   ++L++ A+R RHW++LMT TG  F ++ +  TL+ +  + L+ F+D +  IV  A KE+ +EK + E++ TW  ++F  + + +       +L + +++++ L+DN + LQ++ +S+ +  FL  V +W+K LS+   V+ +W  VQR W +LE IFIG  DIRSQLPE++K+F+ ID  FK++  +  K P + +A   P   S L ++   L  C+K+L +YLD+KR AFPRF+FIS  +LL IL + +D   VQ H+ K+FDN + ++F      + S T   M S E+E + F  P    G+VE W+ ++   MR T R    EAV  Y E K R QW+FDY   VAL   QIWWT +V   F ++++G + A+K+Y K   +Q++ ++  +   LS  DR K+ T+  IDVHARD+V   +   + +++ F W SQLR  W           C  QF Y YEY+G   RLVITPLTDR Y+TLTQ+L + + GAPAGPAGTGKTETTKDL +ALG++  V NC E MDY+S G I+ GL Q GAWGCFDEFNRI V VLSV++ Q+K+IQ+ +  K  RF+F G+EI L   VGIFITMNPGYAGRTELPE++KA FRP  ++VPD + ICEIML ++GF+ A++LA+K  TLY+L KE LSKQ+HYD+GLRA+KSVLV+AG L+R DP+  ED+VLMRALRD N+PK + +D P+F+GLI DLFP LD PR R  DF   V E + + K     +   K+VQL E +  RH+  VVG  G GKS V+K L  +   ++       +NPK  +  EL+GI++P TR+W DGL SNI RE+   +     ++++ DGD+D +W+E++N+VMDDNK+LTLA+ ERI L     L+FE+  L+ A+PATVSR G++Y++  +LG+NP    W++K+E + E   L  L+ KY+P  +D +           + K IIP+   ++V  LC++L+C LT E    D      E  F+ +  W+ GG L +D  V +  +F K               K  + PS+  T+FDYY D   E +++ PW+ +VP++  +PE      LV T +T+R+++ +   ++ +RP++LVG  GT K+ +    L + DPDKY    + F+  TTS  +Q  LE  +EK+   +YGPP  KRL+ FIDDMNMP+VD YGT QP  +++  ++    YDR K L  K++  + +++ M  P  G   ++PR    FSVF  +FP   +L +IY SIL  H   + FS  ++ + P + ++ +  + ++     PT  KFHYIFNLRDLS I+QGM     +         +V+ HE  RV  D+++ D D +   K ++ ++      D + A+ +  +   Y + AL + E R Y  + ++E+      E ++ Y+E  + M LVLF DA+ H+ RI+R +    G+ALLVGVGGSGKQSLT+LAA+  S ++F+I L +GY   DL+ +L  L  K G++N  TVF+  D  V +E FL L+N++L+SG +P L+PDDE E II+ VRNE    G+  S+E+ W++F+ +    L + LC SPVG  LR R R FP VVN T IDWF  WP++AL +V+  F+     + P + +  + K    VH+SV + SK+++   RR NY TPK++L+ I  Y  LL  K K    + +RL+ GLQKL   S Q+ +L  KLA Q+V + +K    + L++ +   T+  + +K +A E+ + V   +  + +++ + E  L +A P L  A+ AL+ L KN++ E++SF  P   V  V+  + V      +  K+ +WK AK MMA   +FL SL   + +NI       ++  L   +   + + + S A  GL  +V  ++ + +V  E++PKR+ + +        + +L  +K +I+ L   L  L  ++E A  ++ + Q+E +   R ++ A++L+ GL+SEN RW   +   K Q+  L GD L+ +AF+SY+G F+  +R E++ + WK  + + K+P+      DP  +   L +D +++ W +EGLP D +S +N  + T   R+PL +DPQ Q + WI  K   +NL+        +L  +E A+  G   L ++++E +DPV+  +L ++ IK  +GR ++ +GDKE +++P FRL L+TKL+NP Y P +  +  ++N+TVT  GLEDQLL+ +V  ER +LEE +  L ++ +  K  LK LED+LL  L++++GN L +TEL+  LE TK  A+E+ EK+K    T  +I++ R+ YR AA R ++L+F++ +++ I+ MYQ+SL A+  VF+ ++ K+ PD  L++R+ N++ ++T +V+ Y   G+FE  KL +T Q+  ++ +    +   ELDF ++      V     P  +LS  SW  +  L  M   +F  L  DIE     WK+++  E PE    P+++ NK  S QKLC++R  R DR+  AI  +V E++G +YV    ++F    ++S   +P+ FILSPG DP  DV K     G+      F  +S+GQGQE  A+  LD A   GHW+ILQN HL+ KWL  LEK LE+  +    +FR++++ EP+ +      P GIL+ S+K+  EPP G+  NL          +L+NFN            F S++F+L +FHAVV ERRK+G  GWN  Y FN  D  + + +L  YL     + +SK+P+  L+YL GE+MYGG   DD+DRR+ RTY++E+    + +       Y +    + +P     +   +YI ++LP E +P ++GLH NAEIG+ T  +++++  ++++QP+   S  GS  SRDE +         KLP+ F++  L  K   + SP +VV LQE ER NIL   + +SL  L   L GE+ M+ +++++  ++Y  Q+P  W + A  ++  LA W T   +R  +   W  +   P  +WL+G   P+S+LTA++Q+T R+N WPLDK +L   V +     + +    +G +VHGL++EGA WD     +V  + K+L  ++PVI +  +   + + +N +  PVY T QR    G   V   +L T E+PS W L GV L+L
Sbjct:  518 NQPLISRDPTTTLITVNFNPQLVSVLREVKYLKARESEDIPDLTADIYSNKELLWQYVANLDLMVGWYNKVIGTVLEVEFPLIQDQLRTIDLQLKEAEDTINWTSNGIWEYIQGVREAVHDLEKRLQKTKDNVDEIQSIMKTWANPVFERKDGKNDSLLNLE-------DRPERLEKTYGQFRTSGAKIHLLLKNNLSLFKADPSSDEWRSYVEYIDEMVIDGFFNSIDSSLKFFLDNTDQKPGLAPLFEAQLDLQVHDLVFHPSLEFGASDGFYDLVESLINDVYRISSLVPRLAEHSSFPHYQADMEDMADLADMRQLLMERVHRVMAQCCE-----HRNAFERYAYLYVDDRKEFMRQFLLYGHVLTTEEIEAHADEGVPEDPPTL---ERFREQVDSYERMYEEVQKLEPVHVFEGWMRVDARAFKSALLNIIKKWSLMFKQHLIDHVTNSLSELEEFIKCTEGGLG-IKVEEGDYAGLVKVMG--HLMAVKERQGATD--EMFEPLQHTIDLLKTYEQELPDVVYKQLEELPEKWINMKKQAVVVKQHVAPLQASEVANLRRKCATFDVEQFKFREHFRKNGPFRF--DIVNPYEMLDTTHKQIQEMESIMAKLIESAGLFEVNIPDYKQLKQCRKEVSILKELWDVVSVVRFNLEAWRTTPWREINVEEMELECKRFSKELRLLDKEARAWDAFCGLDSTVKNTLTSLRAIAELQNPAIRPRHWQQLMTATGVRFSMD-EDTTLTDLLNLNLHHFEDEVRAIVDRAVKEMGMEKVLTELDATWTAMEFGYESHPRTSVP---LLKSDEDLVETLEDNQVQLQNLMSSKHVAFFLEEVSSWQKRLSVADSVISIWFEVQRTWSHLESIFIGSEDIRSQLPEDSKRFEGIDTDFKELAYDAHKTPNVVEATNKPGLYSRLEDIQGRLALCEKALAEYLDTKRLAFPRFYFISSADLLDILSNGTDPHQVQRHLSKLFDNTAKMKFETDADGKPSKTGIGMFSKEEEYVPFNEPCDCTGQVEMWLNRVLDTMRATVRHEMTEAVVAY-EDKPREQWLFDYPAQVALTCTQIWWTSDVGLAFSRLEEGYENAMKEYYKKQVSQLNTLITMLIGQLSPGDRQKVMTICTIDVHARDVVAKIIAQKVENSQAFVWLSQLRHRWDEREKHCFANICDAQFLYSYEYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKSCGNIYKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKSIQDAIRDKKKRFNFMGEEINLFPSVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFIEARLLARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDPERPEDQVLMRALRDFNVPKIVTDDMPVFMGLIGDLFPALDVPRKRDLDFEKFVRESVLDLKLQAEDNFVLKVVQLEELLAVRHSVFVVGNAGTGKSQVLKSLNKTYQNMKRRPVWADLNPKAVTNDELFGIINPATREWKDGLFSNIMRELANVSHAGP-KWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLNPTMRLVFEISHLRTATPATVSRAGILYINQADLGWNPPVSSWIDKREIQSEKANLTILFDKYLPACLDTL---------RSRFKKIIPIPEQSMVQMLCHLLECLLTPEHTPPDCHKELYELYFVFAAIWAFGGALFQDQLVDYRVEFSKWWVT---------EFKTIKFPSQ-GTVFDYYIDP--ETKKFEPWSKMVPRFEMDPEIPLQACLVHTTETIRVSYFMERLLERRRPIMLVGNAGTGKSVLVGGKLGSLDPDKYTIKNVPFNYYTTSAMLQAVLEKPLEKKAGRNYGPPGSKRLIYFIDDMNMPEVDAYGTVQPHTLIRQHMDYNHWYDRSK-LQLKEIHSVQYVSCMN-PTSGSFTINPRLQRHFSVFALSFPGVDALNTIYCSILGQHLSREGFSAVVQKSGPQLVQLALDFHQRVTATFLPTAIKFHYIFNLRDLSNIFQGMLFCKSECMKTPQDLVKVYLHESNRVYRDKMVEDKDFSTFDK-LQSEMVGKFYEDMEEALEEAKVMNMYCHFALGIGEPR-YMPVQSWESLNKTLLEALDSYNEVNAAMNLVLFGDAMSHICRINRILESPRGNALLVGVGGSGKQSLTRLAAFISSLEVFQITLKKGYGITDLKSDLGALCIKAGVKNIGTVFLMTDAQVADEKFLVLVNDLLASGEIPDLYPDDEVENIINSVRNEVRGQGLLDSRENCWKFFIERVRRQLKVALCFSPVGSKLRVRSRKFPAVVNCTVIDWFHEWPQEALESVSLRFLQEVEHIEP-EVKDSVSKFMAYVHVSVNKTSKDYLANERRYNYTTPKSFLEQIKLYRNLLALKRKDLTMKMERLENGLQKLNSTSAQVDDLKAKLAAQEVDLKQKNEDADRLIQVVGVETEKVSREKAVADEEEEKVASIAVVVTRKQKDCEEDLAKAEPALIAAQEALNTLNKNNLTELKSFGSPVAAVTNVTAAVMVLMAPGGRVPKDRSWKAAKVMMAKVDAFLDSLMNFNKENIHENCLKAIQPYLQDPEFKPELVAAKSNAAAGLCSWVINIVKFYEVYCEVEPKRQALNKANAELASAQEKLSVIKAKINHLNENLAKLTAKFEKATADKLKCQQEAETTARTISLANRLVGGLASENVRWAEAVNNFKQQERTLCGDVLLITAFVSYLGYFTKRYRHELMDNTWKPYLSQLKVPIPVTPGLDPLSM---LMDDADVAAWQNEGLPADRMSTENATILTSCERWPLMVDPQLQGIKWIKNK-YGDNLQVIRIGQRGYLDSIERALSAGEVVLIENLEEAVDPVLGPLLGQETIK--KGR-YIKIGDKECEYNPRFRLILHTKLANPHYQPELQAQCTLMNFTVTRDGLEDQLLAAVVSMERPDLEELKSNLTKQQNGFKITLKTLEDNLLSRLSSASGNFLGDTELVENLEITKRTAAEIEEKVKEAKVTEAKINEAREHYRPAAARASLLYFIMNDLNKIHPMYQFSLKAFSVVFQKAVLKAAPDEALKQRVLNLIDSITSSVFQYTTRGLFECDKLTYTAQLAFQILLMNKEINPSELDFLLRYPVQPGVT---SPVDFLSHHSWGGIKALCSM--DEFRNLDRDIESSAKRWKKFVECECPEKEKFPQEWKNK-TSLQKLCMMRALRPDRMNYAIRDFVEEKLGSKYVMGRSVDFAVSFEESGAATPMFFILSPGVDPLKDVEKHGRTMGYTFDNQNFHNVSLGQGQEVVAEQALDLAAREGHWVILQNIHLVAKWLGTLEKKLEQHGEGSSQNFRVFISAEPSSSPEGHIIPQGILENSIKITNEPPLGMHANLH--------KALDNFNQDTLEMCARENEFKSILFSLCYFHAVVAERRKFGPQGWNRSYPFNTGDLTISVNVLYNYL-----EANSKVPYDDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFIKPEMMEG----ELYLA--PGFPLPGNMDYNGYHQYIDDALPAE-SPYLYGLHPNAEIGFLTQTSEKLFRTVLEMQPRDAGSGEGSGTSRDEKVKAVLEETLEKLPEEFNMVELMGKVE-ERSPYVVVALQECERMNILTQEIKRSLKELNLGLKGELTMTNDMENLQNAIYLDQVPDSWTKRAYPSMCGLALWFTDLLNRIRELESWSSDFNLPPAVWLAGFFNPQSFLTAIMQSTARRNEWPLDKMSLQCDVLK-KNREDFSSPPREGAYVHGLFMEGARWDTQAGVIVDARLKELTPAIPVIFIKAVPVDKQETRNVYQCPVYKTRQR----GPTYVWTFNLKTKENPSKWTLAGVALLL 4323          

HSP 2 Score: 72.4034 bits (176), Expect = 1.776e-11
Identity = 49/159 (30.82%), Postives = 81/159 (50.94%), Query Frame = 1
Query: 1021 ENLSDKEIMEMIESTVLKWDQQITGTLE---SLQKIVPHGPSPLAEIDFWRERNAXXXXXXXXXXXPKVKRILNLYSLAEG---PVFDTQNNELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLME 1479
            E+L DK I+  IES V+ W  QI G L+   S   +    P+P  E++FW+ R A L  + +Q K PKV ++  L  + E    P +     ++ +   EA D   FL  ++R  + +     F  V + I P+M  + ++W  S+HYN   R++ L++
Sbjct:  178 EHLVDKSIIHSIESMVIDWSHQIHGVLKRDSSEPLLEGTNPTPQVELNFWKNRYADLQCINDQFKSPKVTKMAQLLDVIESSYYPAYRNMVQDVERALEEATDINLFLKPLQRLTEDLE-STEFSNVKERIAPLMHTVCLVWANSKHYNTPARVIVLLQ 335          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Cavefish
Match: dnah5 (dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:ZDB-GENE-110411-177])

HSP 1 Score: 2053.87 bits (5320), Expect = 0.000e+0
Identity = 1234/3549 (34.77%), Postives = 1953/3549 (55.03%), Query Frame = 1
Query: 3439 RNIIGKLRKYQDKWKKHKRVFIPNKQAQIDKWLTKDPTVMDFYERIRDTIDRKEELLNQPVIRKIGFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDLSLIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSNHPIDQEEIEESDKLRQLFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYIL---GALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDL-TNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILG-SSDCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRV-ITKEAVFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALK---DYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHF-EGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLD--CQLTREGMNQDTIEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYVH----NPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGH-CQM--FSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDD----KTFVQKAIEEQLSEN----AKSDKDYAMTD-----PILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEAV--SPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQV--RNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVF-------------KNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEV-AKRKKPYLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLTKPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSK--IPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTGKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGL--DISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGEPNVMWLSGLHIPESYLTALVQATCRKN-GWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMGVGLVVEADLATTEHPSHWVLQGVCLILN 13920
            +N + +  +Y   W+K       ++++ I ++   +P + +F  +I    D + E+  +P    +G +++    L   +    K W   + +      +T +  +   ++     L+    DL++++  ++ ++ I+   +  + ++  ++E Y +L      + +EE+E+ D LR  ++ L   S  V   L  ++  F       +  F +D  +F  ++ ++GP  +G         L  F +    +  +       E+LF LP+T +P+L  ++K++  L ++Y LY+   +    + + LW ++ I+ ++  +  F    RK+PR +K      +L + + +F +  PL   + + A+  RHWK +   TG  F++  DTF L ++    L ++++ I +I  SA KE  IE+ +++V   W    F+   +    K RG +L    +  E++  ++D+ M L S+ ++R+  PF   +Q W +NLS  +++++ WM VQ  W+YLE +F+GGDI  QLP+EAK+F  IDK++ KIMT   + P + Q+C     +  L  +L D LE CQKSL  YL+ KR  FPRFFF+SD  LL ILG +SD   +Q H++ +FDNI S+ F   T                                        RR N V I+K+        KV  +++F     V L   Q+ WT + E+     +  +K   K    + +LL+  ID    +    L   +R+K  T++ I VH +DI D     +I    +FEW  Q RFY++ + D + I      F Y  E++G   RLVITPLTDR Y+TL QAL M +GGAPAGPAGTGKTETTKD+ + LG   VV NC + MD+R +G+I+ GL Q G+WGCFDEFNRI++SVLSV + Q+  +  G   +   F F +G  ++++   GIF+TMNPGYAGR ELPE++K  FR V ++VPD Q I  + L S GF+    LA+K  TLY+L +EQLSKQ HYDFGLR + SVL   G  +R++P  +E  ++MR LRDMNL K I ED PLFL LI+DLFPG+   +  YP+   ++++ + E   I       KI+QL+ET + RH  M +GP+G GKS  I  L  + T      + + MNPK  +  +++G LD  T DWTDG+ S ++R+  +   K E  +++ DG VDA+W+EN+NSV+DDN+ LTLANG+RI +  +C ++FE  ++  ASPATVSR GMV++    L ++P  + WL K+  + E++ L  L+    P      I+ +     ++ L+  + +  +N++  L    D   +L+RE M     E +++ ++ WS+G  L +D + K + +++       S   D P      P    T+FDY+   +    +W+ W   V +Y++     PE  +S ILVP +D VR  +L+    K  + VLL+GE GT+KT + + +L  ++P+ +   ++NFSS TT L  QR++ES V+KR   +YGPP GK++ +FIDD+NMP ++++G Q    +++ ++E++G ++  K   +  + DI FLAAM  PGGGRND+  R    FS+FN T PS +S+  I+  I +GH C    F ++++  V  +  +T  ++    V++ PTP+ FHYIFNLRDLSRI+QGM     D          +W+HE  RVI DR  + +D     + +   +EE+L E      K + D    D     P   G+     +    ++YE + ++ + +      +  Y+E++  + M LV F DA+ HL +I R IR   G+ALLVGVGGSGKQSLT+LA++     IF+I L+R Y+  +L E+LK LY   G + K   F+  D  + +E FLE +NN+LSSG V  LF  DE + I+S +    +       P+ E++ +YF+++   NLH+VLC SP           FP +++  T+DWF  WP+ AL AV+  F+   +       + E+V+        V E   ++ Q++RR  +VTP +YL FI  Y  +   K+K  ES    +  GLQKL EAS  +A L+ +L +++  +       + +LKE+T +   A + K   Q+     +     I  +K  A+  L  A P LE+A  AL  ++ +D+  +R+ A+PP  +  + +C+ +              KN    +W+ +  +M   +FL SLQ    D I  +   ++    D     I+  + V     GL  +  A+  +  + RE+ P +  +   E        +L+K + E+D  ++EL  +   YE A+ E+Q L E+ +  + ++  A  LI+GL+ E  RW    +    Q  RL+GD L+ +AFLSY G F+ EFR  ++ S W+ ++  R IP      L ++L +   +S+WN +GLP D+LSIQNGI+ T+A+RFPL IDPQ Q   WI  KE  N L+  + N   F   LE ++  G P L +DV E +DP +DNVLEKN         V +GDKEVD    FRLY+ TKL NP Y P I  ++ +I++TVT++GLEDQLL  ++  E++ELE+ R  L+++   NKR +K+LEDSLL  L ++ G+++D+  LI  L  TK  + EV++KL++ A T  +I+  R+ YR  A RG+IL+F++ EMS +N MYQ SL  +L +F  SL +S       KR+ N++  +T  V+ Y   G++E+HK LFT  +TLK++M    +  +E    IKG  S+++ A   KP  W+ D++W ++ +L+++   +FS +L+ I R E  W+ W + E PE   +P  Y   L  F++L L+R +  DR       Y+++ MGE Y    IL+ ER  ++S P +PI+ +LS GSDP   ++ L +R    T    ++SMGQGQE +A+ LL   +A G W +LQNCHL + +L EL   +      H  FRLW+TTE    FPI +LQ S+K   EPP GLK  L+ TY+ I    L+  N   +  +++++AF H+ VQERRKYG +GW+IPY+FN++DF   +Q +Q +L    D  D K  + W +++Y+IGE+ YGGR  DD+D+R+L T+   +F + +F+    F FY      Y IP+C + D  L+YI+ LP  +TPEVFGLH NA+I Y +  AK++   ++ IQP+   SG  ++R+  +   A  +  KLP  +    + K+      + P  + L QE++R   ++  +  +L  L  A+ G + MS  L D    +Y+ +IP  WK+ A     +L  W T   +R  Q+  W+  G PN  W++G   P+ +LTA+ Q   R N GW LD+  L   VT++    ++T+   +G +V+GLYLEGAGWDR    LV  KPK L + +PV+++   E + +K    +  P+Y    R +     ++   DL T++ P +W+L+GV L+ +
Sbjct:  735 KNALERFSRYHHIWRK-------DRESTIQEFSQGNPLLAEFESQILYYKDLELEINAEPEFITVGALALYTADLKLALTAETKGWMLDFGHHCKRKYRTEMEQVFTFVDEASKKLNRPIKDLDDIRIAMAALKEIREHQITIDFQVGPIEESYAMLNKYELSVAKEEMEKVDTLRYTWEKLLARSSEVQNELVSLQPNFRGELISNVQTFVEDCDHFYQEYDKDGPMVMGLAPQDASDRLIMFQNRFDNLYRKFVTFTGGEELFGLPVTQHPQLLEIRKQLTLLQKLYGLYNNVIETVNGYYDVLWADVHIERINNELLDFQTRCRKLPRALKEWQAFLDLKKTIDDFSECCPLLELMANRAMMTRHWKRITEVTGHTFEVETDTFKLRNIMEAPLLKYKEEIEDICISAVKERDIEQKLKQVIAEWDNKTFTFAQF----KTRGELLLRGDSTSEIISNMEDSLMVLGSLMSNRYNTPFKAQIQKWVQNLSNTTDIIENWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMPNVVQSCVGDETMGQLLPHLLDQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVVFHDKT----------------------------------------RRVNHVLISKQVKHHCILFKVMFKFVF-LLAQVGLLGIQMIWTKDSEEALTNARFDRKIMTKTKQSFLELLNTLIDMTTKD----LGTMERTKYETLITIHVHQKDIFDDLCHLNIRSPSDFEWLKQCRFYFIEDLDRMMINITDVGFKYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIDLSVLSVAAQQIAVVLTGKKERKKTFTFTDGDIVEMNPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRQIIIRVKLASCGFIDNVELARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRSNPTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPGIQLDKAGYPELEAAIDKQVTEAGLINHPPWRLKIIQLFETQRVRHGMMALGPSGAGKSTCIHTLMKAMTDCGQPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLR-AKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLNWSPILEGWLMKRSAQ-ESEVLRHLFSSSFPTLYQFSIQSL--DFKMDMLEAFVIMQCINMLQGLIQPKDQGGELSREHM-----ERLYVFALMWSIGALLEQDDRKKMEHWLRH----HDSIHLDLPYIP---PDSQDTMFDYH---VTNDGQWVHWNLRVEEYIYPKDITPE--YSSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGYLSKSNPESHTAKSLNFSSATTPLMFQRSVESYVDKRMGTTYGPPAGKKMSIFIDDINMPVINEWGDQVTNEIVRQLMEQKGFFNLEKPGEFTNIVDIQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFGVIGTGHYCSQRGFEEDVRKVVSRLVPLTRRLWQMTKVKMLPTPANFHYIFNLRDLSRIWQGMLNVNADVIHTPKVLLCLWKHECKRVIADRFTSPEDVAWFDSMLANLVEEELGEEYRDVVKPEVDAYFVDFLQDAPEATGEEPENADFDMPKVYEPIASFPSLRDRLNMFLGLYNESIRGAGMDLVFFTDAMIHLVKISRIIRTPRGNALLVGVGGSGKQSLTRLASFIAGYGIFQITLTRSYNTANLMEDLKNLYRTAGQQGKGISFIITDNEIKDESFLEYMNNVLSSGEVSNLFARDEMDEILSDLIPVMKREFPRRPPTNENLHEYFMSRVRQNLHVVLCFSP-----------FPALISGCTMDWFSRWPKDALVAVSEHFLSSYDIDCTPQVKGEVVQCMGSFQDGVAEKCVDYFQRYRRSTHVTPMSYLSFIQGYKAIY--KEKHLESVKFAMNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAHAAEKVKIEVQKVKDKAQAIVDSISADKAIAKEKLEAAKPALEEAEAALQTIKPSDIATVRTLARPPHLIMRIMDCVLLLFQRRLNAVKIDAEKNCITPSWQESLKLMTAGNFLGSLQQFPKDTINEEVVELLTPYFDMPDYNIETAKRVCGNVAGLCSWTKAMATFFSINREVLPLKANLVVQENRLAIAHADLQKAQAELDAKQAELDVVQAEYEKAVTEKQMLLEDAERCRHKMQTASSLISGLAGEKARWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRN-LLLSDWQKEMRARCIPFGINLNLTEMLIDAPTVSEWNLQGLPNDDLSIQNGIIVTKAARFPLLIDPQTQGKIWIRNKEAKNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGSTYKVKVGDKEVDVMKGFRLYVTTKLPNPAYTPEISARTSIIDFTVTMRGLEDQLLGRVILTEKQELEKDRMDLVEDVMANKRKMKELEDSLLYRLTSTKGSLVDDESLIVVLSNTKRTSEEVTQKLQIAAETEVKINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSLARSSKSPITSKRIGNIIEHMTYEVHNYAARGLYEEHKFLFTLLLTLKIDMQSNRIKHEEFLTLIKGGASLDLKACPPKPSKWIPDMTWLNLVELSKL--WQFSDILDQIGRHEKQWRSWFDKEAPEEEVIPNAYDQSLDCFKRLLLIRSWCPDRTIAQARKYIVDSMGERYAEGVILDLERTWEESDPRTPIICLLSMGSDPTDIIIALGKRQKVETA---YVSMGQGQEVHARKLLQQFMANGGWALLQNCHLGLDFLDELMDTVTETDSIHESFRLWITTETHRNFPITLLQMSIKFTNEPPQGLKAGLKRTYQGINQELLDVSNMVQWRPMLYSVAFLHSTVQERRKYGPLGWSIPYEFNQADFNATVQFVQNHL----DDMDMKRGVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSETMFN--HEFQFYKD----YHIPRCTSVDQYLQYIQGLPAYDTPEVFGLHPNADITYQSKLAKDVLDTILSIQPKDSSSGGGETREAAVGRLADDMLEKLPPDYSPFEVMKRLETMGRLEPMNIFLRQEIDRMQRVLALVRSTLTDLKLAIDGTIVMSENLRDALDCMYDARIPARWKK-ASWASSTLGFWFTELLERNQQFQAWIFEGRPNCFWMTGFFNPQGFLTAMRQEITRANKGWALDRMVLCNEVTRW-MKDDITQPPQEGVYVYGLYLEGAGWDRRNCRLVDSKPKVLFEMMPVVRMYA-ENNGVKDSRLYSCPIYKKPARTDQ---NIIAAVDLRTSQRPEYWILRGVALLCD 4171          

HSP 2 Score: 109.383 bits (272), Expect = 1.053e-22
Identity = 120/566 (21.20%), Postives = 241/566 (42.58%), Query Frame = 1
Query: 1135 SPLAEIDFWRERNAXXXXXXXXXXXPKVKRILNLYSLAEGPVFDTQNN---ELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIAWNLSDRVARLIDVN---TIFNLPLEHVLKDTAEAEKMLRVWNDTYFEVRASIEASGRDARWEFDRKRLFEKTNYMADICHDLNEIAMILQEFYNIFGPELKSVTNEAKRIXXXXXXXXXXXXPLKEMPFNPFNLMKHKYDWSNFMEDFRRK---VVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEVESIDQLFKTNMNNPPLYHFKSCVAGGISWERHLFYNIKRPILRFLTMDEMMQSDNGKRIRTKYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILALANSENFVSENVPEETIDKMDDDLRVDFGFEINEIITETRNLELLGYKVPELA----RNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISDYIEKCNLAL 2793
             P AE+D W++R +  + LL+QLK P VK +L +  +A+  +  T       +     EAKDN K+L  +ER F  + Y  N +++ ++I  ++ A+RMI  ISR+YN  E++  L  ++   +       I  N   TI++ P + V +    A ++   +   + + +  +E S  + +++F    +F K +      + +  +   +  +  +   +++ +   A R++ ++         +K+ P++  +  + + D+    E+F ++   ++SI +  I+                                    +K+      Y +++E + +++      PP+      VAG I W R L+  I+ P+  F     ++ +   KRI   Y  V +T+  +E      W       +S+L+R  + A       +    P+        +L V+F  +I   I ET  +  +G ++P  A    +   +   +YN +   L G+   +            ++LT  + +V   I PGL  LNW+SL I  ++ +   AL
Sbjct:  119 GPRAELDHWKKRMSRFNYLLDQLKSPDVKSVLGVLLMAKSKLIKTWRELDIRITDSANEAKDNVKYLYTLERFFDPL-YNSNPVSMVEAIAGLINAIRMIHSISRYYNTSEKITSLFVKVTNQMITACKAYITNNGSATIWDQPQDVVAEKIRAAIRLNEEYQKCFHKTKQKLEQSPSERQFDFSEMYIFGKFDTFQRRLNKILTMFSTISTYSALQDSKIEGLETMATRLQNIVVT-------MKKKPYSFLD--QRRTDFDQDYEEFCKQTTELLSIPDLGIE------------------------------------EKYQKAFQNYSRDIEMVSRIYTKQKMEPPIGRNLPPVAGKILWSRQLYLRIEEPMKLFQQHPNVLATPEAKRIIRNYNRVAKTLVEYEVIYHRGW-------MSQLVRIGLQA------SLLVRCPDTR------ELYVNFDPQILTQIRETDCISRMGLEIPPFAAVLRQKQNVLKTHYNNLQVTLCGIQPAFE-----------QMLTPHVAKVDEAILPGLTSLNWSSLNIDKFLSRVTAAL 608          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Cavefish
Match: dnah12 (dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:ZDB-GENE-090311-9])

HSP 1 Score: 1933.69 bits (5008), Expect = 0.000e+0
Identity = 1188/3372 (35.23%), Postives = 1855/3372 (55.01%), Query Frame = 1
Query: 4159 LKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKM-------------PREVKAMVTAR------------------NLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDT-FTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSS-DCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQE---IMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQT-----------KLQLHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKF---ENDT-LAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQL----TREGMNQDT---IEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDKPAKAGELPSRF---PTLFDYYFDSIEEKQEWIPWANLVPQY-VHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQ--RPVLLVGETGTSKTA-VSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSV--FNATFPXXXXXXXXXXXXXXGHCQMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSENAKSDKDYAMTD---------PILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEA-VSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVR-----NEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYK--EIN------------WKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVR-DSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKRKKPYLWLSDISWQDVTKLTEMIPIK------FSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLTKP--HPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTA-----FPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTGKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTI-VVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGEPNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAM-----GVGLVVEADLATTEHPSHWVLQGVCLILNTD 13926
            +K     L  +E     +N  E L+    T YPE+  +++ ++   +++ L    ++  + W +  + +L+ + ++  ++ F +E  KM              RE +  +  R                   + E++KEFK+ +P+ S L +  +R RHW+++      N D+ P++  TL  V    L+ + +    I  +ASKE S+EK ++ + ETW  + FS   + + G     IL A+DE+  +LDD  +  Q+M  S FI PF   ++ WE+ L  I + +D W+ VQ +W+YLE IF   DI  Q+PEE + F  +DK ++++M    K P +  A  +   L  L   ++ LE+  K LN YL+ KR  FPRFFF+S+DE+L IL  + D   VQ H+ K F+ I+ L F     ++    AM SSE E   +++  S     G VE W+ ++E  M  + R +   +   Y E+K R QW+ ++ G V LCT+Q++WT EV +  R    G    LK+Y   L +Q+ +IV  VR  L K  R+ L  ++ IDVHARD+V   +   +    +F+W +QLR+YW  +   + I  C     Y YEY+G + RLVITPLTDR Y TL  A  + LGGAP GPAGTGKTETTKDLAKAL + CVV NC +G+DY ++GK F GL   GAW CFDEFNRIE+ VLSV++ Q+  IQ  + MKL  F FEG E++L+    + ITMNPGYAGR+ELP+++K  FR V ++VP+   I EI L+S GFL+AK L+ K+   YRL  EQLS Q HYD+G+RA+K+VLV AG L+   PD +ED +L+R+++D+N PKF+  D PLF G+  DLFPG+  P   Y  F D  +EC  +H    +    DK++Q YE M  RH  M+VG    GK+ V+ +L  + T           K+Q  T    +NPK  ++ +L+G  DP + +WTDG+++N FRE     +  +R++++FDG +D LW+E+MN+V+DDNK L L +GE I++ N  +L+FE  DL  ASPATVSRCGM+Y++P  LG+ P    WLN         EN T L  L+   IPP + R++         +  + ++  TN N V  L  + +  L    T E  N++    I A F  S+ WS+GG    DS+ +FDQF++ + +  +  E   PA   +    F     ++DY ++  + K  WI W   +    + +   K  +I+VPTIDT+  T   T  I     RP+L VG TGT K+  V +  + N + ++Y+   INFS+RT++   Q  + + ++KR K  +GPPMGK+ ++F+DDMNMP ++ +G Q PI +L+   +    YD  KD +   + D+  ++AMG PGGGRN V PRF+  F++   NA      S               F ++  +    I   T+ +Y + +  L PTP+K HY FNLRD SR+ QG      +         R++ HE  RV  DRL++D D+ ++ K ++  + E+ K   D               +LFGDY      A  RLY ++ + E+   + +  + EY++   + M LV+F   L+HL+RI R ++  GG+ALLVGVGGSG+QS+T+LA +     +F+  +S+ Y   + RE+LK L  K G++ + TVF+  D  + EE FLE ++++L++G VP LF  DE++ I+  +       +A +  +  S  +++ +FVN+C  NLH+V+  SP+G+  R R R FP ++N  TI+WF PWPE+AL  VA+ F+  E   + D +R E++      H S    S++F+ +  R NYVTP +YL+ I  +  LL +K     +   R   GL KLA A  Q+ E+  +L   +  + +  I    +++ I   +     K ++ + + +    ++ E +  K E E+ L EA+P LE A  ALD L+ +DV  ++S   PP  V++V   + V K+ K  +IN            W  +K ++ D +FL+ L+  D DNI     + +R + +        ++   S A  GL K++TA+  Y  VA+ + PK+  +   +++       L + + E+ ++E  L  L +  E   +E+ +LQ + D+  R+L  A+KLI GL  E  RW      L++    L GD L+ +  ++Y+GAF+  FR+      W      + IP SD F L   L + ++I  WN  GLP D  SI NG++ + + R+PL IDPQ QA  W+   E  NNL      D D+++ LE  I++G P L ++V E +DP ++ +L K I    G + + LG+  ++F  +FR Y+ TKL NP Y P +  K  ++N+ +T +GLEDQLL ++V  ER ELEE+R  LI +++ NK+ LK++ED +L  L +S GN+L++   I  L+  K  ++E+S+K ++  +T  +I + R+GYR  AK  +ILFF +A+++ I+ MYQYSL+ +++++  S++ S     L+KRL+ +++  T N+Y   C  +FEK KLLF+F +   L + K  +   E  F + G   ++         WL D SW ++ + +++  ++      F   L   +  E           P    LPK + +KL  FQK+ + RC R D+I  AI+ Y+  ++G+++V PP  +  + ++ S    P+VF+LSPG+DP + ++K A     G    K IS+GQGQ   A  ++ +A+  G W+ LQNCHL V W+  LEK  E  +    HPDFRLWLT+ P+  FP+ ILQ  +K+  EPP GL+LNL  +Y    +S    F+  +     +  L++ + FFHA+VQER+K+G +GWNIPY FNESD R+ I+ LQ ++    +     +P+ ++ YL GE  YGGR  DD+DRR+L T + +++     D  +   +  S    Y  P     +D +++I +LP    PEVFG+H N +I       K ++  LI  Q    K G+S   D  + + A+ I++KLP+ F++D    K+ +    ++  VL+QE+ER+N L + +  SL  L++A+ G V M AEL+ +A SL  G++P+ W + +  +LK L ++IT F  R      W +  +PNV WLSG    +++LT  +Q   RK   P+D  +    V  F T+A   E    G +VHGL+L+GA WD+    L    PK L  S+P+I + P      K   TFL  +  TS+R+  +         V+   L T++ P HW+ +GV ++   D
Sbjct:  588 IKTVQKWLQEVEDSISFINKEEALYKWDQTVYPEIDVMKENIEPYQKVFGLVLKWQRTEKRWMDGSFLDLNGESMEAELDEFFREIYKMLKSFQQKQKKAEQGRERQVAMKRRPGEGDDDHLESPTALMCIKVIEQIKEFKEHIPMVSILCNPGIRARHWEQMSEIV--NHDLTPNSGTTLRKVLKQNLSAYMEHFETISAAASKEFSLEKALQNMVETWDIISFSHHAHRESGVS---ILTAVDEIQTMLDDQIVKTQTMRGSPFIKPFEKEIKAWEERLIRIQDTIDEWLKVQAQWLYLEPIFSSQDIMQQMPEEGQLFQTVDKHWREVMRHCVKDPKVLPATSLTGLLEKLQESNNLLEQIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLDFLPNLDIQ----AMYSSEGERVELIQLISTSEARGAVEKWLVQVEDVMLSSIRDVINRSRLAYPETK-RSQWVREWPGQVVLCTSQMYWTQEVHEAIRSGVGG----LKNYYNQLQSQLKDIVELVRGKLPKQTRTTLGALVTIDVHARDVVMEMIEKGVSHETDFQWLAQLRYYWNNDNVRVCIINC--DVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIEMKLEFFDFEGTELRLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLVAAGNLKLKFPDENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGISLPAADYQLFLDCAQECCKKHNVQPVKVFLDKMIQTYEMMIVRHGFMLVGEPFAGKTKVLHVLADTLTLMNERGYNDEEKVQYRT----VNPKSITMGQLFGQFDPVSHEWTDGIVANTFREYAS-AETPDRKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSNQMSLIFEAMDLSQASPATVSRCGMIYMEPSQLGWLPLVTSWLNTLPQPLQTQENSTLLLELFNWLIPPAL-RMLR--------KNCREVVSTTNSNTVVSLTRLFEMLLTEPVTEEPGNKNIRTWIMAAFAFSLVWSIGGSCDRDSRERFDQFLREILS-GKLEEHPIPAAVSKWECPFNDKGLVYDYSYE-FKGKGCWIHWNESIKNVTLGDKNTKVQDIIVPTIDTIFCTLFTTLIIFFSPFRPLLFVGPTGTGKSVYVKEKLMNNLNKERYLPFFINFSARTSANQSQNIIMARLDKRRKGVFGPPMGKKCIIFVDDMNMPAMEVFGAQPPIELLRQYFDHGNWYDL-KDTSKITLVDVQLISAMGPPGGGRNAVTPRFLRHFNICSMNAFSDDTMSRIFSNVVAFYLRNNDFPNDCFSIGNQIVAATLEVYKKAMENLLPTPAKSHYTFNLRDFSRVVQGCLLLKKESLENKRTMIRLFVHEVFRVFYDRLVDDQDRDWLYKLMKNIVKEHFKESFDTVFEHLKLCEEDMRSLLFGDYMTPDVEASERLYAEVPSMESFSQVVESYLTEYNQTHKNRMNLVIFRYVLEHLSRISRVLKQPGGNALLVGVGGSGRQSITRLATFMADMTLFQPEISKNYGMNEWREDLKLLLKKAGVKGQKTVFLLTDAQIKEEAFLEDVDSVLNTGEVPNLFAVDEKQEIMEVMHAVRPIAQAGNKSLEFSPLALFAFFVNRCRENLHVVVAFSPIGDAFRNRLRQFPSLINCCTINWFQPWPEEALERVANKFL--ETLEMSDHERQEVMLICKTFHTSAIHLSEKFLSELGRHNYVTPTSYLELIAAFRLLLTNKRDTVMNAKKRYTNGLDKLAFAESQVGEMKKELVDLQPKLEQAKIDNIKMVQVIEVESVQVEAKSKVVRVEEEAASQKAAEAQALKNECESDLAEAIPALEAALSALDTLKPSDVTIVKSMKNPPSGVKLVMAAVCVMKDIKPEKINDPAGTGQKILDYWGPSKKLLGDMNFLRDLKVYDKDNIPAPVMHKIRSEYMTNPDFDPTKVAKASSAAEGLCKWITAMEVYDRVAKVVAPKKANLIVAQQSLAATMALLNQKRAELKEVEDRLAALKKTLEEKTEEQAQLQFQVDLCARKLERAEKLIGGLGGEKTRWSKAADDLQNTYDNLTGDVLISAGVIAYLGAFTAGFRQNCT-KEWTKLCKSKNIPSSDDFSLSKTLGDPIKIRAWNISGLPTDSFSIDNGVIVSNSRRWPLMIDPQGQANKWVKNSERENNLNVIKLTDADYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLKQIFKQGGMDCIRLGESVIEFSSDFRFYITTKLRNPHYLPELATKVSLLNFMITPEGLEDQLLGIVVAKERPELEEERNALILQSAANKKQLKEIEDKILETLQSSEGNILEDESAIQILDSAKIMSNEISKKQQIAEKTELKIAESREGYRPIAKHSSILFFSIADLANIDPMYQYSLNWFVNLYINSIQDSNKSKILEKRLRYLINHFTYNLYCNVCRSLFEKDKLLFSFLLCSNLLLAKKEIEYAEFMFLLTGGVGLQNNVPNPDPNWLQDKSWDEICRASDLPGLQGLRYPPFCHFLPIYDSKE-----------PYNTPLPKPWCDKLSDFQKMIIYRCLRPDKIEPAISNYITGKLGKKFVEPPPFDLSKSYNDSNSTIPLVFVLSPGADPMASLLKFANDKNMGGANFKSISLGQGQGPIAVKMIQSAMKEGTWVCLQNCHLAVSWMSTLEKICEDFSPETCHPDFRLWLTSYPSPMFPVTILQNGVKMTNEPPTGLRLNLLQSYLSDPVSDPQFFSACSNKELVWEKLLYGVCFFHALVQERKKFGPLGWNIPYGFNESDLRISIRQLQLFVNSYEE-----VPFEAITYLTGECNYGGRVTDDWDRRLLLTILADFYNK---DIIENPRYMFSPSGKYYSPPKSIYEDYVEFIRNLPATQHPEVFGMHENVDISKDLQQTKLLFDSLILTQGGGSKGGASSGGDSTLMDIANDIRTKLPENFNIDSALNKFPVLYEESMNTVLVQEMERYNNLCNTIRVSLQNLLKAIKGLVVMDAELEAIAGSLLVGKVPEKWAKRSYPSLKPLGSYITDFLTRLKFLQDWYDTTKPNVFWLSGFFFTQAFLTGAMQNYARKYSIPIDLLSFDYEVLPFDTSATSPE---DGVYVHGLFLDGARWDKKSGVLAEQHPKVLFDSVPIIWIKP------KHCCTFLL-LSCTSERKGTLSTTGHSTNFVISIMLPTSKRPQHWIKRGVAMLCQLD 3894          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009595.1 (pep scaffold:Pmarinus_7.0:GL478108:144315:184457:1 gene:ENSPMAG00000008659.1 transcript:ENSPMAT00000009595.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 3020.34 bits (7829), Expect = 0.000e+0
Identity = 1465/2301 (63.67%), Postives = 1825/2301 (79.31%), Query Frame = 1
Query: 7054 RRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKF---ENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQL--TREGMNQDTIEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDK-PAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQV-DQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSENAKSDKDYAMTDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKT-ATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKRKKPYLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLTKPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQL--KYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTGKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGEPNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMGVGLVVEADLATTEHPSHWVLQGVCLILNTD 13926
            RRY+LFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQN CALLFEVGDLQYASPATVSRCGMVYVDPKNL Y P+WQ WLN +  K    +   L  L++KY+P  ++ +++G+++G+  E LKTI+P T+LN+V+QLC ML+  L        +  +E  F++++Y SLG  L+E+++  FD  +K L AM    ++ K  A+ GELP + PTLF+Y+FD   E Q W+PW+ LVP YV++ + +F +ILVPT+DTVR +WLL + ++ +RPVLLVGE+GTSKTA +  FL+  D D  + L INFSSRT+SLD+QR+LE++VEKRTKD+YGPP+GKRLL+F+DD+NMP+V D+YGTQQPIA+LKL+LER   YDRGK++  K ++D+G++AAMGK GGGRN VDPRF+SLF+VF+ TFPS+ SL  IY+SIL GH  MFS+E++     +T  T+ +Y+  + +LPPTPSKFHYIFNLRDLSRIYQG+C TT +RFT      R+WR+E  RV  DRLIN DDK  V++ +   L E+   D +  M DPILFGDYR+AL   E RLYED+ +YEAA+ LFQEI+EEY+ + +PM LVLF+DAL+H+TR+HRT+RM+ GHALLVGVGGSGKQSL++LAAY   C +FEI LSRGY+E  LR++LK LY +LG+E K T F+F D HVVEEGFLELINNML++GIVPALFPDDE+EA+I QVR+EA+ AG GP++ES+W YFV+KCASNLHIVL MSP G+TLRTRCRNFPG+VNNT IDWF PWPEQAL AVA  F+  EN +IP D R  +V H V VH SV ++S +F +K RR NYVTPKNYLD++ TY +LLE+KD +   QC RL+GGL KLAEASVQLAELN++LA QKV +  K++AC+ LL+EI+  T+   EKKQ+A+EK++ +E Q++ I  EKGEAE AL  ALP L+ AR AL +L+K+DV EIRSFA PPK VQ V ECI + + +KE++WK AKGMM++ +FL++L  MD D I   Q  ++R  L  L  T +EM  +S+AG G+LKFV AV+GY +VAREIKPKR+KVARLE+ F Q+KRELE+++ E+  L+ EL  L  +YE A+ ERQ+LQ E ++M+RRL AADKLI+GL SEN RW  +LQ L+ ++VRLLGDCL+ +AFL Y GAFSWEFR  M+   W+ +V ER+IP+S PFR+E +LT+DVEIS+W SEGLPPDELS+QNGILTT ASRFPLCIDPQQQALNWI +KE+ NNLK  ++FNDPDFLKQLE+AIKYG PFLF+DVD+YIDPVIDNVLE+NIKG QGR++V+LGDKEVD+DP+FRLYLNTKL+NP+  P+IFGK+MVINYTVTLKGLEDQLLSVIV FER ELEEQRERLIQETS NKRLLK+LEDSLLRELATSTGNMLDN EL+ TLE+TK+KA+EV+EKL L  +T+ +ID+ RDGYR AAKRGA+LFF LA+M+ ++ MYQYSLSA+L VF  SL+KSLPD  L KRL N+  TLT N+Y YGCTG+FEKHKLLF+  + ++LE  +  + Q ELDFF+KGN S+E + R +P+ WL +  WQDV +L E+ P  F+ L + +ER+  +W QW + +TPE A LP  Y++ L +FQ L +LRCFR+DR+YRAI+ YV   MGE YV PP++N E + +QS+P SP+VFILS GSDPA D+ KLAER+GF  ++LK ++MGQGQE  A  LL  A++RGHWL+LQNCHLL +WL+ELEK LE ++KPHPDFRLWLTT+PT +FPIGILQRSLKVVTEPPNGLKLNLR+TY +++  +L++  H AF  LV+TLAFFHAVVQERRKYGK+GWN+ YDFNESDF+VC++IL TYL KA +Q + +IPW SLKYLIGEVMYGGRAID FDRRIL TYMDEY GDFLFD+FQ FHF+ +    Y +P     D  +    +ESLPL NTPEVFGLHSNAEIGYYT AA++MW  L+D+QPQTG++GS  SRDE I+  A  I+++LP  F+L + RK+ G  +SPT VVLLQE++RFN L+ RM +SL  L +AL GEVGMS ELD+VA++L+NG IP IW+RLAPDTLKSLANW+ HF+ R+ QYS WVE+GEP VMWLSGLHIPESYLTALVQATCRKNGWPLD+STLYT VT F    EVTER  QGCFV GL+LEGA WD    CLVR KPK L+  LPV+K+IPIE+HRLK Q+T  TPVY TS RRNAMGVGLV EADL TT+HPSHWVLQGVCL LN D
Sbjct:    1 RRYILFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNTCALLFEVGDLQYASPATVSRCGMVYVDPKNLEYQPYWQRWLNSRPAKVRLHDQAELQRLFEKYVPSCMEMIVDGVVDGRQGEPLKTIVPQTDLNMVSQLCAMLNAVLHEEEAEEEEAVLECHFLEALYCSLGATLLEEARATFDSHVKGLSAMTTVADDLKTSAQPGELPGQCPTLFEYHFD--RESQSWVPWSRLVPAYVYDAQVRFCDILVPTVDTVRTSWLLEQMVRTRRPVLLVGESGTSKTATTHNFLKGLDSDTTLLLPINFSSRTSSLDVQRSLEASVEKRTKDTYGPPVGKRLLIFMDDLNMPRVVDEYGTQQPIALLKLLLERGSLYDRGKEMTCKTLRDLGYVAAMGKAGGGRNQVDPRFLSLFTVFHVTFPSEESLHYIYASILRGHTLMFSEEVRAACDRLTSCTLQLYHAAVSELPPTPSKFHYIFNLRDLSRIYQGLCLTTPERFTTVGHMVRLWRNECLRVFHDRLINTDDKILVERHVRRLLEEHFPHDVEVTMRDPILFGDYRSALSPGEPRLYEDIQDYEAARALFQEILEEYNSSETPMNLVLFEDALEHVTRVHRTLRMERGHALLVGVGGSGKQSLSRLAAYAAGCQVFEITLSRGYNESSLRDDLKALYTRLGVEGKPTAFLFTDAHVVEEGFLELINNMLTAGIVPALFPDDEKEALIGQVRDEAARAGCGPARESVWHYFVSKCASNLHIVLAMSPDGDTLRTRCRNFPGLVNNTCIDWFLPWPEQALLAVAQSFLAGENPMIPGDHRGAVVSHVVSVHCSVGDFSVQFQRKLRRSNYVTPKNYLDYLATYTRLLEEKDLYILGQCQRLEGGLDKLAEASVQLAELNERLAEQKVVLAAKSLACDALLEEISRSTETVNEKKQLAEEKAREIEDQNRVIAVEKGEAEEALTAALPALQAARRALQELDKSDVTEIRSFATPPKQVQTVCECILLMRGHKEVSWKAAKGMMSESNFLRNLMEMDCDAIGQGQVKLIRGILKSLGTTYEEMVPISRAGAGMLKFVEAVMGYCEVAREIKPKRDKVARLERDFYQSKRELERIQAELATLQEELAALGSKYEAAMSERQQLQAENEVMERRLLAADKLISGLGSENARWTSELQELRQRRVRLLGDCLLSAAFLCYSGAFSWEFRSAMLSDAWEKEVREREIPLSQPFRVESLLTDDVEISRWGSEGLPPDELSVQNGILTTHASRFPLCIDPQQQALNWIRRKEQKNNLKVVSSFNDPDFLKQLEMAIKYGFPFLFQDVDDYIDPVIDNVLERNIKGQQGRQYVVLGDKEVDYDPSFRLYLNTKLANPRLSPSIFGKAMVINYTVTLKGLEDQLLSVIVAFERSELEEQRERLIQETSHNKRLLKELEDSLLRELATSTGNMLDNAELVLTLEDTKAKATEVAEKLALAEKTALDIDRLRDGYRPAAKRGALLFFSLADMAQVSGMYQYSLSAFLGVFDLSLRKSLPDTVLPKRLVNITDTLTHNIYNYGCTGLFEKHKLLFSLNMAIRLEQAEERVPQSELDFFLKGNISLEKSARARPFDWLPEQGWQDVVQLAEVSPDAFASLPDHVERNGQAWGQWFDLDTPEQAPLPDGYAHSLSAFQHLLVLRCFRVDRVYRAISDYVASTMGERYVQPPVVNLEGVLEQSSPTSPVVFILSAGSDPAGDLAKLAERTGFSGSRLKMLAMGQGQEKAALQLLGHAVSRGHWLMLQNCHLLPRWLKELEKALEGISKPHPDFRLWLTTDPTPSFPIGILQRSLKVVTEPPNGLKLNLRATYFRVSHEALDSCPHPAFRPLVYTLAFFHAVVQERRKYGKLGWNVSYDFNESDFQVCMEILCTYLSKAHEQANGRIPWASLKYLIGEVMYGGRAIDSFDRRILTTYMDEYLGDFLFDSFQVFHFFCNSETDYRLPPDGPKDAYIVTAEVESLPLANTPEVFGLHSNAEIGYYTQAARDMWRHLVDLQPQTGETGSGVSRDEFISGVARDIQARLPLPFELGQTRKRLGAVLSPTAVVLLQEMQRFNALLQRMARSLAELQKALAGEVGMSGELDEVARALFNGTIPAIWRRLAPDTLKSLANWMVHFHQRHQQYSAWVEDGEPTVMWLSGLHIPESYLTALVQATCRKNGWPLDRSTLYTQVTTFRGPEEVTERPGQGCFVSGLFLEGADWDVEASCLVRSKPKVLMVQLPVLKIIPIESHRLKLQSTLRTPVYTTSTRRNAMGVGLVFEADLFTTKHPSHWVLQGVCLTLNCD 2299          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Sea Lamprey
Match: DNAH6 (dynein axonemal heavy chain 6 [Source:HGNC Symbol;Acc:HGNC:2951])

HSP 1 Score: 2078.91 bits (5385), Expect = 0.000e+0
Identity = 1221/3348 (36.47%), Postives = 1915/3348 (57.20%), Query Frame = 1
Query: 4192 EHRRQELN--AAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSS-DCECVQEHMIKMFDNISSLRFT-------KGTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVFFYRESKVRVQWMFD-YQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKL-------------QLHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDT---LAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTREG-----MNQDTIEAIFIQSIY----WSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPD-KYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDI-----GFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSE--NAKSDKDYAMTDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYS-EAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGP-SKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITI-------DEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKRKKPYL-WLSDISWQDVTKLTE-------------MIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKD-----YSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLTKP----HPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSL-NNFNHTAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTGKSGSSQSRDEIINEKASGIKSKLPKLFDLDRL------RKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGEPNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLY----------TSVT------QFATAAEV---TERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAM-----GVGLVVEADLATTEHPSHWVLQGVCLI 13914
            E ++Q L   A ++ F + +T +  L  V  E+K    +++  D  +   + W E  ++ LD + L+  +  + K   ++ + +        L +K++  ++ LP+ + L++ +L+ RHW+ L    G          TL+ +  +E+  + + I ++   AS E S+E  +++VE+ W T +F V P+ +  K+  +IL   DE+  +LDD+ +N+ ++++SR++GP    V  W++ L L ++ L+ WM  QR W+YLE IF   DI+ QLP EAK F  +DK++K IM +  + P   +A   P  L    N +  LE+ QK L  YL+SKR  FPRF+F+S+DELL IL  + + + VQ H+ K FD I+ L F        +  +      AM+S E E +     +   G VEDW+ K+E  M ++ R +TK A+  Y +S  R +W+       V L   Q+ W  ++             ++ ++ K    +++ +   VR  L K  R  +T ++ +DVHARDIV   V++ +  A  FEW+ QLR+YW  E D    +    Q+ YGYEY+G   RLVITPLTDR YL L  AL + LGGAPAGPAGTGKTETTKDLAKAL + CVV NC +G+DY+ +G+ F+GL Q GAW CFDEFNRI++ VLSVI+ QL TI+N    K+ RF FEG+EIKL      FITMNPGYAGRTELP+++KA FRP+ ++VP+   I E++L+S+GF S++VLA+KMT +Y+L  EQLS+Q+HYDFG+RA+KSVLVMAG L+R +P L ED VL+RALRD NLPKF+ +DA LF G++ DLFPG++ P   Y     S+E  L   K   +     K++QLYETM  RH  M+VGPTGGGK+ V   L  +   L             ++HT +  +NPK  S+ ELYG ++  T +W DGL++   R +    D  + ++++ DG VDALW+EN+N+V+DDNK+L LAN ERI+L     ++FEV DL+ ASPATVSRCGMVY+D + L + P+ Q W+N   +KF  DT   +  L++ Y+   +  V          +K    +P  +++ VT L  +L+  L  +G     M    + +I  Q+      W++GG L+E+   +FD F+K         EE+  AK   LPS    L+ YY D   ++ +  PW  +VP + +N E  F E+LVPT DT+R  +L+ + + ++  VL  G TG  K+ V++  L     + +Y+ L INFS++T+S   Q  +ES +EK+ K+  G P  KR+++F+DD+NMP++D+YG+Q PI +L+   +  G YDR K + WK++QD              PGGGRN V PRFI  FS+     PS+ SL  I+ +IL+G    F   +K     I +  + +Y ++  +L PTP+K HYIFNLRDLS+  QG+ Q         +Q +R++ HE  RV  DRLIN++DK +    + E  S+    + + +Y +  PILFGD+         R+YED+ + E  KG+ Q+ +++Y+  +   MKLV F DA++H+TRI R IR + G+ALLVGVGG+GKQSLT+LA +      F+I LSRGYS     E+L+ LY   G+E+K TVF+F D  +V E FLE INN+L+SG VP LF  DE E +++  R +A  AG+   +++ + Q+F+N+  + LHIVLCMSPVG+  R RCR FP +VN  TIDWF  WP +AL +V+  F  P + L  D+ +  + +  V +H+SV E ++ +  + RR  Y TP +YL+ IN YL +L +K     +  DR++ GL KL E +  + +L  +L+  +  + +K+   E L++++ +  + A + +++  E     +V+++E +    +A+  L EALP L+ A  ALD L+++D+ E+R F  PP+ V+ V E I +  + K+ +W  AK ++ D +FL+ L   D +NI+        D + KLK+ I       +++  VSKA   +  +V A+  Y+ V +++ PKR+++A  +         L   +  + ++E ++  L  ++++++ E++ L +   + Q R++ A KL + L  E  RW   +   + +   ++G+  + SA ++Y GAF+  +R +M+  RW     E  IP++  F L  IL +  EI +WN++GLP D +S +NGIL TR  R+PL IDPQ QA  WI  KE  N LK     D +FL+ LE AI+ G+P L +++ E +DP ++ +L K      GR  + LGD +VD+D NFR Y+ TK++NP Y P +  K  +IN+TVT  GLEDQLLS +V+ E+ ELEEQR  LI   + +K  LK +ED +L+ L TS GN+LDN ELI TL+E+K  +  +  +LK    T E I+  R+ YR  A RG++++FV+A +S I+ MYQYSL  +  +F  +++ S    +L +RL+ ++       YT    G+FE+HKL+F+F + +++    G+++  E + F++G   ++  +  KP + WL++ +W     L +              IPI  ++   +I  +  +W+  + +    T  + ++     ++ +L  FQKL L++ F  +++  A+T +VIE +G+ ++  P ++   ++   +  +P+VF+LS GSDP     + A   G+ + ++  IS+GQGQ   A+ L++ A+  G W+ LQNCHL   W+  +E+ ++ L++P    HP++RL+L++ PT  FP+ +LQ S+KV  EPP GL+ N+R  + +I  +    N     +  ++F + FFHA++QER+K+G +GWNI Y+FN+SD    +  L  + Q      D +IPW +L Y+ GE+ YGGR  D +D+R LRT +  +F      T +P + Y++    Y   +  T  D   YIE+LPL + PE+FG+H NA + +       +   ++++QP++   G+  S DEI+ E A  I +KLP++ D++        R + G  I+    VL QE++RFN L+  +  SLHTL +A+ G V MS E++ +  S  N Q+P +W   A  +LK L  W+     R T    W++ G P   W+SG   P+ +LT  +Q   RK   P+D+   +          TSV       QF    E          G  VHGL+++ + WD     +      Q+   LPV+   P + ++    + +  P+Y TS R   +         VV   + +     +W+ +G  L+
Sbjct:  810 EFQQQALQYRAYQKNFKVEVTNFDALNEVCDELKRKQMMWDSLDEWEVFTKEWLECQFETLDPEQLNSEVAKYAKIVNQLEKGLPPNNVVPLLKKKVEFIREKLPVVAFLRNPSLKARHWEMLEEIIGAPLRDKETPLTLAGLIELEVFHYAEQIQDVSGQASGEASLESILKKVEDGWKTAEFVVLPH-RDSKDV-FILAGTDEIQILLDDSIINISTITSSRYVGPIKSRVDEWQRQLLLFNQTLEEWMTCQRNWLYLESIFSAPDIQRQLPAEAKMFMQVDKSWKDIMRKIYRLPNALRAATQPGLLDTFKNNNALLEQIQKCLEAYLESKRVVFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDAIARLEFALAPAEGEQERTFTNDILAMVSPEGEKVSLGKGLKARGNVEDWLGKVEEAMFQSLRRLTKMAIGEY-QSMPRTEWVVSGLPSQVVLTVAQLMWCRDLTQCLEGGDHDHLQSVANFEKENFERLNSLACLVRGNLPKIHRCIITALITVDVHARDIVTDMVQEKVETANNFEWQRQLRYYWDLELDNCVARMALSQYVYGYEYLGACPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKVPRFMFEGREIKLIQTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPNYALIAEVILYSEGFESSRVLARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENPHLREDVVLIRALRDSNLPKFLADDAMLFSGILSDLFPGVEIPNHDYGSLQSSIENALKARKLQAVPSMVHKVIQLYETMLVRHGVMLVGPTGGGKTTVYTALSDALGSLHEAGESKHNPFYQKVHTTV--LNPKSISMGELYGEVNNLTLEWRDGLMALSVR-VAVADDSEDHKWIVCDGPVDALWIENLNTVLDDNKMLCLANSERIKLTPQIHMIFEVQDLKVASPATVSRCGMVYIDSEELKWMPYVQTWMNGIIDKFGEDTGQYIMALFENYVEDGLRFV---------NKKCTQAMPQVDISKVTTLSCLLESLLLGKGGPDLKMEHSRLTSIVCQTFVFCYLWAVGGNLVENCWDQFDTFVK------HQFEENHDAK---LPSS-GDLWSYYMDYDSKRLD--PWERIVPNFRYNKEVPFFEMLVPTTDTMRFGYLMEKLLAVKHSVLFTGTTGVGKSVVARGLLDKIQEEAQYVPLYINFSAQTSSTRTQEIIESKLEKKRKNIIGAPGKKRVIIFVDDLNMPKLDRYGSQPPIELLRQYQDFGGFYDREK-MFWKEIQDAREDRGAMQPFCAPPGGGRNPVTPRFIRHFSMLCLPSPSEHSLKQIFQAILTGFLVDFPVAVKQVATNIVEAAVEMYGRMSTELLPTPAKSHYIFNLRDLSKCMQGILQCDSGTVRDQNQIFRLFCHECQRVFHDRLINNEDKDYFNTMLAEMASKQFGVQVEAEYFVKHPILFGDFMKVGVQRADRVYEDLTDVEKLKGVLQDYLDDYNLSSAKEMKLVFFQDAIEHVTRITRMIRQERGNALLVGVGGTGKQSLTRLACHMCGYRCFQIELSRGYSYDTFHEDLRKLYTIAGVEDKDTVFLFTDTQIVIEEFLEDINNILNSGEVPNLFEKDELEKVLAATRPKAKEAGIPEGNRDEVLQFFINRVRARLHIVLCMSPVGDAFRARCRMFPSIVNCCTIDWFVQWPREALLSVSKTFFTPVD-LGSDELKENLSEMCVEIHMSVTELAEHYYAELRRRYYTTPTSYLELINLYLSMLGEKRSQLTNSRDRIKNGLTKLLETNELVDKLQLELSALEPVLKQKSEDVEALMEKLATDQENADQVRRVVMEDEAVAKVKAEETQAMAADAQRDLDEALPALQAANRALDSLDRSDISEVRVFTNPPEGVRTVMEAICIVLS-KKPDWASAKQLLGDSNFLKRLTDYDKENIS-------EDVIQKLKVYINNKDFVPEKVERVSKACKSMCMWVRAMDLYSRVLKDVGPKRQRLATAQAELDATMAMLNDKQRRLKQVEDQIGALQDQFDMSVAEKESLAKNMALTQARMSRAGKLTSALGDEQIRWQESVAQFQVEINNVIGNVFIASACVAYYGAFTSHYR-QMLIDRWISRCQELGIPINANFSLIGILGDPFEIRQWNTDGLPRDTVSTENGILVTRGRRWPLMIDPQDQANRWIRNKEMKNGLKIIKLTDGNFLRTLENAIRLGMPVLLEELKETLDPALEPILLKQTFVSGGRLLIRLGDSDVDYDKNFRFYMTTKMANPHYLPEVCIKVTIINFTVTKSGLEDQLLSDVVRLEKPELEEQRNELIVRINADKNQLKVIEDRILKLLFTSEGNILDNEELIKTLQESKVTSGAIKTRLKEAEATEEMINTAREKYRPVAARGSVMYFVIASLSEIDPMYQYSLKYFKQLFNMTIETSEKRSDLAERLELLLKQTLLATYTNISRGLFEQHKLIFSFMLCIEILRQHGHVSDAEWNLFLRGAAGMDKERPTKPEIGWLAESTWNLCCDLEDHLPCFKGLKREIVAIPILVTLGRLEIRLNPEAWEGCMKEPLHFTEEVSENEIQGHWNERLSKFQKLVLVKSFMEEKVVFAMTDFVIENLGKAFIENPPVDLATLYQDMSASTPLVFVLSTGSDPMGAFQRFAREMGY-SERVHAISLGQGQGPIAEKLIEEAVKSGDWVFLQNCHLAASWMLAMEEIIKALSEPNAVIHPNYRLFLSSMPTRNFPVTVLQNSVKVTNEPPKGLRANIRRAFTEITPAFFEKNVLGQNWRKIIFGICFFHAIIQERKKFGPLGWNIHYEFNDSDRECALLNLNLFCQ------DGRIPWDALIYITGEITYGGRVTDSWDQRCLRTILKRFFSP---KTLEPGYLYSTS-GIYYASEEKTLQDHKDYIENLPLNDDPEIFGMHENANLAFQRQETGTLVKTILEVQPRSSGQGAGTSNDEIVKELADSILAKLPEILDMEGAMESLFTRDEKG-RINSLTTVLEQEVDRFNTLLQVIRSSLHTLKKAIAGFVVMSEEMEKIYNSFLNSQVPVLWSDNAYPSLKPLGGWVKDLALRTTFIDAWIKTGPPKSFWISGFFFPQGFLTGTLQNHARKYNLPIDELGFHYKTLPVYRDQTSVAEAMRTQQFGQELEADIQLPAVQDGVLVHGLFMDASRWDDEDMVMEDALAAQMNPPLPVLHFEPCQNYQ-PDPSLYHAPLYKTSARAGTLSTTGHSTNFVVTVFIPSKRDSDYWISKGAALL 4106          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006497.1 (pep scaffold:Pmarinus_7.0:GL476875:373:73185:-1 gene:ENSPMAG00000005847.1 transcript:ENSPMAT00000006497.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1295.03 bits (3350), Expect = 0.000e+0
Identity = 802/2384 (33.64%), Postives = 1296/2384 (54.36%), Query Frame = 1
Query: 3523 IDKWLTKDPTVMDFYERIRDTIDRKEELLNQPVIRKIGFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDLSLIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSNHPIDQEEIEESDKLRQLFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYIL---GALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDL-TNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILG-SSDCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQEIMEFRSPVLIE----GRVEDWMTKIEMEMRRTNRVITKEAVFFYRESKVRV-QWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHF-EGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQAD---KIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLN---KKENKFENDTLAGLYKKYI-------PPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTREGMNQDTIEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYVH--NPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGH-C--QMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSENAKSDKDYAMTDPILFGDY-RNALE----------VAEVRLYEDMINYEAAKGLFQEIMEEYSEAV--SPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRN--EASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVF-------------KNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSE 10503
            + +++T DPT+ +F  ++      ++++ + P    +G +    + L   +    + WK  +  +L+  A  +   +    E     L+   CDLE+++A ++ +  ++   ++ ES I  V+E + +L   +        +  D L   + +L  +S  V   L  ++          +++F KDL +F   +  +GPG  G         L+    +   +  +    +  E+LF LP+T YPEL  +++E+  L ++Y LY+   ++ + + E LW +LDI+ ++  +  F  + RK+P+ +K      +L +K+  F +  PL   + ++A+  RHW+ +   TG  FDI  D F L ++    L  F+D I +I  SA+KE  I+  ++ V   W +  F+  P+    K RG +L       E + +++D+ M L S+ ++R+  PF  ++Q W + LS  +E+++ WM+VQ  W+YLE +F+GGDI  QLP+EAK+F  IDK+++KIM    + P I   C     L+ L  +L + LE CQKSL  YL+ KR  FPRFFF+SD  LL ILG +SD   +Q H++ +FDN++ + F +    ++   ++ S E E +    PV+ +    G VE W+  +   +R T   + ++A     +   ++ ++   +   V L   Q+ WT + E      K  +K       K L + ++E++      L+K +R K  T++ I VH +DI D  VR +I    +FEW  Q RFY++ E D+  IQ     F Y  EY+G   RLVITPLTDR Y+TL+QAL M +GGAPAGPAGTGKTETTKD+ K LG   VV NC + MDYR +G+I+ GL Q GAWGCFDEFNRIE+ VLSV + Q+  +      K ++F F +G  +++D   GIF+TMNPGYAGR ELPE++K QFR V ++VPD   I  + L S GF   ++L++K  TLY+L +EQLSKQ HYDFGLR + SVL   G ++R++P+  E  V+MR LRDMNL K + ED PLF+ LI DLFPG+   +  YP+  +++   LA+ K   L        KI+QLYET + RH  M +GP+G GK+  I +L  + T      + + MNPK  +  +++G LD  T DWTDG+ S ++R+  K   K E  ++L DG VDA+W+EN+NSV+DDNK LTLANG+RI +  +C ++FE  ++  ASPATVSR GMV++    L + P  Q WL     ++ +    T+  +++  I        P +D ++E M   QA+E LK ++P                +     +    ++ + + S+ WS+G  L  + + + + F+++       +  D P  A +      ++F+Y    + +   W  W   VP++ +  +   ++S ILVP +D VR  +L+   +K ++ VLL+GE GT+KT + + ++   D + ++  ++NFSS TT    QR +ES V+KR   +YGPP G+++ +FIDD+NMP ++++G Q    +++ ++E  G Y+  K   +  + D+ F+AAM  PGGGRND+  R    F +FN T PS +S+  I+ +   GH C  + F +E+      +   T  ++    V++ PTP+KFHYIFNLRDLSRI+QGM     +    SD    ++ HE  RVI DR     DK +    + + + ++  +    +M   + F D+ R+A E          +   ++YE + ++       Q  + +Y+E+V  + M LV F DA+ HL +I R IR   G+ALLVGVGGSGKQSLT+LA++      F+I LSR Y+  +L E+LK LY K G + K   F+F D  + +E FLE +NN+L+SG V  LF  DE + I  ++    +       P+ E+++ YF+++  +NLH+VLC SPVGE  R R   FP +++  T+DWF  WP  AL AVA  F+         + +  +V    +    V E   E+ ++FRR  YVTPK+YL FI  Y  +  +K        +R++ GL KL EA   +++L+ +L +++  +   +   + +L E+TS+ Q A   KQ  Q+     +    EI  +K  AE  L  A P LE+A  AL  ++  D+  +R  +KPP  +  + +C+ +              +     +W  A+ +M    FL SL T   D I  +  +++   ++     ++  R+V     GL  +  A++ +  + +E+ P +  +   E      + EL++ + ++D+ + EL  +   Y+ A+ E+Q L ++ +  +R++N A  LI+GL  E
Sbjct: 1126 VKEFMTTDPTMSEFNAQMVYYAQLEQQVQDLPAHFAVGPVLAMTEPLKLALVQECRTWKRAFGAALNRKASASTDEVLAFSEAMAKHLARPICDLEDVRAAMAALAELRAAEIQMESAIGPVEEAFAMLAKYDLTFRDSSADRVDGLAYCWKNLMTQSVQVQNTLVILQPTMKADLLTGVAEFHKDLSSFQLDYDTQGPGEAGIAPQEASDRLQMCQMQFDDLWRKFTTYSGGEELFGLPVTDYPELQRIRRELALLQKLYGLYNTVIESVDGYYEILWSDLDIEKINNELLDFQNKCRKLPKALKEWQAFEDLKKKIDNFNETCPLLEMMANKAMMSRHWERITNVTGHTFDIESDHFALKNIMEAPLLTFKDDIEDICISATKERDIDAKLKAVVSEWSSQCFTFAPF----KSRGELLLKGSDTAEKVALMEDSLMVLASLMSNRYNVPFKPTIQQWVQKLSNTTEIIENWMMVQNLWIYLEAVFVGGDIAKQLPQEAKRFQNIDKSWQKIMQRAHEIPGIVVCCVGDETLAQLLPHLLEQLEMCQKSLTGYLEKKRLVFPRFFFVSDPALLEILGQASDPHTIQAHLLGLFDNVNQVGFHEKNYEQI--LSIESQEGESVTLVEPVMAQRGWQGNVETWLGSLLTGVRSTVHAVIRQAAAIIEDGAFKLHEFQTSFPAQVGLLA-QMIWTRDSEVALNNAKNDRKIMPATNQKFL-DLLNELIDMTTRDLTKRERVKYETLITIHVHQKDIFDDLVRMNIKSTADFEWLKQSRFYFVEETDKCLIQITDVDFHYCNEYLGCTDRLVITPLTDRCYITLSQALGMSMGGAPAGPAGTGKTETTKDMGKCLGKYVVVFNCSDQMDYRGLGRIYKGLAQSGAWGCFDEFNRIELPVLSVAAQQIYIVLQCKKNKRTQFVFTDGDIVEMDREFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRAIIMRVKLASAGFRDNQILSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAVKRSNPEEPEKTVVMRVLRDMNLSKLVDEDEPLFMSLINDLFPGITLDKAGYPELEEAI---LAQTKAAGLVHHPPWVLKIIQLYETQRVRHGMMALGPSGAGKTCCIHMLMKAMTDCGEPHREMRMNPKAITAPQMFGTLDVATNDWTDGIFSTLWRKTLK-AKKGEHIWILLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWRPIVQAWLQGLPTEQAQVLWSTMDSVFQDLINFVFTAVNPKMD-ILECMYIKQAIELLKGLLP----------------EADERRLEHSHLQRLLVFSLMWSVGALLELEDRARMEAFLRA-----HPSHLDLPGSAND-----DSIFEYV---VGDSGGWEHWNTRVPEFAYPRDTVPEYSAILVPNVDNVRTDFLMQCIMKQEKAVLLIGEQGTAKTVMIKGYMNKYDAELHLTKSLNFSSATTPNMFQRTVESYVDKRMGTTYGPPAGRKMTIFIDDINMPIINEWGDQITNEIVRQLMENNGFYNLEKPGEFTTIVDVQFVAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNASIDKIFRTFAEGHFCPERGFPEEVNQLAVALVPTTRRLWQATKVKMLPTPAKFHYIFNLRDLSRIWQGMLIMNSEVCRSSDMLLALFGHECVRVIADRFTAQQDKDWFNGTMSKIMLDDHGTAAAASMEAEVYFVDFMRDAPEPTGEEPDDADLEAPKVYEPIPSFPQLAERLQAFLVQYNESVRGANMDLVFFADAMVHLIKISRIIRTPRGNALLVGVGGSGKQSLTRLASFIAGYSSFQITLSRTYNMSNLMEDLKQLYRKTGQQGKGVTFIFTDNEIKDEAFLEYMNNVLASGEVSNLFARDEIDEITQELIPVLKKEHPRRPPTNENLYDYFLSRVRANLHVVLCFSPVGEKFRARALKFPALISGCTMDWFQSWPRDALTAVAGHFLAEYRVECTPEVKRGVVDAMAVFQDMVAERCVEYFERFRRQTYVTPKSYLSFIGGYKSIYSEKLSNVALLSERMRTGLSKLQEAEKSVSQLSRELEVKEKELAVASRRADEVLCEVTSKAQAAESVKQQVQKVKDKAQAIVDEIAADKAVAEKKLEAAKPALEEAEAALQTIKPADIGTVRKLSKPPHLIMRIMDCVLLLFRRRVDTVVPEPERPCMRPSWSEAQKLMNFAGFLNSLLTFSKDTINEEMVDLLMPYMEMEDYNLETARNVCGNVAGLCSWTKAMVTFFGINKEVLPLKANLIIQESRLAVAQGELDRAQAQLDEKQRELDAVQAMYDTAVREKQILVDDAEACRRKMNNATALIDGLGGE 3467          

HSP 2 Score: 123.635 bits (309), Expect = 1.040e-27
Identity = 132/597 (22.11%), Postives = 271/597 (45.39%), Query Frame = 1
Query: 1024 NLSDKEIMEMIESTVLKWDQQITGTLESLQKIVPHGPS--PLAEIDFWRERNAXXXXXXXXXXXPKVKRILNLYSLAEGPV---FDTQNNELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIAWNLSDRVARLIDVN--TIFNLPLEHVLKDTAEAEKMLRVWNDTYFEVRASIEASGRDARWEFDRKRLFEKTNYMADICHDLNEIAMILQEFYNIFGPELKSVTNEAKRIXXXXXXXXXXXXPLKEMPFNPFNLMKHKYDWSNFMEDFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEVESIDQLFKTNMNNPPLYHFKSCVAGGISWERHLFYNIKRPILRFLTMDEMMQSDNGKRIRTKYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILALANSENFVSENVPEETIDKMDDDLRVDFGFEINEIITETRNLELLGYKVPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISDYIEKCNLAL 2793
             + + E++E +E+ +  W +QI   L   ++I     +  P AE+ +W++R +  ++LLE+LK  +V+++  L   A       +   ++ + +   EAKDN K+L  +E+ F  +A   + +++   I  +M  +RM+  ISR+YN  E M  L  ++   +       +      I++   +++L+  +E  ++   +   + E +  +  S    ++EF    +F K +     C  L +++ +LQ   ++ G  L+ V  E   I+++  + + L    K   ++  +  K ++D     ++F  +   +      F+++ F      E   ++L +F+ I   +   +LM +K+  ++ +Y ++++ + + ++    NPP+      V+G I W R LF  I  P+       +++Q+  GK     Y  +   +  FE      W   VD V + LL   ++     + F                  V+F   I E++ E ++L  LG++VPE   N+  +++        LL  +  Y   + S+  I   ++T  +  V+  I PGL  ++W SL I  YIE+   A+
Sbjct:  229 TVGNTEMVERLEAALRVWMKQIEQVLVESEQIRKEADNVGPSAELVYWKKRTSRFNSLLEELKSERVQKVTGLLQAARSRSLKHWKELDSRITEEASEAKDNVKYLYSLEKFFGPLA-KYSPVSIKSGIEGLMSNIRMVHTISRYYNSSEHMTSLFVKVTNQMIATCKAYLHQGGGKIWDHDWDNLLQRMSECIRLNEEYQHCFHETKQHLRQSNNPRQFEFSENYIFGKFD---SFCMRLRKLSDMLQTMQSLAG--LQHVRIEG--IDKIFLRYQALATNTKAKTYDVLDHRKSEFDID--YKEFCSQTEGLYQSLQTFVDSWFGDALKTEKMLELLGKFERIAGGRL--QLM-EKYQLVLHRYARDMDMVRRTYQKQKQNPPIPRNIPPVSGKIMWARQLFRKIDIPMKFLNNKRDVLQTSEGKITVRNYNKMAAVLLEFELLYHRAWSRAVDLVRNSLLSSLLVRYPKKKEFF-----------------VNFDLAIFELLMEAKHLHKLGFQVPEAVINLCQKEQQIKHHHTRLLEALQEYTQAVSSIPPILQPLMTPCVALVEDAILPGLTIISWTSLNIDTYIEEIQAAV 795          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001140.1 (pep scaffold:Pmarinus_7.0:GL478666:370:47701:-1 gene:ENSPMAG00000001005.1 transcript:ENSPMAT00000001140.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1285.01 bits (3324), Expect = 0.000e+0
Identity = 831/2369 (35.08%), Postives = 1289/2369 (54.41%), Query Frame = 1
Query: 3817 KALLSTIQTIQLLSLEFESRITDVQERYRVLTLSNHPIDQEEIEESDKLRQLFDSLTFESKNVNY---------RLTPVKTKFTDITKEEISDFGKDLKNFADKFKE---------EGPGSIGRDLDVGLVVLKK--FHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKE----FKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSS-DCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQEI---MEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKIL-------CASQTKLQLHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEK-LKTIIPLTNLNLVTQLCNMLDCQL------TREGMNQDT-----IEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDK----------PAKAGELPSRFP---TLFDYYFDSIEEKQEWIPWANLVPQYVHNP-EKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTA-VSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQ---MFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKT----FVQKAIEEQLSEN------AKSDKDYAMTD----PILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSE-AVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQV----RNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYK--------------EINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDS-LDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRK 10626
            KAL + I T  L+ L+   +  +VQE  ++    N        E  D L  L D  +     + +         R+  + T+   I  E+   + + LK    +F+E         E   ++G   DV   + K    H +L       +  NA E+ F  P + YP+   +Q  +    ++YE+        + W E    +++  V+++ +  + +   K+ R ++A   A  + ++LK     F+  LP+   L +  LR RHW  L    G    +  +   L     M L  F     +I  +ASKE S+EK + ++   W  ++F++  Y   G     IL A+D++  +LDD+ +  Q+M  S FI PF   ++ WE+ L L+ E+LD W+ VQ  W+YLE IF   DI +Q+PEE ++F  +DKT++ ++ +T     +     +   L  L   ++ LE   K LNDYL+ KR  FPRFFF+S+DELL IL  + D   VQ H+ K F+ IS + FT+     +  T M SSE E+   +E  S     G+VE W+ ++E  M R+   +  EA+  Y  S  R +W+  + G   LC +Q +WT EV +  R    G +  L+ Y    + QIDE+V  VR  LS+  R  L  ++++DVHARD++ + ++  I    +F+W SQLR+YW  E   +Q +       YGYEY+G   RLVITPLTDR Y TL  AL+++LGGAP GPAGTGKTETTKDLAKA+   CVV NC +G+DY ++GK F GL  CGAW CFDEFNRI++ VLSV++ Q+ TIQ G+        FEG E+KL+    +FITMNPGYAGR+ELP+++KA FR V ++VPD   I EIML+S GF+SA+ L+ K+   YRL  EQLS Q+HYD+G+RA+KSVL  AG L+   P  +ED +++R++ D+NLPKF+  D PLF G+  DLFPG+  P+  Y    ++++E   +    +    A+KI+Q+YE M  RH  M+VG   GGK+   ++L       C      +   ++  +NPK  ++ +LYG  D  + +W+DG+L+  +R     T  + R++++FDG VDA+W+ENMN+V+DDNK L L +GE I+L +   L+FE  DL+ ASPATVSRCGM+Y++P  LG+ P    WLN +        L+  +K  I    +R++   +  Q V K  K + P ++ NLV  L N++DCQ+      T+     D      IE IF+ S+ WS+G       QV FDQ ++ L + P S +  K          PA+   +P  FP   ++++Y F   E K  W  W   +      P +  F++I+VPT+DT+R T L+   +  Q+PVL VG TGT K+  ++   L++ D + Y  L INFS++TT+   Q  +   +++R K  YGP  GKR+++F+DD+NMP  ++YG Q P+ +L+  L+    YD  KD +  K++++  L AMG PGGGRN V  RF+  F+          S+F+I+S I+  H      F  +       + + TM +Y      L PTP+K HY+FNLRD SR+ QG+C +  +    +    R+W HE  RV  DRL++D D+T    F++K I   + E+        S+ D  + D     ++F D+ ++ +  + + Y ++ + E  + + +  +EE++  +  PM LVLF  A++H+ RI R ++    HALLVGVGGSG+QSLT+LAA+   C++F++ +S+GY+  + RE+LK +  +     ++ VF+F D  + +E FLE INN+L+SG +P LF  DE++ I  ++    R          S  ++   FV++C   LH+VL MSP+G+  R R R FP +VN  TIDWF  WP  AL AVA+ ++  E+  + ++     +    + H S    S++F  + +R NYVTP +YL+ I+T+  LLE K         R + GL+KL  A+ Q+A +  +LA  +  + E  I   N +  I   ++  +  +++ +        Q+   +  K E +A L EALP+L  A  ALD L + D+  +++   PP  V++V E I++ K  K              E  W  AK ++ D  FLQSL   D DNI +     +R   +  L+   D++R+ S A  GL K+V A+  Y  VA+ + PK+ K+ + E         L + +  + +++ +L  L Q  E    ++  L+ + D+  ++L+ A++LI GL  E  RW+   +LL  +   L GD LV S  ++Y+GAF   FR+
Sbjct:  475 KALSTPINTKALMELKEYIQKVEVQEMSQLQVKLN--------EAKDHLLFLLDHASLSPSEMRHNNTAFQWCGRMPGIFTEHRRILTEKTEQYQESLKFRRRRFEEDLEAYAKQAEEFSTLGDLADVNKYLKKAQVLHTKLEAATEMIESFNAEEEAFAWPTSQYPQKKKIQDVLMPYLRLYEMAVEFTSKHKAWMEGPLADVNPDVVEQDVGNYWRGLYKLERSLQASPQALLIQQQLKSNVEAFRTHLPMAQVLCNPGLRGRHWDALSEVVGFPL-LTQEQVCLEKFLEMNLESFLSKFNDISDTASKEYSLEKALEKMVREWDEMQFTLIVYRDSGTS---ILSAVDDIQMLLDDHIVKTQTMRGSPFIKPFESDMKEWERKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRRFTTVDKTWRDLIKQTLTDTHVLAVVSIDKMLERLQKSTELLELILKGLNDYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGISRVEFTEA----LDITHMKSSEGEVVQLIETISTSKARGQVEKWLLELEAVMIRSVHNVIGEAMEAY-PSTPRAEWVRAWPGQTVLCVSQAFWTSEVHEAIR----GGQQVLERYLAQCNGQIDEVVGLVRGQLSQQSRVTLGALVVLDVHARDVLVALLKGGIAHDSDFQWLSQLRYYW--EDGHLQTRMINAGLPYGYEYLGNTPRLVITPLTDRCYRTLFGALNLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINTGSDTLMFEGTELKLNPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIMLYSFGFVSARPLSVKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPSENEDILMLRSIVDVNLPKFLAHDLPLFEGITSDLFPGVKLPKPDYVVLLEAIKENCEKMNLQMTDFFAEKILQIYEMMIVRHGFMIVGEPFGGKTCAYRVLAAALGDICEKALMAENKVQITVLNPKAITMGQLYGQFDAISHEWSDGVLAVSYRAFATSTSPD-RKWLVFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQLASTTNLIFEPMDLEVASPATVSRCGMIYMEPHILGWRPLLTSWLNARP-----PPLSAPHKALICALFERLVPCCL--QFVRKSTKELSPTSDTNLVCSLMNLMDCQMDDFHDETKIKAMDDRDVSAWIEGIFLFSLVWSVGASCSTHGQVLFDQLLRELMSGPLSADTSKRFHLSENVEPPAEPFSVP--FPAAGSVYEYRFIQ-EGKGRWELWTEALSLAPPIPRDMNFNDIIVPTLDTIRFTALMEMLVTHQKPVLFVGPTGTGKSVYITNFLLKHLDKNTYKPLTINFSAQTTAAQTQNIIMGKLDRRRKGVYGPAQGKRMVLFVDDVNMPAREEYGAQPPVELLRQWLDHSNWYDL-KDCSMIKLENVQILGAMGPPGGGRNAVTARFLRHFNTVTINEFDDKSMFTIFSRIMGWHFTARFAFPTDFSVLTEQLVQSTMEVYKAATQNLLPTPTKSHYLFNLRDFSRVIQGVCLSLPETCPVAASIQRLWVHEVLRVFYDRLVDDADRTWLVAFIRKTIHTYMKEDFTQLFQHDSNGDGQVEDDDLRSLMFCDFSDSKD--DAKRYVEVSDVERLRLVVEGHLEEFNNLSKKPMNLVLFRFAIEHVCRISRILKQPRSHALLVGVGGSGRQSLTRLAAHMADCELFQVEISKGYATNEWREDLKRILRRSTDGEQNGVFLFTDTQIKQESFLEDINNLLNSGEIPNLFAPDEKQEICEKMRQIDRQRDKDKQTDGSPLALLNMFVDRCRDQLHVVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQSWPGDALQAVATRYL--EDVEVSEETLASCIDMCKLFHTSTIALSQKFQAEQQRYNYVTPTSYLELISTFKDLLEKKRLEVMRMKRRYEVGLEKLESATSQVAGMQAELAALQPQLLEAGIQVVNTMAVIERESEEVSRTERVVKADEAVANEQAMAAKVIKDECDADLAEALPILRSALAALDTLTQQDITVVKTMKSPPAGVKLVMEAISILKGVKPDRVPDPSGSGRMVEDLWGPAKRLLGDMKFLQSLHDFDKDNIPVAIMKTIRAKYITNLEFDPDKIRNASTAAEGLCKWVIAMESYDKVAKVVAPKKVKLNQAEAELAVAMGSLRRKQEALREVQDKLAGLQQTLEANKQKKADLENQVDMCTKKLDRAEQLIGGLGGERSRWMEAARLLGIRYNDLTGDTLVSSGIVAYLGAFISSFRQ 2804          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001372.1 (pep scaffold:Pmarinus_7.0:GL479430:457:33677:-1 gene:ENSPMAG00000001214.1 transcript:ENSPMAT00000001372.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1107.05 bits (2862), Expect = 0.000e+0
Identity = 699/2063 (33.88%), Postives = 1123/2063 (54.44%), Query Frame = 1
Query: 4654 EIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALD---EVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDL-TNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILG-SSDCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVFFYRESKVR-VQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHF-EGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLD--CQLTREGMNQDTIEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYV----HNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGH---CQMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSENAKSDK-----------------DYAMTDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEAV--SPMKLVLFDDALDHLTRI-------HRTIRMDGGHAL----LVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRN--EASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVF-------------KNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDV 10659
            +I  SA KE  IE  +++V   W    F+   +    K RG +L   D   E++  ++D+ M L S+ ++R+  PF   +Q W  NLS  +++++ WM VQ  W+YLE +F+GGDI  QLP+EAK+F  IDK++ KIMT   +   + Q C     +  L  +L + LE CQKSL  YL+ KR  FPRFFF+SD  LL ILG +SD   +Q H++ +FDNI ++ F +     +   A+ S E E ++   PV+ +G VE W+  +  E +++   + + A    ++S    ++++  Y   V L   Q+ WT + E+     +  +K A+    +     ++ ++      LS  +R K  T++ I VH RDI D   R  I    +FEW  Q RFY+  + D++ +      F Y  E++G   RLVITPLTDR Y+TL QAL M +GGAPAGPAGTGKTETTKD+ + LG   VV NC + MD+R +G+IF GL Q G+WGCFDEFNRI++ VLSV + Q+  +      + S+F F +G  ++++   GIF+TMNPGYAGR ELPE++K  FR V ++VPD Q I  + L S GFL   VLA+K  TLY+L +EQLSKQ ++ +G+  +   L     + +     +     +R+ R +++ K I ED PLFL LI DLFPG+   +  YP    ++   + +   ++ +    K++QLYET   RH  M +GP+G GK+  I  L  + T+     + + MNPK  +  +++G LD  T DWTDG+ S ++R+  +   K E  +++ DG VDA+W+EN+NSV+DDNK LTLANG+RI +  +C ++FE  ++  ASPATVSR GMV++    L ++P  + WL ++  + E +TL  LY K            +     ++ L+  + + +LN++  L    D   ++T E + +     +++ ++ WS+   L  D + + + +++S     +S   D PA +   P    ++FDY    +    +W+ W++ V +Y     H PE  ++ ILVP +D VR  +L+    K  + VLL+GE GT+KT + + +L   DP+ ++   +NFSS TT L  QR +ES V+K+   +YGPP GK+L VFIDD+NMP ++++G Q    +++ ++E+RG Y+  K   +  + D+ F+AAM  PGGGRND+  R     S+FN T PS +S+  I+  I +GH    + F++ ++     +   T  ++    +++ PTP+KFHY+FNLRDLSRI+QG+  TT D  +  +   R+++HE  RVI DR    +D  +     EE+L+  A  +                  D+    P   GD     +    ++YE + +Y+  +      +++Y+E+V  + M LV F DA+ HL +        + T+    GH+L    + GV     Q +            F++  S  YS  +L E+LK LY   G + K   F+F D  + +E FLE +NN+LSSG V  LF  DE + I+S++    +       P++E++ ++F+ +   NLH+VLC SPVGE  RTR   FP +++  T+DWF  WP+ AL AV+  F+         + + E+V         V E   ++ Q+FRR  +VTPK+YL F+  Y  + ++K    ++  +R+Q GLQKL EAS  +A L+ +L +++  +       + +LKE+T + Q A + K   Q+  +  E     I  +K  AE  LV A P LE+A  AL  ++++D+  +R+  +PP  +  + +C+ +              +     +W+ +  +M   +FL SL+    D IT +   ++    D     ID  R V     GL  +  A+  +  + +E+ P +  +   +        +L+  + E+D  ++EL  +   YE A+ E+Q L ++ +  +R++  A  LI+GL+ E +RW    +    Q  RL+GD L+ +AFLSY G F+ EFR  ++   W+ ++
Sbjct:    2 DICISAVKERDIEFKLKQVVAEWDGKTFTFGNF----KTRGELLLRGDNTTEIIATMEDSLMVLGSLMSNRYNAPFKSQIQKWVSNLSNTTDIIENWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMNNVVQCCVGDETMGQLLPHLLEQLELCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKTVEFHEKVYDRI--LAVCSREGETVQLDKPVMADGNVEVWLNALLKESQQSLHGVIRSAALAVQDSAFSLIEFLDSYPAQVGLLGIQLLWTRDSEEALANARYNRK-AMPQTNQAFLVLLNRLISMTTQDLSAVERIKYETLITIHVHQRDIFDDLCRMHIKSPTDFEWLKQCRFYFKEDVDKLIVWITDVSFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERRSQFTFTDGDLVEMNPEFGIFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFLDNIVLARKFYTLYKLCEEQLSKQVYWVYGILEVMYSLKTCKAMGKAHTSSTAQLFCIRSYRRVSMMKVIDEDEPLFLSLIDDLFPGIALDKAGYPQLEAAINRQVEQAGLVIHAPWKLKVIQLYETQCVRHGMMALGPSGAGKTTCIHTLMRAMTECGSPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTTR-AKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWSPILEGWLKQRSPQ-ERETLRSLYAKSFLELYRYAAHSL--SFKMDTLEAFVIVQSLNMLQGLIPSKDHGGEVTPEHLGR-----LYVFALMWSVCAYLELDDRRRMELWLRS----HESMRLDLPAVS---PHGEDSMFDYM---VGADGQWVHWSSRVEEYAYPGDHTPE--YNSILVPNVDNVRTDFLIHNIAKQGKSVLLMGEQGTAKTVMLKGYLSKYDPETHLAKNLNFSSATTPLMFQRTIESYVDKKMGTTYGPPAGKKLTVFIDDINMPIINEWGDQVTNEIVRQLMEQRGFYNLEKPGEFTNIVDVQFVAAMIHPGGGRNDIPQRLKRQLSIFNCTLPSNASIDKIFGVIGTGHYSAARGFTEGVRALAAQLVPATRRLWQLTKIKMLPTPAKFHYVFNLRDLSRIWQGLLNTTADVVSSPELLLRLFKHECERVIADRFTCAEDTDW----FEERLAAVASEELGAAAGEALAVGERAFFVDFLRDAPEATGDEPEDADFDMPKIYEPIASYDELRDRLNFFLQQYNESVRGARMDLVFFTDAMLHLVKFIPVLGVTNLTLMTFDGHSLQDWAVPGVVRHDAQHIQ-----------FDLTFSTSYSTSNLLEDLKVLYRVAGQQGKGITFLFTDNEIKDEAFLEYMNNVLSSGEVSNLFARDEMDEILSELAPVMKKQHPRRPPTQENLHEFFMTRVRLNLHVVLCFSPVGERFRTRALRFPALISGCTMDWFSRWPKDALVAVSEHFLSSYTMDCTVEVKQEVVACMGSFQDGVAEKCTDYFQRFRRSTHVTPKSYLSFVQGYKTVYKEKHTEVQTLANRMQMGLQKLKEASESVAGLSVELEMKEKELQVANEKADKVLKEVTVKAQAAEKVKMEVQKVKETAERIVDSISVDKAVAEKKLVAAKPALEEAEAALQTIKQSDIATVRTLGRPPHLIMRIMDCVLLLFQRRVNPVRMDPERGCVTPSWQESLKLMTAGNFLGSLKQFPKDTITEEMVELLHPYFDMPDYNIDTARKVCGNVAGLCSWTKAMAYFFGINKEVLPLKSNLVVQQGRLNIAMGDLQSAQAELDAKQAELDLVQAGYEKALREKQELMDDAERCRRKMQTASGLISGLAGEKERWTNMSKEFAAQIKRLVGDVLMATAFLSYAGPFNQEFRN-LLLGEWQREL 2020          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Yeast
Match: DYN1 (Cytoplasmic heavy chain dynein; microtubule motor protein; member of the AAA+ protein family, required for anaphase spindle elongation; involved in spindle assembly, chromosome movement, and spindle orientation during cell division, targeted to microtubule tips by Pac1p; motility along microtubules inhibited by She1p [Source:SGD;Acc:S000001762])

HSP 1 Score: 737.258 bits (1902), Expect = 0.000e+0
Identity = 668/2601 (25.68%), Postives = 1224/2601 (47.06%), Query Frame = 1
Query: 4147 GLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTG----QNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGG-DIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSS-DCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQEIMEFRSPVLIEGRVE--DWMTKIEMEMRRTNRVITKEAVFFYRESKVRVQWMFDYQGMVA-------LCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYW----LREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSE----DKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECL---AEHKYIVLSDQ-ADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLI-PMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREIN---KPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNK-------KENKFENDTLAGLYKKYIPP-------TIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQ----LCNMLDCQLTREGMNQDTIEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLF----DYYFDSIEEKQEWIPWANLVPQYVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNL--ESNVEKRTKDSYGPPMG--KRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGG-GRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSD--QFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSENAKSDKDYAMTDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAG-MGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVA-----------SVFIGPE-NSLIPDDQRIEIVKHFV---MVHLSVEEYSKEFMQKFRRG-NYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVR-----DSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQN-GILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMV--INYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFK-FSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLL 11691
             L +L+ F++ +T ++ +   + AA ++  +P+    +L +V +E+K  D ++       +  +   ET W  +D+ +L   +  FL+   ++PR VK     ++L  ++        +  +LK  AL+ RHW  +    G    Q   ++   F+L  V  + L   + ++ +I+  A KE  IEK +  +++ W   ++ V  +  G K    ++   D + Q   ++   L SM AS +   F     + E  L+ +SE+   W+ VQ  W+ L GI     DI++ LP E  KF ++   +K I T   +     +   +PN  + L    D L+  + SL+ +L+ +R  FPRF+F+ +D+LL I+GS    + V + M KMF +I S+ F     LE   T + S E E++     + ++  ++  +W+  ++ E++ +  V T+     +R+   +++   D + +V+       L + Q+ WT  VE         Q      Y K +  +I  ++  +    S N + K+  +L+  +H  +++      S  +     W    +FY     L + + + I Q      Y +EY+G+  RL+ TPL    + TLT +L    GG   GPAGTGKTET K   + LG + VV NC +  DY+ + ++  G+ Q GAWGCFDEFNR++  VLS +S  ++ IQNGL +  S      +E  L     +FIT+NPGY GR+ELPE++K  FR   +  P    I E++L   GF  +K LA K+     L   + S  NHY FGLR LK      G LR   P +SE    +K ++ +L+ + LP     D  +F   +  +F     P       + ++ +CL    +     +S++   K +Q Y   KT+   ++VG  G GK+   K +  +      H  ++  ++ K  +   LYG +   T +W DGL ++I R +N     T KN R +++FD D+D  +VE MNSV+DDNK+LTL NGER+ +  +  +LFE  +L + +PAT++RCG+++        +      LNK       K + FE D L  L              T    +  ++  +   KL+T + L  ++L++       N+ D  L      +D I  +  +S+ ++L G    +SQ  F Q I +          D           + T+        F S   +   IP  +L    V  P     +I++PTIDT++   +  + +  +R ++L G  G+ KT +    LRN+    Y  + INFS  TT+  I   L   +N    +K     P    K L++F D++N+P++D+YG+Q  +  L+ ++E++G +   ++  W  ++ I  + A   P   GR  +  RF    ++    +PS  SL  IY        ++  +    T P   + ++ +YN+   +   T  + HY+F+ R+L+R+ +G+  T ++   +       R+W +E  R+  DRL+   +K   ++ + E + +   +     ++   L      +L+  EV    D++N+       +E  + + +    + +V+ +  +DH+ RI R ++   GH +L+G   +GK  LT+  A+     I +  + R  +  D    LK   +   ++   T  +  + +++E  FLE +N +L++  +P LF  +E + +++ +RN+  S G +  +++ ++ +FV + A NLH+V  +        +   + P + N   I+W   W  + +  VA           + FI PE N  +   + I+ ++  V   ++H     + + F QK + G N  +P  ++D +   +KL+  K +  +     +  GL+KL E+ +++ ELN  L+ +   +TEK     + L ++      +  K++  +E  + ++VQ ++I K K     ++ +  P + +A+  + +++K  + EIRS   PP  V++V E +     Y+  NW+  +  +    F+ ++   D    TL     +R     + L     T + +   SKA   L ++V A + ++ V   + P R+++ R+E    + K  L   +     LE+ ++   ++Y L I + + ++ E   +Q  L+ +  L+  L+ E +RWL   +        L+G+C++ S + +Y G  +   R +M+    K  + +  +     +R  D L    E  KW   GL  ++  ++N  I+       P  +DP    +  ++     N     +F +  F+K+LE AI++G   + +D  E+ DP+I  ++ +       R  V +GD EVD   +F+L++++   +P     IF +S V  +++    + +E ++  + +  E  E++ +RE LI+  ++ K  LK+LE  LL EL  S GNML+N EL+ TL   K +A  + +KL        + D   + Y    K    +F +L +    +  Y  S+  +L  FK   +KKS      + R+  ++  L + VY    T + +K K++
Sbjct: 1183 ALKILEFFNESITKLKKKMHSVAAAAKMLLIPVVLNDQLTHVVEEVKTYDLVWRSIKNLWEDVQRTFETPWCRVDVLLLQSDLANFLRRADELPRAVKQFEMYKSLFSQVNMLTSVNKILVELKDGALKPRHWNMIFRDIGKRQIQKNLLDKLEFSLKDVMVLNLTLNEILLTKIIERAQKEFVIEKSLNRIKKFWKEAQYEVIEHSSGLK----LVREWDVLEQACKEDLEELVSMKASNYYKIFEQDCLDLESKLTKLSEIQVNWVEVQFYWLDLYGILGENLDIQNFLPLETSKFKSLTSEYKMITTRAFQLDTTIEVIHIPNFDTTLKLTIDSLKMIKSSLSTFLERQRRQFPRFYFLGNDDLLKIIGSGKHHDQVSKFMKKMFGSIESIIF-----LEDFITGVRSVEGEVLNLNEKIELKDSIQAQEWLNILDTEIKLS--VFTQ-----FRDCLGQLKDGTDIEVVVSKYIFQAILLSAQVMWTELVEKCL------QTNQFSKYWKEVDMKIKGLLDKLNKS-SDNVKKKIEALLVEYLHFNNVIGQLKNCSTKEEARLLWAKVQKFYQKNDTLDDLNSVFISQSGYLLQYKFEYIGIPERLIYTPLLLIGFATLTDSLHQKYGGCFFGPAGTGKTETVKAFGQNLGRVVVVFNCDDSFDYQVLSRLLVGITQIGAWGCFDEFNRLDEKVLSAVSANIQQIQNGLQVGKSHITLLEEETPLSPHTAVFITLNPGYNGRSELPENLKKSFREFSMKSPQSGTIAEMILQIMGFEDSKSLASKIVHFLELLSSKCSSMNHYHFGLRTLK------GVLRNCSPLISEFGEGEKTVVESLKRVILPSLGDTDELVFKDELSKIFDSAGTPLN-----SKAIVQCLKDAGQRSGFSMSEEFLKKCMQFYYMQKTQQALILVGKAGCGKTATWKTVIDAMAIFDGHANVVYVIDTKVLTKESLYGSMLKATLEWRDGLFTSILRRVNDDITGTFKNSRIWVVFDSDLDPEYVEAMNSVLDDNKILTLPNGERLPIPPNFRILFETDNLDHTTPATITRCGLLWFSTDVCSISSKIDHLLNKSYEALDNKLSMFELDKLKDLISDSFDMASLTNIFTCSNDLVHILGVRTFNKLETAVQLA-VHLISSYRQWFQNLDDKSL------KDVITLLIKRSLLYALAGDSTGESQRAFIQTINTYFGHDSQELSD-----------YSTIVIANDKLSFSSFCSE---IPSVSLEAHEVMRP-----DIVIPTIDTIKHEKIFYDLLNSKRGIILCGPPGSGKTMIMNNALRNSSL--YDVVGINFSKDTTTEHILSALHRHTNYVTTSKGLTLLPKSDIKNLVLFCDEINLPKLDKYGSQNVVLFLRQLMEKQGFWKTPEN-KWVTIERIHIVGACNPPTDPGRIPMSERFTRHAAILYLGYPSGKSLSQIYEIYYKAIFKLVPEFRSYTEP-FARASVHLYNECKARY-STGLQSHYLFSPRELTRLVRGV-YTAINTGPRQTLRSLIRLWAYEAWRIFADRLVGVKEKNSFEQLLYETVDKYLPNQDLGNISSTSLLFSGLLSLDFKEVN-KTDLVNF------IEERFKTFCDEELEVPMVIHESMVDHILRIDRALKQVQGHMMLIGASRTGKTILTRFVAWLNGLKIVQPKIHRHSNLSDFDMILKKAISDCSLKESRTCLIIDESNILETAFLERMNTLLANADIPDLFQGEEYDKLLNNLRNKTRSLGLLLDTEQELYDWFVGEIAKNLHVVFTICDPTNNKSSAMISSPALFNRCIINWMGDWDTKTMSQVANNMVDVIPMEFTDFIVPEVNKELVFTEPIQTIRDAVVNILIH-----FDRNFYQKMKVGVNPRSPGYFIDGLRALVKLVTAKYQDLQENQRFVNVGLEKLNESVLKVNELNKTLSKKSTELTEKEKEARSTLDKMLMEQNESERKQEATEEIKKILKVQEEDIRKRKEVVMKSIQDIEPTILEAQRGVKNIKKQQLTEIRSMVNPPSGVKIVMEAVCAILGYQFSNWRDIQQFIRKDDFIHNIVHYDT---TLHMKPQIRKYMEEEFLSDPNFTYETINRASKACGPLYQWVNAQINFSKVLENVDPLRQEMKRIEFESLKTKANLLAAEEMTQDLEASIEVSKRKYSLLIRDVEAIKTEMSNVQANLDRSISLVKSLTFEKERWLNTTKQFSKTSQELIGNCIISSIYETYFGHLNERERADMLVI-LKRLLGKFAVKYDVNYRFIDYLVTLDEKMKWLECGLDKNDYFLENMSIVMNSQDAVPFLLDPSSHMIT-VISNYYGNKTVLLSFLEEGFVKRLENAIRFGSVVIIQD-GEFFDPIISRLISREFNHAGNRVTVEIGDHEVDVSGDFKLFIHS--CDPSGDIPIFLRSRVRLVHFVTNKESIETRIFDITLTEENAEMQRKREDLIKLNTEYKLKLKNLEKRLLEELNNSQGNMLENDELMVTLNNLKKEAMNIEKKLSESEEFFPQFDNLVEEYSIIGKHSVKIFSMLEKFGQFHWFYGISIGQFLSCFKRVFIKKSRETRAARTRVDEILWLLYQEVYCQFSTALDKKFKMI 3697          

HSP 2 Score: 70.0922 bits (170), Expect = 1.041e-11
Identity = 53/215 (24.65%), Postives = 104/215 (48.37%), Query Frame = 1
Query: 12193 KLAERSGFGTTKLKFISMGQGQEAN-AKLLLDAAIARGHWLILQNCHLLVKWLRE-LEKDLE--RLTKPHPDFRLWLTTEPT-EAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKA-ADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRIL 12819
            KL E +      LK I +G  +  N A+  +  +   G W++LQN  + + W++  L K +E  +  + H  F++++T   T +  P  +LQR+ + V E   G+   ++  +     +   +   + + +  F L++FHA++  R +    G++  Y FN+ DF    Q    YL+   A    + IPW  ++  I  ++YGG+  ++ D  ++
Sbjct: 3799 KLIELAKASKESLKIIPLGSIENLNYAQEEISKSKIEGGWILLQNIQMSLSWVKTYLHKHVEETKAAEEHEKFKMFMTCHLTGDKLPAPLLQRTDRFVYEDIPGILDTVKDLWGSQFFTGKISGVWSVYCT--FLLSWFHALITARTRLVPHGFSKKYYFNDCDF----QFASVYLENVLATNSTNNIPWAQVRDHIATIVYGGKIDEEKDLEVV 4007          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Nematostella
Match: EDO35852 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK91])

HSP 1 Score: 5411.27 bits (14036), Expect = 0.000e+0
Identity = 2712/4374 (62.00%), Postives = 3357/4374 (76.75%), Query Frame = 1
Query:  853 ESIDEKVHETRAAVQARDEFLISLKKFTSIVDQTIIQIASEVKLEIPDLDLFENDKENLSDKEIMEMIESTVLKWDQQITGTLESLQKIVPHGPSPLAEIDFWRERNAXXXXXXXXXXXPKVKRILNLYSLAEG---PVFDTQNNELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIAWNLSDRVARLIDVNTIFNLPLEHVLKDTAEAEKMLRVWNDTYFEVRASIEASGRDARWEFDRKRLFEKTNYMADICHDLNEIAMILQEFYNIFGPELKSVTNEAKRIXXXXXXXXXXXXPLKEMPFNPFNLMKHKYDWSNFMEDFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEVESIDQLFKTNMNNPPLYHFKSCVAGGISWERHLFYNIKRPILRFLTMDEMMQSDNGKRIRTKYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILALANSENFVSENVPEETIDKMDDDLRVDFGFEINEIITETRNLELLGYKVPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISDYIEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFKL---QSGNKFLKCKEFFEFMESERTSDFEHLGRKYSTIGPLITKLQGEIIGDRDVNPFEKFQPFYEFWEKRIFDRVYNMVLKNLQDYQNMLRDENFPTCLFEVDLMLAGTDVIGNPQTTEIYKLAIQDLRDAVEATRVFIRWKRNSCIETTGMKIDGQDELFYFTFYLDIGNSVEITYFCEQIANYYRNIIGKLRKYQDKWKKHKRVFIPNKQAQIDKWLTKDPTVMDFYERIRDTIDRKEELLNQPVIRKIGFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDLSLIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSNHPIDQEEIEESDKLRQLFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQL----TREGMNQDTIEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSENAKSDKDYAMTDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKRKKPYLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLTKPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIP-----QCDTGDD-QLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTGKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGEPNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMGVGLVVEADLATTEHPSHWVLQGVCLILNTD 13926
            ++  +   E+R+ V  RDEFL++++KF+S +++TI Q+  +++LE+PDL L ++  E   D EI+  +E T+  W+  I+  LE   K  P G  PLAEIDFWRERNA LSA+ EQLKLP VK+I+ + +         F+    ELNK++ EAKDN +FLS +ERHFK++A+G +F  V ++IP MM ALRM+WIISRHYN+DERMVPLMERIAW LS+RVA+ +++ TI   P   V + T+EA   LR W ++YF+VRA IE+SGRDARWEFDRKRLFE+T+YMA IC DL E+A +++EFYNIFGPELK+VT + KRIE+VL++V ELV+P++ + F+PF+L +H   W N M+ F R+V +IEN+A  FI+N F +LRSAEGAFDMLL F+HIRSR+AIN  M +KFNDI+ Q+ KE            N PP       VAG ISWER LFY IKR ILRF  M++M+ +++GK+   KYL+V R M+ +E+K++  WR  V+  L   L+KN+L   ++ +  +                VDF  E+ EIITET+ LE LG++VPELARNVALQ+E Y K V+GL  M+  YH+V  SL+  E ++L D IKE+KR ++PG +RLNWNSLGISDY+ +C  A+  FES V  I K   DI  +L+ I+  +LFK    ++       KE+F+F+E  R+ + E L RKY  IGPL+TK++G ++   +     K QP+Y FWE  +++ +  MV +NLQ +   L+ +  P  LF+++  L+  +++ +P   EIYKL +Q +RD VE T++F+RW   +CIET     +G+DE   F+F+ DI  S  I      ++   +N +G L KY ++WK+++ ++  +K   + K+  K+PT + + E+++   +   E+  QP+ R + F+ +NL  L + ++ + + W       L+ESAK NL ++K +IE   TDL   P  LE+LK +L  I  I+ +SL+ E R  D++ERYR L +    +   E E  + + QL+D L  ES+ V+Y L  VK KFT+IT++++S+F  D+  F + F  EGP SIG DLD G+ +LKKF +E    E  RQEL  AE+LF L IT YPEL  ++KE+K L+Q++ +Y+ QK+AR+ WA TLW NLD+ VL +GI+G++K+ +++PREVKA+     L EK+KEFK+++PLFSDLK+EALRERHWK+LM  TG  FD+NP+TFTL ++FAMEL+ F DVIA+I  SA+KEL IEKG+ EV +TW  +KF+V  Y+KG +ERG++LG +DE+LQILDDNAMNLQSMSASRF+GPFL +V  WEK+LS I EV++VWMVVQRKWMYLE IFIGGDIR+QLPEEA+KFD IDKTFKKIM +TAK P + +AC  PNRL  L  + +GLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGS D  CVQEHMIKMFDNI+SLRF +G++ E  ATAMISSE E M+FR  V  EGRVEDWMT +  EMRRTNR+ITKEA++ Y     R++WM  YQGMVAL  NQ+WWTWEVEDVFRK+KKG K  +K+YA+  H QID++V  VRS LSKNDR K  TVLII+VHARDI+DSFVRDSIMD++EFEWESQLRFYW +  DE+ I+QCTG+FGYGYEYMGLNGRLVITPLTDRIYLT+TQALSMYLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMD++S+GKIF+GL QCGAWGCFDEFNRI+VSVLSV+STQ+KT+QN L   L R  FEG EI LD+R+GIFITMNPGYAGRTELPESVKA FRPVV IVPDLQQICEIMLFS+GFL AKVLAKKMT LY+L+  QLSKQ+HYDFGLRALK+VLVMAGEL+R  P+LSED VLMRALRDMNLPKF+FED PLFLGLI DLFPGLDCPRVRYP+FND+VE  L ++KYI+L  QADK+VQ+YETM TRHTTM+VGPTGGGK+VVI  L  +QT+L +HTKL  MN K  +VIELYG LDP TRDWTDGLLSNIFREINKPTDKNER+Y++FDGDVDALWVENMNSVMDDNKLLTLANGERIRLQ HCALLFEV DL+YASPATVSRCGMVYVDPKNLGY P+WQ W N + N  E + L  L++KY+P ++D ++EG+++G+  +KLKTIIPLTNLN+V QL +MLD  L    +   +  D  EAIFI S+ WS G  L+ED ++ +DQ IK L  +P +  E      GELPS  PTL++YYFDS  +K  W+PW ++VP+YVHNP+ K++EILVPT+DTVR TWLL   + I RPVLLVGETGTSKTA +  +LR  D D  + L INFSSRTTS+++Q NLE+NVEKRTKD+YGPPMGKRLLVF+DDMNMPQVD+YGTQQPIA+LKL+LE+ G YDRGK+L WK ++DIGF+AAMGKPGGGRN+VDPRFISLFSVFN TFPS+ SL  IYSSIL+GH Q F   I++ V  IT  T+ +Y  II  LPPTPSKFHYIFNLRDLSR+YQG+C TT DRF    +F RVWR+E  RV  DRL N+ D+  V   I   + +N     D AM DP LFGDYRN L   + RLYED+++Y+A K +F+EI+EEY+   +PM LVLFDDAL+HLTRIHR IRMD GHALLVGVGGSGKQSLTKLAA++  C +FEI L+RGY E   RE+LK LYN LG+ENK  VF+F D HV +EGFLELINNML+SG+VPAL+PDDE+E II QVR+EA+ AG+ P++ESIWQYFVNKCA+NLHIVL MSPVG+ LRTRCRNFPG+                            N  IPD  R  +V H V VH +V  YS+ F+QK RR NY TPKNYLDFI+TY +LLE KDK+   QC RL+GGL KL  AS QLAELN+KLA+QK+AVTEK+ ACE LL EI   TQ A EKK++A  K + +  Q+K I  EK EAE AL  ALP LE+A+LAL DL+K+DV EIRSFAKPP+ VQ+VSECI   + YKEI+WK AK MM++ +FL+SL  MDVD IT  Q    RD L ++  T++EM+ VSKAG GL KFV AV+GY  VAREIKPKREKVARLE+ F  +KRELEK++ E+  LE EL+ L ++Y+ A+ E+  LQEE +IM+RRL AADKLI+GL SE  RW  DLQ LKDQ+VRLLGDCL+ +AFLSY+GAF+W+FR++M+  +W++DV++R+IP+S PF+++ +LTNDVE+SKW SEGLPPD+LSI+NGILTT+ASR+PLCIDPQQQALNWI +KEE NNLK  TFND DFLKQLELAIKYG P LFKDVDEYIDPVIDNVL+KNIKG+ GREFV+LGDKEVD+DP+FRLYLNTKLSNPKY P  F + MV+NYTVT+KGLEDQLLSVIV  ERKELEEQRERLIQETS+NKRLLKDLED+LLRELATS GNMLDN EL+ TLE+TK+KA EVSEKLKLGA+T+ +IDK RDGYR AAK GA+LFFVL+EMS +NSMYQYSL++YL+VF  SL+KSLPD  L KRL+N+M TLT NVY Y CTG+FE+HKLLF+FQ+T+K+    G L Q+ELDFF+KGN ++E + R+KPY W+ D  W+DV +L ++ P  F  L +DIER+E  W++W + + PE+   P  Y   L  FQ+L LLRCFR+DR+Y AIT +V  +MGE+YVTPP+L+FE I +QSTPFSP++FILSPGSDPASD++KLAERSGFG  KLKF++MGQGQE  A  LL+ AI+RG WL+LQNCHLLVKWLR LEK LER++KPHPDFRLWLTT+PT  FPIGILQRSLKVVTEPPNGLKLNLRSTY KI+   L +  H +F  LVF L FFHAVVQERRKYGKIGWNI YDFNESDFRVC+ +L TYL K+    D KIPW SLKYLIGEVMYGGR IDDFDRR+++TYMDEY GDF+FDTFQPFHFY ++   Y IP     + D G D  + YIE LPL NTP+VFGLH NAEIGYYT+AAK+MW  L+++QPQT       SR+E I + AS I+ KLP LFD+DR+RK    +I+PT VVLLQEL+RFN+L+ RM+ SL  L RAL GEVGMS+ELD+V++SL+NG IP IW++LAP TLKSL NW+ HF  R  QY++WV +GEP V+WLSGLHIP+SYLTALVQATCRK+GWPLD+STLYT+VT++  A EVTERAH GCFV GLYLEGA WD ++ CL RPKPK L++ LPV+KVIPIE+HRLK QNTF TPVY TSQRRNAMGVGLV EADLATTEH SHWVLQGVCL LN+D
Sbjct:    3 DATSQATEESRSKVILRDEFLMNIQKFSSNINRTIHQLEGDIRLEMPDLVLGDDITELSKDPEIVNTLEETLHNWEVTISSALEMQLKKTPQGSGPLAEIDFWRERNATLSAIAEQLKLPTVKKIVAVLTKVNSENLANFEYHRAELNKYYTEAKDNVRFLSTLERHFKNLAHGASFNIVLETIPSMMNALRMVWIISRHYNRDERMVPLMERIAWELSERVAKTVNIRTILKEPPYVVKQKTSEARDTLRTWKESYFDVRAKIESSGRDARWEFDRKRLFERTDYMASICEDLQEVAQVMEEFYNIFGPELKAVTGDPKRIEDVLKRVHELVKPIENVAFDPFSL-RHLASWRNVMDWFHREVNAIENEAKHFIDNSFKSLRSAEGAFDMLLNFRHIRSREAINSQMMKKFNDILVQFGKE------------NQPP-------VAGAISWERSLFYRIKRTILRFQEMEDMLNNEHGKQASKKYLSVARLMKEYEDKKYEAWREQVEANLLIYLKKNLLTKPSTSSATTHR-----------SYVVDFAPELAEIITETKYLEQLGFQVPELARNVALQEEKYLKYVDGLKLMLERYHTVTGSLDVAETQLLDDNIKELKRVLKPGSKRLNWNSLGISDYVTRCGQAIGKFESLVNQIQKNAKDIYSRLEMIEITELFKTPPPKTNGIMPDAKEYFDFLEKGRSQELEVLARKYRAIGPLLTKMEG-LVAHTNTGRAPKLQPYYAFWENAVYEALTKMVTRNLQVFNTKLQSK-LP--LFQIETALSAPEIVLSPPANEIYKLVMQSVRDMVEGTKLFVRWMNGTCIETPPQHAEGEDEPVVFSFFTDISASPAIIELVTTVSKSVQNTLGTLNKYLNRWKRYRLLWKLDKSNMVMKFAAKNPTCIAYDEKLQFYSNLVLEVGTQPMSRDVEFVRLNLDPLATTIQANARAWVKELGKMLNESAKDNLMTLKGEIETLCTDLKRAPDTLEDLKFVLRVIADIRDMSLDVELRTADIKERYRTLKMYEIEVSDNETELVNGIDQLWDDLFVESRRVDYSLVSVKMKFTEITQDQVSNFTSDISKFKESFINEGPSSIGTDLDAGVELLKKFQEEYNTFEKERQELTNAERLFGLSITMYPELQQMEKELKGLEQVFGIYEKQKEARDEWANTLWANLDVSVLSDGIDGYIKQLKRLPREVKALPLCHVLEEKMKEFKNSIPLFSDLKNEALRERHWKKLMDMTGMKFDLNPETFTLQNMFAMELHNFSDVIADITASATKELGIEKGIAEVSDTWNAMKFTVAKYMKGTQERGFVLGTVDEILQILDDNAMNLQSMSASRFVGPFLETVNKWEKSLSHIGEVVEVWMVVQRKWMYLESIFIGGDIRAQLPEEARKFDDIDKTFKKIMADTAKNPKVLEACHAPNRLDQLQFIVNGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSHDPTCVQEHMIKMFDNIASLRFQEGSNKETLATAMISSEGESMDFRQAVPAEGRVEDWMTSVLKEMRRTNRLITKEAIYNYCNQITRIEWMMQYQGMVALAGNQVWWTWEVEDVFRKVKKGDKMGMKNYARKCHRQIDDLVVKVRSNLSKNDRKKFNTVLIIEVHARDIIDSFVRDSIMDSREFEWESQLRFYWDQAPDELMIRQCTGEFGYGYEYMGLNGRLVITPLTDRIYLTITQALSMYLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDFKSIGKIFSGLAQCGAWGCFDEFNRIDVSVLSVVSTQIKTLQNSLSSGLKRLQFEGTEIALDARMGIFITMNPGYAGRTELPESVKALFRPVVCIVPDLQQICEIMLFSEGFLYAKVLAKKMTVLYKLASGQLSKQSHYDFGLRALKAVLVMAGELKRGSPELSEDVVLMRALRDMNLPKFVFEDVPLFLGLIADLFPGLDCPRVRYPNFNDAVESSLTDNKYILLPHQADKVVQMYETMLTRHTTMIVGPTGGGKTVVINTLAMAQTRLGMHTKLYVMNAKACTVIELYGTLDPVTRDWTDGLLSNIFREINKPTDKNERKYIVFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQKHCALLFEVADLRYASPATVSRCGMVYVDPKNLGYRPYWQKWCNARSNAKEREELDRLFEKYVPASVDLILEGILDGKQGKKLKTIIPLTNLNMVEQLSHMLDALLPPAESSNFLGPDVTEAIFISSLIWSTGAGLLEDGRIVYDQLIKRLAGIPANPAEGTVVGPGELPSAQPTLYEYYFDS--KKLLWVPWLDVVPEYVHNPDLKYNEILVPTVDTVRTTWLLQLMVNIHRPVLLVGETGTSKTATTANYLRGMDQDTTLLLNINFSSRTTSINVQHNLEANVEKRTKDTYGPPMGKRLLVFMDDMNMPQVDEYGTQQPIALLKLLLEKGGMYDRGKELIWKNVRDIGFVAAMGKPGGGRNEVDPRFISLFSVFNVTFPSEESLRRIYSSILTGHLQPFPKNIQDLVEHITTSTLELYTNIIRDLPPTPSKFHYIFNLRDLSRVYQGLCLTTPDRFDSPAKFVRVWRNECMRVFCDRLTNEADRETVSGYISSLVDQNFSEHTDIAMRDPCLFGDYRNTL-TEDPRLYEDVVDYDATKAIFEEILEEYNMDHAPMNLVLFDDALEHLTRIHRVIRMDQGHALLVGVGGSGKQSLTKLAAFSAGCGVFEITLTRGYDENSFREDLKELYNSLGLENKKMVFLFTDAHVAQEGFLELINNMLTSGMVPALYPDDEKEGIIGQVRDEANKAGVPPARESIWQYFVNKCANNLHIVLAMSPVGDILRTRCRNFPGL----------------------------NDKIPDQYRETVVDHVVFVHQTVGTYSQSFLQKLRRVNYTTPKNYLDFISTYNRLLEIKDKYVLEQCHRLEGGLGKLLAASEQLAELNEKLAVQKIAVTEKSEACEKLLVEIQRATQQANEKKEMAIGKKKEIAEQNKVIVVEKTEAEEALAAALPALEEAKLALQDLDKSDVTEIRSFAKPPRAVQMVSECIVALRGYKEISWKSAKAMMSEGNFLKSLTEMDVDGITTGQVKKCRDMLKEMNTTVEEMKEVSKAGAGLFKFVIAVMGYCSVAREIKPKREKVARLERNFHLSKRELEKIEKELKALEEELERLGKQYDDAMREKSSLQEEAEIMERRLIAADKLISGLGSEKIRWTKDLQDLKDQRVRLLGDCLLGAAFLSYLGAFTWDFRRDMLRKQWENDVIQREIPLSKPFKVDVLLTNDVEVSKWTSEGLPPDDLSIENGILTTQASRYPLCIDPQQQALNWIKKKEEKNNLKVVTFNDHDFLKQLELAIKYGFPILFKDVDEYIDPVIDNVLDKNIKGEPGREFVVLGDKEVDYDPSFRLYLNTKLSNPKYTPAHFSRCMVVNYTVTMKGLEDQLLSVIVGVERKELEEQRERLIQETSENKRLLKDLEDTLLRELATSQGNMLDNVELVQTLEDTKTKAVEVSEKLKLGAKTAIDIDKLRDGYRPAAKLGAVLFFVLSEMSVVNSMYQYSLNSYLEVFDLSLRKSLPDTILSKRLKNIMDTLTMNVYNYACTGLFERHKLLFSFQMTIKIMEADGKLKQEELDFFLKGNIALEKSSRQKPYSWMPDQGWEDVIRLCQVTPEVFGSLADDIERNEKGWREWSDLDAPESHPFPGKYEESLSDFQRLLLLRCFRVDRVYLAITHFVTGRMGEKYVTPPVLSFESILEQSTPFSPVIFILSPGSDPASDLMKLAERSGFGGNKLKFLAMGQGQEKLALQLLETAISRGQWLMLQNCHLLVKWLRTLEKVLERISKPHPDFRLWLTTDPTPEFPIGILQRSLKVVTEPPNGLKLNLRSTYHKISNQMLADCPHQSFSPLVFVLGFFHAVVQERRKYGKIGWNIAYDFNESDFRVCMTLLNTYLTKSLQNTDVKIPWASLKYLIGEVMYGGRVIDDFDRRVVKTYMDEYMGDFIFDTFQPFHFYNNEEVDYCIPKNGENKYDPGRDVYVDYIEELPLANTPDVFGLHPNAEIGYYTNAAKDMWLHLVELQPQTAGDSGGISREEFITKIASDIQGKLPPLFDVDRVRKNLS-EITPTAVVLLQELDRFNVLIRRMSTSLINLQRALAGEVGMSSELDEVSRSLFNGMIPNIWRKLAPATLKSLGNWMEHFQKRLDQYNKWVNDGEPAVIWLSGLHIPDSYLTALVQATCRKHGWPLDRSTLYTTVTKYHNADEVTERAHSGCFVSGLYLEGASWDLAESCLRRPKPKVLVEELPVLKVIPIESHRLKLQNTFRTPVYTTSQRRNAMGVGLVFEADLATTEHTSHWVLQGVCLTLNSD 4309          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Nematostella
Match: EDO47920 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKK0])

HSP 1 Score: 2275.74 bits (5896), Expect = 0.000e+0
Identity = 1467/4422 (33.18%), Postives = 2383/4422 (53.89%), Query Frame = 1
Query: 1033 DKEIMEMIESTVLKWDQQITGTLE--SLQKIVPH-GPSPLAEIDFWRERNAXXXXXXXXXXXPKVKRILNLYSLAEG---PVFDTQNNELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIAWNLSDRVARLIDVNTIFNLPLEHVLKDTAEAEKMLRVWNDTYFEVRASIE---ASGRDAR-WEFDRKRLFEKTNYMADICHDLNEIAMILQEFYNIFGPELKSVTNE--AKRIXXXXXXXXXXXXPLKEMPFNPFNLMKHKY--DWSNFME---DFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEVESIDQLFKTNM------NNPPLYHFKSCVAGGISWERHLFYNIKRPI--LRFLTMDEMMQSDNGKRIRTKYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILALANSENFVSENVPEETIDKMDDDLRVDFGFEINEIITETRNLELLGYK----VPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISDYIEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFKLQSGNKFLKCKEFFEFMESERTSDFEHLGRKYSTIGPLITKLQGEIIGDRDVNPFEKFQ---------PFYEFWEKRIFDRVYNMV---LKNLQDYQNMLRDENFPTCLFEVDLMLAGTDVIGNPQTTEIYKLAIQDLRDAVEATRVFIRWKRNSCIETTGMKIDGQDELFYFTFYLDIGNSVEITYFCEQIANYYRNIIGKLRKYQDKWKKHKRVFIPNK-------------------QAQIDKWLTKDPTVMDFYERIRDTIDRKEELLNQPVIRKIG------FISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHF--TDLSLIPC----DLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSNHPIDQEEIEESDKLRQLFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDN-AMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGG-DIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDCEC-VQEHMIKMFDNISSLRFTK--GTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTID--RVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTREGM----NQDTIEAIFIQSIYWSLGGCLIEDSQVKF-DQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQM--FSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTF---VQKAIEEQLSENAKSDKDYAMTDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVF-----KNYKEINWKVAKGMMAD-PSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVER--KIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKN-IKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKR-----LLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKRKKPYLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKF--ISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLTK-PHPDFRLWLTTEP-----TEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNH---------TAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQ--TGKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVEN-GEPNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPV--IKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMGVGLVVEADLATTEHPSHWVLQGVCLILNT 13923
            D+ ++  IES ++ W  QI   L+  S Q ++    P PL E+DFW+ R A L  + EQL  PKV+R+  L    +    P F     ++     EA+D T  L  + R  + +    +F  +   +P ++    ++W  S+ Y    R++ L++ +   + +     +D   IF   +E   +   +A +   ++ DT+ E R +I    A G + + WEF  + +F + +   +    + ++     EF  +   E+  +  +  + ++ E+ ++  EL        ++       ++  D++ F E   D  R++ SI  QA D   +C     S E A  +L     +  R  I+     K+  ++  +EKE++    ++   M         P+      VAG + W   L   I +P+  L+       +++     I  KY  + + + + +EK +  W   V  +  + L K ++    +   +                +V+F  ++  ++ E + LE+   +    +PE A  +  ++E ++K    L   V  Y+ V ++L  +E  ++  ++  +   +    + LNWNS G+ +YIEK    +H  E +V         + + + +   A LF+ +   K    +      E E  ++     ++Y+    +IT+  GE I     N  E FQ          + +  +  + D  +N +   L  L ++ ++  + N    LFE  L L   D++  P           DL + +    V   +K  S ++      + +       +  D+ + ++++   + + +    I+ K  +Y+  +  +  +++ ++                   +A  ++ + + P  +   E+ +D ID  E+L  + V    G      +  V+ +     + +  KRW  ++   L +    +L    ND+ G     D+ L       D   L A++  +  ++      +     +++   +L      + +E   +  +L + +++    +  V  ++ P++     I + +   F      F + F++  P +   + DV    L K + E+  +E     L+ +  LF +    Y +L   ++E+  L Q++++      + E W  T W  +D++ ++   + F+KE R + +E++A      L   +K    +L    +L++ A+RERHW++LM  T   F ++ DT TL+ + A+ L+ F+D +  IV  A+KEL +EK ++E++ TW  ++F  + +++       +L + +E+++ L+DN  + LQ++  S++IG FL  V +W+K LS    V+ +W  VQR W +LE IFIG  DIR+QLPE++K+FD ID  FK++  E AK P + + C  P     L NL + L  C+K+L +YL++KR AFPRF+F+S  +LL IL + +    V  H+ K+FDN++ L+F +    ++   A  M S E E +EF S    +G+VE W+ ++   MR T R    E+V  Y E K R QW+FD+   VALC  QIWWT EV   F ++++G + A+KDY K   +Q+  ++  +   LSK DR K+ T+  IDVHARD+V   ++  +  A+ F W SQLR  W  +        C  QF Y YEY+G   RLVITPLTDR Y+TLTQ+L + + GAPAGPAGTGKTETTKDL +ALG++  V NC E MDY+S G I+ GL Q GAWGCFDEFNRI V VLSVI+ Q+K+IQ+ +  K  RF F+G++I L   VG+FITMNPGYAGRTELPE++KA FRP  ++VPD + ICEIML ++GFL A+ LA+K  TLY L KE LSKQ+HYD+GLRA+KSVLV+AG L+R+D    ED+VLMRALRD N+PK + +D P+F+GLI DLFP LD PR R PDF   V++ + + K         KIVQL E +  RH+  V+GP G GK+ VI+ L  +    +    +  +NPK  +  EL+G ++P TR+W DGL S I R+++     +  ++++ DGD+D +W+E++N+VMDDNK+LTLA+ ER+ L     LLFE+G L+ A+PATVSR G+++++  ++G+NP+   W++ +E + E   L  L+ KY+P  +D  RV           + K I P+ ++ +VT LC +L+C LT        N++  E  F+ +  W+ GG + +D  V +  +F K               K  + PS   T+FDYY DS  E ++++PW + V ++  +PE     +LV T +T R+ + +   ++ +RPV+LVG  GT KT +   + ++ DPD  +   + F+  TTS  +Q+ LE  +EK+   +YGPP  K+L+ FIDDMNMP VD YGT QP  +++  L+    +DR K L  K +++  ++A M  P  G   ++PR    F+VF  +FP   +L +IY SIL+GH ++  F+  +      +T   + +  ++     PT  KFHY+FNLRDLS I+QG+   T +       F R+W HE  RV  D+LI+D D      +Q  + ++  E    +  YA   P +F  + +   + E + Y  + ++E    L  E +E Y+E  + M LVLF+DA+ H+ RI+R +    G+ALLVGVGGSGKQSL +LAA+  + ++F+I L +GY   D++ +L  L  K G++N  TVF+  D  V EE FL LIN++L+SG +P L+PDDE E IIS VRNE   AG+  ++E+ W +F+ +   NL +VLC SPVG TLR R R FP V N T IDWF  WP++AL +V+  FI     L   + +  + +    VH SV E S+ ++   RR NY TPK++L+ IN Y  LL+ K K    + +RL+ GL KL   + Q+ +L  KLA Q+V + +K    + L++++   T+  +++K IA ++ + V+V +K++ +++   E  L +A P L  A+ AL+ L K ++ E++SF  PP  V  V   + V      K  K+ +WK AK MM    +FL  L   D +NI       V+  LD  +   D ++  S A  G+  +V  ++ +  +  +++PKR+ +          + +L K+K +I +L+  L +L   +E A  E+ + Q+E +   + +  A++L+ GL+SEN RW   ++  K+Q+  L GD L+ +AF+SY G F+  +R  ++  +W   +  +  KIP+++      +LT++  I+ WN+E LP D +S +N  + T   R+PL IDPQ Q + WI +  E N+L+        +L  +E A+  G   L +++ E +DPV+D ++ +N IK  +GR  + +GDKEV++  +FR+ L+TKL+NP Y P +  ++ +IN+TVT +GLEDQLL+ +V  ER +LEE +          ++      LK+LEDSLL  L+ + GN L +  L+  LE TK  A+E+  ++    +T  +I+  R+ YR AA R ++L+F+L +++ IN MYQ+SL A+  VF+ +++++ P   ++ R+ N++  +T +V+ Y   G+FEK K++FT Q+  ++ + K  +   ELDF ++    + V     P  +LS++SW  +  L+ M   +F  L  DIE     WK++   E PE    P+++ NK  + QKLC++R  R DR+  A++ +V E++G +YV      F    ++S P +PI FILSPG DP  DV    ++ GF      F  +S+GQGQE  A+  LD A   GHW+ILQN HL+  WL +LEK LE  ++  +PD+R++++ EP         P GIL+ S+K+  EPP G+  NL          +LNNFN            F S++F+L +FHAVV ERRK+G  GWN  Y FN  D  + + +L  YL     + ++K+PW  L+YL GE+MYGG   DD+DRR+ +TY++EY    + +        A  F   L P  D     L   E+LP E +P ++GLH NAEIG+ T+ +  ++  L+++QP+   G  G+SQ+R+E + +    I  KLP+ F++  +  +   D +P  VV  QE ER N+L + M  SL  L   L GE+ +++E++D++ +L+   +P+ W R A  ++  LA W      R  +  QW  +   PNV+WLSG   P+S+LTA+ Q+  RKN WPLDK  L   VT+     +      +G +VHGL++EGA WD     +   K K L  ++PV  I+ IP++    K  N +  PVY T QR    G   V    L T E+PS W L GV L+L++
Sbjct:  185 DRSLVHSIESVIIDWSHQIQTVLKRSSAQPLLEGTNPGPLVELDFWKARAANLECIFEQLHDPKVRRMAELLEKTQSSYFPAFKKIFKDVVAALDEARDITLHLKPLRRQLEDMEQ-YDFSELHKILPAILHVCGLLWANSKFYCSAPRIIVLLQELCNMIIEMARTYLDPAEIFKSEIEEAYEKVKKAIENCMLFRDTFEENRKTISKFFAEGTEVKPWEFASEIVFTRLDKFVERLRVVEDVFATAMEFGKLEKVEIAGIKGKMLSHQVVEIFEEFNELFAVFSNSTYDALEATNKEFVDDFNQFRERVADLDRRLASIVCQAFD---DC----ASTESALKLLDCLGSLLDRPLIHADFEHKYPILLRMFEKELDQAKVIYDQQMECAQAEGAAPINKNMPNVAGSLKWSSELKERITKPMQALKLSLNHGTLETAEAMIIFNKYDEMNKLLDSHDEKIYQSWTEGVGNIAQQNLDKPLIVRDPNTKLI----------------KVNFDPKLVSVLREVKYLEVASNETLEAIPESATAIFARNETFHKFCANLDLTVAWYNKVRETLLDVEFPLVESQLVAIDTQLEQAEKSLNWNSDGVWEYIEKTRDMVHDLEKRVQAAKDNIEAMNQLMTKWSEAPLFERKEAKK----EGLLNLEERETITN-----KRYA----MITQ-SGEKIHKLLKNNLELFQADADTDMWRAYVDSIDDMVLDGFFNCIHCSLNYLLEHTDLKHNAN---ALFEAKLELHQPDMVFIPSLDFGVTAGFYDLVEGI----VSDIYKMASLVKRLAEHNESEH------YEADVEDMLDLSEMRQDLMDRVNGIMNKANEYRSSFDSYSYLWLDDRNEFMRQFLLYNHVLTAEEIEAHTEEGVPESPPTL---EQFKDQIDTYEKLYTE-VDEVDGTNIFDTWFRVDARPFKQALLNIIKRWSYMFKQHLIDHVTNSL----NDLAGFIKVADVGLTQTVEEGDYNGLVAVMGHLMAVKDRQSATDEMFEPLKQTIELLKTYGQEMPEEVHTQLQELPEQWNNSKKIAVTVKQQVAPLQASEVAIIRRKCGQFDIKQHEFREDFRKTAPFAFNSE-DV-YDRLDKSNREICAMEEEMNALSESAGLFEVNFPDYKQLRACRREVILLKQLWDMIFVVLTSIEEWKFTPWAEIDVENMEMECKRFVKEIRSLDKEMRAWDGFTGLDSTVKNMVTSLRAVGELQNPAIRERHWQQLMQATKVKFVMDDDT-TLADLLALNLHNFEDEVRGIVDKATKELGMEKVLKELDVTWSQMEFEHEEHVRTHIP---LLKSSEELIETLEDNQVVQLQNLMTSKYIGHFLEEVTSWQKKLSTADSVITIWFEVQRTWSHLESIFIGSEDIRNQLPEDSKRFDGIDVDFKELTNEGAKIPNVVECCNRPGLFEKLENLQERLSLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNQPVEVARHLSKLFDNMARLKFKEDDAGNVTKDAVGMYSKEGEYVEFDSVCDCDGQVEIWLNRVMDRMRATVRKEQSESVVSYEE-KPREQWLFDFPAQVALCGTQIWWTTEVGIAFGRLEEGYENAIKDYYKKQVSQLSTLINMLIGDLSKGDRQKIMTICTIDVHARDVVAKLIQQKVDSAQAFLWLSQLRHRWDDQQSHCFANICDAQFKYSYEYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKSCGNIYKGLSQTGAWGCFDEFNRISVEVLSVIAVQVKSIQDAIRDKKERFIFQGEDICLVPTVGLFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLEARALARKFITLYSLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRSDRQRPEDQVLMRALRDFNIPKIVTDDVPVFMGLIGDLFPALDVPRKRDPDFEALVKKSVTDLKLQPEDSFILKIVQLEELLAVRHSVFVLGPAGTGKTQVIRSLNKTYMNQKRKPMMFDLNPKAVTADELFGFINPATREWKDGLFSTIMRDLSN-IASDSPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERVPLTPSMRLLFEIGHLKTATPATVSRAGILFLNFADVGWNPYVSSWIDTREVQSEKANLQILFDKYVPVCLDLLRV-----------RFKKITPIPDITMVTTLCYLLECLLTPANTPPDCNKELYELYFVFAAVWAFGGAMFQDQLVDYRTEFSKWWVT---------EFKTIKFPSA-GTVFDYYIDS--ETKKFVPWTDKVQKFELDPEVPLQAVLVHTAETTRVRFFMDLLMENRRPVMLVGGAGTGKTVLVNDYFQSLDPDVSMVGNVPFNYYTTSAMLQQVLEKPLEKKAGRNYGPPGNKKLIYFIDDMNMPMVDTYGTVQPHTLIRQHLDYSHWFDRTK-LTLKDIRNTQYIACMN-PTAGSFTINPRLQRHFAVFAISFPGLDALKTIYLSILNGHMKVHNFASAVSKFTEKVTDAALAMNQKVTSTFLPTAIKFHYVFNLRDLSNIFQGILFATHECIKTPVDFARLWMHECNRVYRDKLIDDKDMEVFDKIQIDMTKKFFEELDEEAMYA--KPNMFSHFSSG--IGEPK-YLAVPDWEVLSKLLTEALENYNEVNAVMNLVLFEDAMQHVCRINRILESPRGNALLVGVGGSGKQSLARLAAFISALEVFQITLRKGYGIPDMKLDLANLCTKAGLKNIGTVFLLTDAQVPEENFLVLINDLLASGEIPGLYPDDEVENIISGVRNEVKGAGLQDTRENCWMFFIERVRRNLKVVLCFSPVGATLRVRSRKFPAVTNCTAIDWFHEWPQEALVSVSRRFIEDLEQL-EAEYKPPVAEFMSYVHTSVNEESQMYLANERRYNYTTPKSFLEQINLYRNLLKKKSKELTQKTERLENGLLKLQSTAQQVDDLKAKLASQEVELKQKNEDADKLIQKVGVETEKVSKEKAIADDEEKKVQVIAKDVSEKQRSCEEDLAKAEPALLAAQEALNTLNKGNLTELKSFGSPPGAVVNVCSAVMVLLAPANKIPKDRSWKAAKIMMGKVDAFLDQLINYDKENIHESNLKAVQPYLDNPEFEPDFIKGKSLAAGGICAWVINIVQFYYIFCDVEPKRKALEAANAELAAAEEKLSKIKAKIQELDENLAELTANFERATSEKLKCQQEAESTAKTIELANRLVGGLASENVRWGESVKSFKEQEKTLPGDVLLTTAFVSYHGCFTRRYRDNLLNDKWLVFLASQNPKIPITEGLDPLSLLTDNATIATWNNENLPADRMSTENATILTNCERWPLMIDPQLQGVKWI-KTREGNDLRIVRLGQKGYLDTIERAVSNGECVLIENMGENVDPVLDALIGRNTIK--KGRA-IKMGDKEVEYHADFRMILHTKLANPHYKPEMQAQTTLINFTVTREGLEDQLLADVVSKERPDLEETKASDRIFPLTQQQNAFTIKLKELEDSLLARLSAAGGNFLGDYALVENLEITKRTAAEIEVQVTEAKQTEIKINDAREAYRPAAARASLLYFILNDLNKINPMYQFSLKAFSVVFQKAIERAEPAEEVKARVVNLIDCITYSVFIYTTRGLFEKDKIIFTAQVAFQVLLMKKEIIPHELDFLLRFPAVMNVT---SPVDFLSNLSWGGIKALSNM--EEFRNLDRDIEGSAKRWKKFAESECPEKEKFPQEWKNK-TALQKLCMMRALRPDRMTYAVSNFVEEKLGHKYVEDAPTPFAMSFEESGPATPIFFILSPGVDPLKDVEAHGKKIGFTFDAKNFHNVSLGQGQEIVAEQCLDLAAKEGHWVILQNVHLVKNWLPKLEKKLEAFSEGSNPDYRVYISAEPAGTPDAHIIPQGILETSIKITNEPPTGMMANLH--------KALNNFNQDTLEMCARENEFKSILFSLCYFHAVVAERRKFGPQGWNRSYPFNTGDLTISVDVLYNYL-----EANAKVPWTDLRYLFGEIMYGGHITDDWDRRLCKTYLEEYMKPEMLEGELNL---APGFP--LPPNSDFKGYHLYIDETLPPE-SPYLYGLHPNAEIGFLTTTSDNLFRTLLEMQPRDAGGGEGASQTREEKVKQVLDDIFEKLPEEFNVPEMMARVE-DRTPYTVVAFQECERMNMLTNEMKTSLKQLDLGLKGELTITSEMEDLSNALFLDDVPESWTRRAYPSMFGLAAWFVDLLLRIKELEQWTSDFCLPNVVWLSGFFNPQSFLTAIEQSMARKNEWPLDKMALQVDVTK-KNKEDFNSPPREGAYVHGLFMEGARWDTQTGMIADSKLKDLTPAMPVMFIRAIPVDKQDTK--NVYECPVYKTRQR----GPTYVWNFFLKTRENPSKWTLAGVALLLSS 4471          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Nematostella
Match: EDO34077 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQG6])

HSP 1 Score: 2182.53 bits (5654), Expect = 0.000e+0
Identity = 1311/3748 (34.98%), Postives = 2108/3748 (56.24%), Query Frame = 1
Query: 1900 WSNFMEDFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEVESIDQLFKT-NMNNPPLYHFKSCVAGGISWERHLFYNIKRPILRFLTMDEMMQSDNGKRIRTKYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILALANSENFVSENVPEETIDKMDDDLRVDFGFEINEIITETRNLELLGYKVPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISDY-IEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFKLQSGNKFLKCKEFFEFMESERTSDFEHLGRKYSTIGPLITKLQG---EIIGDRDVNPFEKF----QPFYEFWEK------RIFDRVYNMVLK-NLQDYQNMLRDE--NFPTCLFEVDLMLAGTDVIGNPQTTEIYKLAIQDLRDAVEATRVFIRW-----KRNSCIETTGMKIDGQDELFYFTFYLDIGNSVEITYFCEQIANYYRNIIGKLRKYQDKWKKHKRVFIPNKQAQIDKWLTKDPTVMDF------YERIRDTIDRKEELLNQPVIRKIGFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDLSLIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSNHPIDQEEIEESDKLRQLFDSLTFE-------SKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVK--AMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYI-LGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSS-DCECVQEHMIKMFDNISSLRFTK-GTSLEMS-ATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVFFYRES-KVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIK-KGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLH-------TKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTRE-GMNQDT-------IEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWAN-LVPQYVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLS-------ENAKSDKDYAMTDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYS--EAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQ-RIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEV-AKRKKPYL-WLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLT--KPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFN-HTAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQ 12918
            W +    FR  V  +E    + I + F T+ + E   ++L  FQH+ +R+AI + + +K  ++   + +E+  + + F T  ++ PPLY      AG  SW R L   I + +        + Q  +G  IRT+Y  + + +  F  K FNEW   VDK    LL   ++  +            E    +D    ++F   + ++  E    E L  + P     V  + E    + E +L +V  Y+ +I  L   E  +  + I+ + + I PGL +L+W S GISDY I +C       +  V       + I +   +I    L K+ S       K  ++ +E      FE   +K+  +G + T+LQ    EI+G    N +E F    Q     W +      R+ +  + + +K +LQ+    +  +  + P  L  V ++L G  V  +P  T++  +            ++F R      ++ S  E   + I+  +E       +  G S   ++               L+ Y   W  ++ ++   K A I ++   +P V  F      Y  I +   ++E +LN      I F+ ++   L   +  H   W++ +   L E A   L  + N ++G+   LS  P  L+EL   LS ++ +Q      E++   + +++ +L       ++ E+   ++++ + D+L+ E         + +  L   K KF         +F K +    D F+ +GP S    +   L  + ++H+++  ++ +   L     +F +      +L N++K++++L+Q++ +    ++  + W    +  L    ++   +   K   K+ REVK        ++  ++++FK  +PL  DLK+ A+R+RHW ++ T+  + FD   D FTL  +  + L++F + I EI  +ASKELSIE+ +  +   W  +   + PY    K+RG+  L   DEV Q L+DN + L +M ASR++  F   V  WE+ LSLI EV+++ + VQR+WMYLE IF+G DIR QLP E+ +FD ++  +K IM    K P   +    P  L  L +++  LE+ QKSL+ YL++KR  FPRF+F+S+D+LL ILG S + E VQ H+ K FDNI +L+  + G + + + A  M S+E E +EF   VL+EG VE W+  +E  MR T + + K      ++S   R +W+ ++ G + + ++Q+ WT +        K +G K ALK   K   + +++    +R  L+K  R K+  ++ I+VH RD+++  ++    D   FEW SQLR YW ++ D+  ++Q   QF YGYEY+G +GRLVITPLTDR Y+TLT AL ++ GG+P GPAGTGKTET KDL KALG   +V NC EG+D++S+G++++GL Q GAWGCFDEFNRI + VLSV++ Q+ +I + L    +RF FEG+EI L    GIFITMNPGYAGRTELP+++K+ FRP+ + VPD   I EI+LF++GF + KVLAKK+ TLY L+ +QLSKQ+HYDFGLRAL SVL  AG  +R +PD+S++++L+ +++DMN+ K   +DAPLF G++ DLFPG++ P + Y    +++   L +  Y    +   KI+QLYET  +RH+T+VVG TG GKSV  ++L ++ T+L+          +  P+NPK  S+ ELYG  D NT +WTDG+LS++ R+     +K E +++LFD  VD LW+E+MNSVMDDNK+LTL NGERI + +  +LLFEV DL  ASPATVSRCGMVY D ++LG+ P+   WL+++ +K   + L  L++K++P    +V+E   +       K  +P + LN V  LC + D   T E G+           +E  F+  + WS+   + EDS+ K D F++ L               G+ P++  T+++Y+ D I++K  W  W + L   + +NP   F +I++PT+DTVR  +L+   I+ +RPVLL G  GT KT+V+Q  L+  DP  Y  L IN S++T+S D+Q  +ES VEKRTK  Y P  GK+++ F+DD NMP  D +G+Q P+ +++L ++    YDR K    K ++D+  LA+MG PGGGR  +  R  S F++ N TFP +S +  I+ ++++   Q F +++K    I+T+ T+ IYN I+ ++ PTP++ HY+FNLRD+S+I+QG+ +   D         R+W HE  RV  DRLI++ D+      + ++L         N   +K      PI FG++     + +  +YED+++++A K   ++ ME+Y+    V  + LVLF DA++H+TRI R I    G+ LLVG+GGSG+QSLT+LA+Y     +F+I +++ Y  ++ R++LK LY + G++NK TVF+F D   +EEGFLE +NN+LSSG VP L+  DE E + + + + A+   +  + ES++ +F+ +  SNLHIVLCMSPVG+  R R R +P  VN TTIDWF  WP  AL  VA  ++  EN  + D++ +  + + FV VH SV + S   + + +R NYVTP NYL+ ++ Y  LL +K K       +L+ GL K+ +   ++  ++ +L    + V E    CE  L  I  + + A E++++ Q +S+ + ++  +       A+  L EA+P L++A  AL+ L K D+ EI+S+ +PP  V+ V E + + +   E  W  AK  + D +F++ L   D DN+T +    +     +     + +  VS A   L  +V A+  Y  + R ++PK++++ +      + +  L + K ++ ++   +++L ++Y+    +++ L+ + ++++ +L+ A KL++GL+ E  RW   + +L++    L+GDCL+ +AF+SY G F   +R E+V   W   V +  +  +  F     L     + +WN +GLP D  S +NG++ TR +R+PL IDPQ QAL WI   E  + LK       D+L+ LE A+++G P L ++V E +DP +  +L K++    GR  + LGDKEV++ P+FR Y+ TKLSNP Y P I  K+ ++N+ V  +GLE QLL ++V+ ER ELEEQ++ L+   +  K+ L++LED +LR L T+ G++LD+ +L+NTL  +K+ + EV+E+L +  +T  +ID  R+GYR  A+R +ILFFVL +M  I+ MYQ+SL AY+D+F  S++KS    NL  R+QN+    T  VY Y C G+FE+HKLLF+FQ+  K+    G L  DE +FF++G   ++   +   P   WL+D SW +VT+L ++    F  ++   E+    W QW     PE   LP ++ N     Q++ ++R  R DR+    T +++  +G ++V PP+L+   + D S+  +P++F+LSPG DP S +++LAE  G  + +   +S+GQGQ   A  ++   +  G+W+ L NCHL + W+ +L+K +E+L    PHPDFRLWL++ P   FPI ILQ  +K+ TEPP GLK N++  Y+ I     +  +    +  L+F L FFH+V+ ERRK+  +GWNI Y FN+SDF V   +L  YL +  +      PW +LKYL+  V YGG   DDFDRR+L +Y++E F D      Q  ++  S   TY +P+
Sbjct:  279 WHDDFNRFRAGVKDLEVMVQNLIASAFETVTTVEEGVEILDIFQHLSTREAIRRTIDKKTVEVYQLFNEELNLVKKEFNTKTVDLPPLY---PKYAGSASWARMLKRRIDKSMNVLSKAFFLPQIGSGDEIRTQYQQLAQALDEFVRKTFNEWTATVDKDCGRLLEIPLMRRS-----------AERAGTLD----LNFDKVLLKLFNEIHYWEKLMLETPHYVSEVYQKKEDLRILRENVLLVVRDYNRIIAVLSPEERGLFRERIRSLDKKIHPGLTKLSWASKGISDYFIGECRNNCSKVQGIVDDYKNANLVISKNCIKISEMLLVKIDS-------KRVYDNLE------FEEEQKKH--MGLVQTRLQVAHVEIVGTMK-NTYEVFKNDGQEVQAHWLRYTEKMDRMVEEAFRLNVKWSLQELSRAINGDGKSIPNPLLRVKVVLEGDKVEFSPTLTKLASMMDNIASTLTTCLQIFKRLPDLLTRKKSIKEPVHLVIERDEETKKIQTSIKAGMSANASH---------------LQSYLSTWDGYREIWEIQKDAFIRRYQRLNPPVSSFDADIARYTEIANNFQKEETVLN------IDFVLLDCSPLKFALLSHCNEWQNKFTTLLREMASQKLTELNNFLKGNAKKLSAPPETLDELGDSLSLLEQLQNDLPNIEAKFAPLHQQFAIL-------EKYEVAIPEEVQGMLDALSGEWLLFQQCLIDSDVMLKKSKEKFKTGLIHSSEEFKKTVNGLFDDFQSKGPFSSSIGVKEALEQVTQYHEQVVNLKSQETSLRRGLNIFKIEQALSKDLQNLEKDLEHLEQVWTVTKEWEELWDTWKVGKFVELVTTDMETQAQLLFKRLNKIIREVKDKNWEICDSIKSRIEQFKRTMPLIQDLKNSAMRDRHWSQIKTEVQKPFDHTGDDFTLEKIIELGLDQFGEQICEISGAASKELSIEQAISGIASIWDQVSLDIGPY----KDRGHFRLKQTDEVFQQLEDNQVTLSTMKASRYVKAFEAEVDKWERTLSLILEVVEMILTVQRQWMYLENIFLGEDIRKQLPRESAEFDDVNANWKIIMQRLNKDPNALRGTHYPGLLETLNDMNTKLEEIQKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSKNPEAVQPHLKKCFDNIKTLKMARVGLTFDKTEAVGMYSAEGEYVEFGHSVLLEGPVEAWLCDVERSMRWTLKELLKHCRLGLKKSLSKRDKWVKEWPGQLTITSSQMQWTSDCNKALSSSKERGDKKALKSLKKKQVSMLNKFSEMIRGSLTKMQRLKIVALVTIEVHGRDVIEKLIKAGCNDVTAFEWLSQLRLYWDKDIDDCVVRQTNTQFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGNYVIVVNCSEGLDFKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGATRFVFEGREINLVWSCGIFITMNPGYAGRTELPDNLKSMFRPISMCVPDSGMIAEIILFAEGFNNTKVLAKKVHTLYTLAVQQLSKQDHYDFGLRALTSVLRYAGRKKRANPDMSDEEILLLSMKDMNVAKLTTQDAPLFNGIVSDLFPGIEAPVIDYGKLRNAIVAELKDGGYQPTPNTILKIIQLYETKNSRHSTIVVGQTGSGKSVTWRVLQSAMTRLKRDGEPGFNVVREFPINPKAVSLGELYGEFDLNTNEWTDGVLSSVMRQTCS-DEKPEEKWILFDAPVDTLWIESMNSVMDDNKVLTLINGERISMPDMVSLLFEVEDLAVASPATVSRCGMVYTDFRDLGWQPYVDSWLDRRVDKQSVEHLQRLFEKFVP----KVLEFRKH-----HCKEPVPTSELNSVVSLCVLFDALATEENGVRMSNGESYARMLELWFLFCLIWSVCASVDEDSRKKMDNFLREL--------------EGQFPAK-DTVYEYHVD-IKQKT-WASWEDKLRSGWRYNPSVPFYKIMIPTVDTVRYDFLVYNLIQAKRPVLLTGPVGTGKTSVAQKVLQKLDPKTYGLLVINMSAQTSSNDVQEIIESKVEKRTKGVYVPIGGKQMITFMDDFNMPAKDTFGSQPPLELIRLWIDYGFWYDRMKQ-TVKYVKDMHLLASMGPPGGGRMVISKRLQSRFNLINMTFPQESQIKRIFGTMINQKLQDFEEDVKPLGDIMTQATIEIYNTIVAKMLPTPTRIHYLFNLRDISKIFQGLLRANKDLHDTKTAISRLWVHECFRVFSDRLIDNTDRESFVTLLSDKLGSMFDLTFHNLCPNKQ----SPI-FGNF-----MKDDTMYEDLVDFKAIKRYMEDQMEDYNMEPGVIAINLVLFRDAIEHVTRIVRVIGQPRGNMLLVGIGGSGRQSLTRLASYIIEYKVFQIEVTKHYRRQEFRDDLKRLYYQAGVDNKPTVFLFNDTQALEEGFLEDVNNILSSGEVPNLYKPDEFEEVRTALSDIAAKEDVQDTPESMFHFFIERVRSNLHIVLCMSPVGDPFRNRIRMYPAFVNCTTIDWFSEWPGDALLEVAERYL--ENIELGDEETKANVAQIFVTVHRSVVDMSARMLLELKRHNYVTPTNYLELVSGYQSLLAEKKKELGDAASKLRNGLDKIDDTRAKVEVMSVELEDATLKVAEFQKQCEEYLVVIVQQKREADEQQKMVQARSEKIAIEEDKCRVMAENAQHDLDEAIPALQEAMKALESLNKKDMTEIKSYGRPPALVEKVMEAVMILRQ-SEPTWAEAKRQLGDGNFIKQLVNYDKDNMTDRILKKIGTYCAQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIYRVVEPKKQRLHQATAQLEEKQAILAEAKAKLKEVTDRMEELKRQYDEKSAQKEELRAKAELLEIKLDRAGKLVSGLAGERDRWEASVTILEENIGYLVGDCLIAAAFMSYAGPFLSNYRDELVLKTWLAQVRQLGVACNPNFSFSGFLAKPTTVREWNIQGLPSDAFSTENGVMVTRGNRWPLMIDPQGQALKWIKNMEGKSGLKIIDLQQSDYLRTLENAVQFGSPVLLQNVQEELDPSLAPILNKSVVKVGGRYLIKLGDKEVEYSPDFRFYITTKLSNPHYTPEISTKTTIVNFAVKEQGLEAQLLGIVVRRERPELEEQKDALVINIAAGKKKLEELEDEILRLLQTAQGSLLDDEQLVNTLNSSKTTSQEVAEQLTVSEQTEIKIDAAREGYRPCAQRASILFFVLNDMGRIDPMYQFSLDAYIDLFNNSIEKSQRSPNLDNRIQNLNEYHTYAVYKYTCRGLFERHKLLFSFQMCSKILEAAGKLNMDEYNFFLRGGVVLDREGQMDNPCTQWLTDTSWDNVTELDKL--PNFHGIVTSFEQYPRDWNQWYTSSEPENTPLPGEWENACNELQRMLVVRSLRPDRVSFTATSFIVNNLGSKFVEPPVLDMSSVVDDSSTRTPLIFVLSPGVDPTSALLQLAENCGM-SNRFHALSLGQGQAPIATRMIKEGVKDGNWVFLANCHLSLSWMPQLDKLVEQLQVEDPHPDFRLWLSSSPHPEFPISILQVGIKMTTEPPKGLKANMKRLYQLITEQQFSRCHKQDKYKKLLFGLCFFHSVLLERRKFLMLGWNIVYGFNDSDFEVSENLLSIYLDEYEE-----TPWDALKYLVAGVNYGGHVTDDFDRRLLHSYINEMFND---QAIQTPYYKLSSLPTYYVPK 3908          

HSP 2 Score: 72.0182 bits (175), Expect = 7.238e-12
Identity = 57/201 (28.36%), Postives = 100/201 (49.75%), Query Frame = 1
Query:  901 RDEFLISLKKFTSIVDQTIIQIASEVKLEIPDLDLFENDKENLSDKEIMEMIESTVLKWDQQITGTLESLQKI-VPHGPSPLAEIDFWRERNAXXXXXXXXXXXPKVKRILNLYSLAEGPVFDTQNNELNKF----HIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIA 1488
            +++FL  L KF + +  T  ++  +  L +P      N ++   +KE ++ +E+ ++ W +QI   L S           PL EI+FWR R A LS + EQL  P VKRI     L++   + T   +L+K       +A+ N KFLS ++   + +A       V   +P ++  +RM+W+ S HY   ER+  ++ ++ 
Sbjct:   20 KNDFLAHLHKFMANLTDTRYKMQGKTVLYVPSESTTINIEQASKNKEFVQRLEAAMIHWTRQIKEVLSSQDTFETAENSGPLEEIEFWRSRCADLSGISEQLDKPGVKRIQATLELSKSS-YVTPFLKLSKLIQDGSSQAQSNLKFLSTLKGPCEELAQA-QPKDVPAMLPRILHTIRMVWMNSEHYRSRERLTGILRKVC 218          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Nematostella
Match: EDO35603 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKZ5])

HSP 1 Score: 2137.84 bits (5538), Expect = 0.000e+0
Identity = 1246/3539 (35.21%), Postives = 1996/3539 (56.40%), Query Frame = 1
Query: 3478 WKKHKRVFIPNKQAQIDKWLTKDPTVMDFYERIRDTIDRKEELLNQPVIRKIGFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDLSLIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSNHPIDQEEIEESDKLRQLFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGP---GSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALD---EVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDL-TNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILG-SSDCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWM-TKIEMEMRRTNRVITKEAVFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHF-EGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTREG----MNQDTIEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSL--CAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYV----HNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGH-CQ--MFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSENAKSDK-----------DYAMTDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEAV--SPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQV--RNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVF-------------KNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEV-AKRKKPYLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLTKPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSK--IPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTGKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLR---KKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGEPNVMWLSGLHIPESYLTALVQATCRKN-GWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMGVGLVVEADLATTEHPSHWVLQGVCLILN 13920
            + K+  V+  ++   I  +L  DP + +F  +I    + ++ ++ +P    +G I++  + L S +    K W   +    ++  +  +  I   +E     LS    DL++++  ++ ++ I+   ++ +  I  ++E Y++L   + PI +EE E  D LR  ++ L   +      L  +++ F     +E+  F  D+ +FA  +   GP       R+    L++   F +    +  +    +  E+LF LP+T YPEL  +++E+  L ++Y LY+        + + LW++++I+ +++ +  F    RK+PR +K      +L + + +F ++ PL   + ++A+++RHW  +   TG  FDI  DTF+L ++    L + ++ I ++  +A KE  IE  ++ V   W T   +   +    K RG +L   D   E++ +++D+ M L S+ ++R+  PF  ++Q W + LS  +++++ WM VQ  W+YLE +F+GGDI  QLP+EAK+F  IDK + KIMT   +   + Q C     L  L  +L + LE CQKSL  YL+ KR  FPRFFF+SD  LL ILG +SD   +Q H++ +FDNI S++F +     +   A+ISSE E +E   PV+ +G VE W+ T + M  +  + VI +  V     S   ++++  +   V L   Q+ WT +  +     K  +K   +  A      ++ ++      L++  R+K  T++ I VH RDI D   R  I    +FEW  Q+RFY+  + D   +      F Y  E++G   RLVITPLTDR Y+TL QAL M +GGAPAGPAGTGKTETTKD+ KALG   VV NC + MDYR +G+IF GL Q G+WGCFDEFNRI++ VLSV + Q+  I  G   +  +F F +G  + ++   GIF+TMNPGYAGR ELPE++K QFR V ++VPD Q I  + L S GF+    L++K  TLY+L +EQLSKQ HYDFGLR + SVL   G  +RN+P  SE+  +MR LRDMNL K I ED PLFL LI DLFPG+   +  YP+   ++     E   I       K++QL+ET + RH  MV+GP+G GK+  I +L  + T      K + MNPK  +  +++G LD  T DWTDG+ S ++R+  +   K E+ +++ DG VDA+W+EN+NSV+DDNK LTLANG+RI +   C ++FE  ++  ASPATVSR GMVY+    L + P  Q W+NK+    E + L G ++K     +  + E +++          + + + N + Q   +LD  + ++      +   +E +++ S+ WS+G  L  D + K + F++      +PQ +E +              +F++    + +  EW  W   V +YV    H P+  F  ILVP +D V + +L+    K  +  LL+GE GT+KT + + ++   DP+K++  + NFSS +T L  QR +ES V+KR   +YGPP GK++ VF+DD+NMP ++++G Q    +++ ++E +G Y+  K  ++  + DI FL+AM  PGGGRND+  R    F +FN T PS +S+  I+S I  G+ C+   F +++++    +   T  ++    V++ PTP+KFHYIFNLRDLSRI+QG+  T  +          +W+HE  RV+ DR  N  DK + +K ++  + +    D            D+    P   GD     +    ++YE + +++  +      M+ Y++++  + M LV F DA+ HL R+ R IR   G+ALLVGVGGSGKQSLT+L+++      F+I L+R Y+  +L E+LK LY   G   +   F+F D  + +EGFLE +NN+LSSG V  LF  DE + I  ++    +       P+ E++++YF+ +   NLH+VLC SPVGE  R R   FPG+++  T+DWF  WP+ AL AVA  F+   + +   + + ++V    ++H  V     ++ Q+FRR  +VTPK+YL FIN Y  +  +K         R+  GL KL EAS  +A+L+ +LA+++  +   +   + +LKE++ + Q A + K   Q+     +    EI  +K  AE  L +A P LE+A  AL  ++   +  +R  AKPP  +  + +C+ +              +N  + +W  +  +M+   FL +L   D D+I  +   ++   L+     ++  + V     GL  +  A+  +  + +E+ P +  +A  E   G  + +L K + ++D+ ++EL +    YE A+ E+Q L ++ +  +R++ AA  LI+GL  E +RW    +   +Q  RL+GD LVC+ FLSY G F+ EFR E++ S W+ ++  RKIP +    +  ++ +   + +WN +GLP DELS+QNGI+ T+A+RFPL +DPQ Q   WI  +E+ N ++  + N   F   LE A+  G P L +DV E +DP +DNVLEKN         V +GDKEVD    F LY+ TKL NP Y P I  ++ +I++TVT+KGLEDQLL +++  E+ ELE +R +L+++ S NKR +K+LED+LL  L ++ G+++D+  LI  L  TK+ A EVS+KL + A T  +I+  R+ +R  A RG+IL+F++ EMS +N MYQ SL  +L +F  S+++S P     KR+ N++  LT  V+ Y C G+FE HK LFT  +  K+++    +  +E    IKG  S+++ A   K   W++D++W ++ +L+++   +FS +L  I R+E  WK W + + PE A +P  Y+N L +F+KL L+R +  DR       Y+ E MG +Y    IL  E+  ++S   +P++  LS GSDP   +  LA++  +     + ISMGQGQE +A+ LL++ +  G W +LQNCHL ++++ EL   +      H DFRLW+TTE    FPIG+LQ S+K   EPP GL+  L+ TY  I+   L+  N   +  +++++AF H+ VQERRKYG +GWNIPY+FN++DF   +Q +Q +L    D  D K  + W +++Y++GEV YGGR  DDFD+R+L T+   +F + +F     F+FY      Y+IP+  +    L++I+ L L ++PEVFGLH NA+I Y ++ AK+    ++ IQP+   SG  ++R+ I+++ A  +  KLP+ +    ++   +K G  +SP  + L QE++R   ++  +  +L  L  A+ G + MS  L D    +Y+ +IP  WK+++ ++  ++  W T   +R  Q+  W  +G PNV W++G   P+ +LTA+ Q   R + GW LD   L+  VT+F    ++T    +G +VHGL+L+GAGWDR    LV P  K L   +PVI +  I +   +    +  P+Y   +R +   +  V   DL T ++P HW+L+GV L+ +
Sbjct: 1135 FNKYSSVWQGDRDHTISAFLQNDPKLSEFEAQILHYKEMEQTIVQEPESYSVGSIALMTEKLKSSLCAETKAWCISFSRYCNQKYRMEMEEIFTFVEDMTKRLSRPIKDLDDIRLAMNALKEIRSQEIKIDMNIGPIEESYQMLARYDMPIAREESERVDTLRYSWEKLQSLATESQDHLIGIQSNFKGGLIDEVQTFILDVGSFAGDYNSTGPMVPNVPPREASDRLII---FQNRFDTLWRKYITYSGGEELFGLPVTEYPELMQIKRELNLLQKLYGLYNDVIDTVNGYYDILWQDVNIEKINQELLDFQNRCRKLPRALKDWQAFLDLKKTIDDFNESCPLLELMANKAMKQRHWDRIANLTGHTFDIESDTFSLRNIMEAPLLKHKEDIEDVCIAAVKEKDIEAKMKMVIADWSTKDLTFANF----KNRGELLLRGDNTSEIVSLMEDSLMVLGSLMSNRYNAPFKKNIQLWVQKLSNTTDIIENWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFQNIDKQWVKIMTRAHENCNVVQCCVGDETLGQLLPHLLEQLELCQKSLTGYLEKKRLVFPRFFFVSDPVLLEILGQASDSHTIQAHLLNVFDNIKSVKFHEKDYDRI--MAVISSEGETVEMVKPVMAQGNVEIWLGTLLTMSRQSLHNVIRQAYVAINDSSFNLLEFLNTFPAQVGLLGIQMIWTRDATEALTNAKYDKKVMQQTNAAF-QELLNVLIEQTTKELTRVVRTKFETLITIHVHQRDIFDDLCRMHIRTPSDFEWLKQIRFYFNDDTDVCSVNITDVTFIYQNEFLGCTERLVITPLTDRCYITLAQALFMSMGGAPAGPAGTGKTETTKDMGKALGKYVVVFNCSDQMDYRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIYIILTGKKERKKQFIFSDGDVVDMNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIIRVKLASCGFIDNITLSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRNNPGDSENTTVMRVLRDMNLSKLIDEDEPLFLSLINDLFPGIVLDKAGYPELEQAIATEAEEIGLINHPPWRLKLIQLFETQRVRHGMMVLGPSGAGKTKCIHVLMKAMTDCGTPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLR-AKKGEKIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPQCKIVFEPHNIDNASPATVSRNGMVYMSSSGLDWRPVVQAWINKRPIP-EGEILNGFFEKSYEELLTFLRESLVSK---------MDILDHNYIIQTLTLLDGLIPKKDDGGQFSSQHLEHLYVFSLMWSIGALLELDDRAKMETFMRENFDLDLPQVSENE-------------NIFEFM---VNDAGEWAHWNTRVEEYVYPKDHVPD--FLSILVPNVDNVCMDYLIETVSKQSKAALLIGEQGTAKTVMIKGYMSKYDPEKHLSKSFNFSSASTPLLFQRTIESFVDKRMGSTYGPPAGKKMTVFVDDINMPIINEWGDQVTNEIVRQLMETKGFYNLEKPGDFTNIADIQFLSAMIHPGGGRNDIPQRLKRQFLIFNCTLPSNASIDKIFSVIGGGYFCKERGFINDVQDFALKLVPCTRKLWQLTKVKMLPTPAKFHYIFNLRDLSRIWQGILNTIAEVINSERALVSLWKHECQRVVSDRFTNQQDKDWFEKTMKRVIVDELGEDYQPMIDATAYFVDFLRDAPEATGDEPEDADFETPKIYEPIPSFDGLEERLAMYMDLYNDSIRGAGMDLVFFRDAMIHLMRVSRIIRTPRGNALLVGVGGSGKQSLTRLSSFIAGYKTFQITLTRSYNSSNLMEDLKYLYRTAGQNGQGITFIFTDNEIKDEGFLEYLNNVLSSGEVSNLFARDEIDEICGELIPVMKKEFPRRPPTGENLYEYFLTRAKHNLHVVLCFSPVGEKFRNRSLKFPGLISGCTMDWFSRWPKDALIAVADHFLSSFDIVCTAEIKTQVVHSMGVIHDGVANCCTDYFQRFRRATHVTPKSYLSFINGYKSIYTEKRGEIGELAQRMHTGLDKLMEASDSVAQLSKELAVKEKELAVASEKADKVLKEVSIKAQAAEKVKAQVQKVKDKAQAIVDEIAVDKAVAEGKLEKAKPALEEAEAALQTIKPAHISTVRKLAKPPHLIMRIMDCVLLLMVKKVDPVVHDPERNMLKPSWSESLKLMSKSDFLNNLLNFDKDSINDETVELLAAYLEADDYNMETAKRVCGDVAGLCSWTRAMSTFFGINKEVLPLKANLAVQEARLGVAQGDLNKAQAQLDEKQAELDEAQAMYENAVKEKQDLLDDAEACRRKMLAASALISGLGGEKERWTEQSKEFAEQIGRLVGDVLVCTGFLSYSGPFNQEFR-ELLMSNWQKEMKSRKIPFTSNLNVTGMMVDGATVGEWNLQGLPNDELSVQNGIIVTKATRFPLLVDPQGQGKAWIKNREKDNEMQITSLNHKYFRTHLEDALSLGRPLLIEDVGEELDPALDNVLEKNFIKSGSTLKVKVGDKEVDVMKGFVLYVTTKLPNPAYTPEISARTSIIDFTVTIKGLEDQLLGLVILTEKAELESERTKLLEDVSSNKRKMKELEDNLLYRLTSTQGSLVDDESLIEVLSVTKTTAEEVSQKLLVAADTEIKINGAREEFRPVATRGSILYFLIVEMSYVNCMYQTSLKQFLGLFSQSMERSHPSPITSKRINNIIDYLTHEVWRYSCRGLFENHKFLFTLLLAFKIDLQNKRIKHNEFMTLIKGGASLDLKACPPKTCRWITDMTWLNLVELSKL--SQFSDILNQISRNEKQWKNWFDKDAPEEAEIPDGYANSLDTFRKLLLIRSWCPDRTISQARKYISESMGAQYGETVILELEKTWEESDNRTPLINFLSMGSDPTGMIEALAKKHKYDC---RAISMGQGQEVHARKLLNSFMQTGGWALLQNCHLGLEFMLELIDTVVESEHIHEDFRLWMTTEEHVQFPIGLLQMSIKFTNEPPQGLRAGLKRTYNGISQDQLDVSNLPQWRPMLYSVAFLHSTVQERRKYGPLGWNIPYEFNQADFTASVQFVQNHL----DDMDIKKGVSWNTVRYMLGEVQYGGRVTDDFDKRLLNTFAKVWFSEGMFHP--SFNFYKG----YVIPKGTSVQQFLEHIDGLKLVDSPEVFGLHPNADITYQSNLAKDCLDTILSIQPKDSSSGGGETRESIVHKMADDMLEKLPEDYIQHEVKARLQKMG-PLSPMNIFLRQEIDRMQRVITAVRITLTDLKLAIDGTIIMSETLRDSLDCMYDARIPTHWKKVSWES-STIGFWFTELIERNAQFRTWCFDGRPNVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVVLHNDVTRFF-KDDITTPPAEGVYVHGLFLDGAGWDRRGCKLVEPPAKVLFTPVPVIHIYAINSTGGRDNRLYQCPIYKKPRRTDLTYIACV---DLKTNQNPDHWILRGVALLCD 4612          

HSP 2 Score: 154.451 bits (389), Expect = 8.841e-37
Identity = 150/713 (21.04%), Postives = 321/713 (45.02%), Query Frame = 1
Query:  883 RAAVQARDEFLISLKKFTSIVDQTIIQIASEVKL-EIPDLDLFENDKEN-----LSDKEIMEMIESTVLKWDQQITGTLESLQKIVPHGP--SPLAEIDFWRERNAXXXXXXXXXXXPKVKRILNLYSLAEGPVFDTQNN---ELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIAWNLSDRVARLI---DVNTIFNLPLEHVLKDTAEAEKMLRVWNDTYFEVRASIEASGRDARWEFDRKRLFEKTNYMADICHDLNEIAMILQEFYNIFGPELKSVTNEAKRIXXXXXXXXXXXXPLKEMPFNPFNLMKHKYDWSNFMEDFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEVESIDQLFKTNMNNPPLYHFKSCVAGGISWERHLFYNIKRPILRFLTMDEMMQSDNGKRIRTKYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILALANSENFVSENVPEETIDKMDDDLRVDFGFEINEIITETRNLELLGYKVPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISDYIEKCNLALHGFESKVATIHK-VTMDIEEKLKEIDNAKLFKLQSGN-----KFLK-----CKEFFEFMESE 2946
            +     R EF+  L+ F +I+      +   V L E   +DL   +         S  E +E IE+ V  W +QI   L   +++        P AE+D W++R A  ++LL+Q+K    K ++ +   A+  +  T       +  +  EAKDN KFL  +E+ F    Y  + + + D IP ++ A+RMI   SR+YN  ERM  L  ++   +       I       ++      +++      ++   +   + + +  +E +  + ++EF    +F K N  +   + + E+   +Q+F  +    ++ +     +++ ++         +K+ P++  +  K ++D ++F E+F+R++  ++ Q  +F++ CF  + S + A  ++ +F+ +    ++   + +K+  I+  + +++E+I ++++ +  +PP+      +AG I+W R ++  I+ P++ F     ++Q+ + ++I   Y  + + +  FE      W   V+ + S L  +  L + + +N                 L V+F  +I  +I ET  +  LG  +P  A  +  +     K  + L  ++     V+  +      ++   + +V+  I PGL  LNW SL +  Y++    +L   E  +   +  V   I+  L+E+ +  L +L +       +FLK     CK   + +E++
Sbjct:  159 KQGSSVRHEFMNQLESFVAILASAQASLEDAVTLKECDTVDLSNINTPTDFIAAASSSETLEQIEAVVSAWIKQIEQVLAESEQMRKEADDVGPKAELDHWKKRMAKFNSLLDQIKGSDCKAVVGVLHAAKSKLLKTWRELDIRITDYANEAKDNVKFLYTLEK-FCDPLYNSDPVGMMDGIPGLINAIRMINSYSRYYNTSERMTALFVKVTNQMITACKNYITEHGYKNVWEYTHSELIEKLGNCIRLNEEYQRCFQKTKQRLEQNPDERQFEFSEMYIFGKINTFSRRLNKIIEMMNTMQKFMTLGESRIEGLEQMWNKVQLIMTT-------MKKKPYDLLDYRKMEFD-ADF-EEFKRQISELQAQLQNFMDICFEKIPSTQRALRLIRKFESL-GLDSLRDTIQEKYERILIYFGRDIETIQKIYQRHKTDPPVARDLPPIAGKIAWARQMYRRIQEPMIMFQKYPSILQTSDARKIIKNYNKLSKVLLEFELLYHQAWVKQVEVIKSGL--QASLLVRHPDN---------------KKLFVNFDPQIMTLIRETECMVRLGLDIPFSAHALLQKQSSLKKNSDTLQLLLNERERVLGKIPQTFRPLMAPHLAKVEAAIDPGLTMLNWTSLNLDTYVDSVYESLGELELLIDRANDLVAFRIDAVLEEMSSVPLCELPTDTPKTIEQFLKTTEGLCKRGADLLETK 843          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Nematostella
Match: EDO31800 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWW2])

HSP 1 Score: 1992.62 bits (5161), Expect = 0.000e+0
Identity = 1215/3474 (34.97%), Postives = 1936/3474 (55.73%), Query Frame = 1
Query: 3781 DLSLIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSNHPIDQEEIEESDKLRQLFDSL-TFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSS-DCECVQEHMIKMFDNISSLRFTKGTSLEMSAT-----AMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVFFYRESKVRVQWMFDYQGM-------VALCTNQIWWTWEVEDVFRKIKKGQKTAL----KDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLIP---------MNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTREGMNQD----------TIEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRN-TDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSEN---AKSDKDYAMTDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEAVSP-MKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPS-KESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVA----VTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDEL-SIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKRKKPYL-WLSDISWQDVTKLTEMI-------------PIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLT----KPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSL-NNFNHTAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTGKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKK-YGLDI----SPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGEPNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTL-YTSVTQFATAAEVTERAHQ------------------GCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAM-----GVGLVVEADLATTEHPSHWVLQGVCLI 13914
            +L ++P    +    L+ +  IQ    + E+    ++E Y ++     P   E++     LR    ++     K++  R + +  KF     ++I   GKD+K    K ++          +  +  LK+   ++  +        + ++ F + +T + EL  V  E++    ++       +++++W ETL++ L+ + L   +  + K   ++ + +        L EKL+  +  LP+ ++L++ AL++RHW ++      +F  + +  TL  +  +E     + I E+   AS E S+E  +++VE+ W + +F V P+ +  K+  +ILG +D++  +LDD+ +N+ +++ SR +GP    V+ W++ L L SE +D WM  QR W+YLE IF   DI+ QLP EAK F  +DK++K+IM +  + P   +A   P  L    N +  L++ QK L  YL+SK   FPRF+F+S+DELL IL  + +   VQ H+ K FD I+ L F  G++++  +T        + E+  M + +  ++ G +     K+ +     +  I    + F         W+ D           ++L ++ ++ TW     +         AL         +    ++ +   VR  L K  R+ L  ++ IDVHARDIV   V   +     FEW  QLR+YW  + D   ++     + YGYEY+G + RLVITPLTDR YL L  AL + LGGAPAGPAGTGKTETTKDLAKAL   CVV NC EG+D++ +G+ F+GL Q GAW CFDEFNRI++ VLSVI+ QL TI+N  + K SRF FEG+EIKL      FITMNPGYAGRTELP+++KA FRP+ ++VP+   I E++L+S+GF S+K LA+KMT +YRL  EQLS+Q+HYDFG+RA+KSVLVMAG L+R++PDL ED VL+RALRD NLPKF+  DA LF  ++ DLFPG + P   Y     ++E+C+       +     K++QLYETM  RH  M+VGPTG GK+    +L  + T L    +  P         +NPK  ++ ELYG ++  T +W DGL++   R+  + T   + ++++ DG VDALW+ENMN+V+DDNK+L LAN ERI+L N   +LFEV DL  ASPATVSRCGMVY+DP  LG+ PF + W+ K  +K + +T     ++Y+    D  ++  +   A +K    +   +++ VT +C + D          D           I   F+    WS+GG L+E     FD F + L A      + +   +G+       L+ YY D    + E  PW  ++P + ++ E  + ++LVPT+DTVR  +L+ + + + + VL  G TG  K+ +++  L + +    Y+ + +NFS++T+S   Q  +E+ +EK+ K+  G P GKR+++F+DD+NMP++D YG+Q PI +L+   + RG YDR K L WK++ D+   +A   PGGGRN V PRF+  FS+F     ++ +L  I+ SI+SG    F  E++     I   ++ IY ++   L PTP+K HY+FNLRDLS+  QG+ Q          Q +R++ HE +RV  DRLIN +DKTF    + E   ++   A+S + +  ++PILFGD+         +LYE++ + +  K L  + +++Y+   S  MKLV F DA++H++RI R +R   G+ALLVGVGG+GKQSLT+LA +  +   F+I L+RGY     RE+LK LY+  G++ ++TVF+F D  +V E FLE INN+L+SG VP LF  +E EA+++  R  A  AG+    ++ ++ YF+++  +NLHIVLCMSPVG+  RTRCR FP +VN  TIDWF  WP +AL +V+S F   E  L  +  + ++ +  V +H SV   +  F  + RR  Y TP +YL+ I  YL +L++K K      DR++ GL+KL E +    +L D + ++ VA    + +K++  E L++++    + A + + + Q +    + ++ E      EA+  L EALP LE A+ ALD L+K+D+ E+R F KPP+ V  V E I +    K  +W  AK M+ D  FL+ L   D D I       ++  +D  K  ++ +  VSKA   ++ +V A+  Y  V R ++PKR K+A  +         L + +  + ++ES++ +L   Y+ +I E++ L +       RL  A KL   L  E  RW  ++   + +   ++G+  V +A ++Y GAF+  +R E++ S W +   E  +P+SD F L ++L +  EI +WNS+GLP D L +I++ IL     R  L +    +A  WI  KE  N LK     D +FL+ LE  I+ G+P L ++V E +DP ++ +L K      GR  + LGD ++D+D NFR Y+ TKL+NP Y P +  K  +IN+TVT  GLEDQLLS +V+ ER +LE+QR +LI   + +K  LK +ED +L+ L  S GN+LD+  LINTL E+K  +  +S +LK   RT E+I   R+ YR  A RG++++FV+A ++ ++ MYQYSL  +  +F   ++ S    +L +RL+ +++  T +VY     G+FEK KL+F+F +   +   +  +T +E +FF++G   ++  +  KP + WL+D  W     L +++             PI  SM   ++++ E      + D+  + A  P+ + ++L SF++L  ++ F+ +++  A   +V E +G+ +V  P ++   + +  +   P++FILS GSDP +  ++ A    + T +++ IS+GQGQ   A+ L+  A   G W+ LQNCHL   W+  +E  ++ LT    + H DFRL+L++ PT+AFP+ +LQ S+KV  EPP GL+ N +  + ++      ++     +  LVF + FFHA++QER+K+G +GWNI Y+FN+SD    ++ L+ +L       D  IPW +L ++ G++ YGGR  D++D+R L T +  +F   + +    F    S+   Y  P  ++  D  +Y+++LPL + PEVFG+H NA I + T    ++   ++++QP+   SG  ++ DEI+ E A  I  KL  + D+++  K  +  D     +    VL QE++RFN L+  +  SL  L +A+ G V MS ELD V  S  N Q+P +W   +  +LK L +W+     R     QW+ +G P   W+SG   P+ +LT  +Q   RK   P+D+ T  Y  + Q+    EV E   +                  G  VHGLYL+GA WD     L   +  ++   LP++ + P + + +   + +++P+Y TS R   +         VV   L T    + W+ +G  L+
Sbjct:  485 ELEVVPSSTNDYVKSLTFLDEIQEKIDDIEAESMTIKELYDLIDNYKVPTPPEDLAVYQTLRPTVTAVRNVIDKSLAERDSNID-KFCTCMDKDIVQLGKDVKEVKQKAQDPKILDSSSKSESIIAYLKELQGKMDRLHDTAFTYKSYQKNFKVEVTKFEELEEVHAELRLKQSLWNSLVEWDQSQQDWTETLFEELNPETLSNNVMKYAKTVMQLEKGLPPNSVVPILKEKLENMRHKLPVITNLRNPALKQRHWDQIQQIFNYHFK-DEEPLTLGLLDKIEAFEHTESIEEVSGQASSEASLEGILKKVEDAWKSTEFIVLPH-RDSKDV-FILGGVDDIQAVLDDSMINVSTIAGSRHVGPIRPRVEEWQRQLYLFSETMDEWMTCQRNWLYLESIFSAPDIQRQLPAEAKMFMTVDKSWKEIMRKVNRLPNALRAATQPGLLETFQNNNALLDQIQKCLEAYLESKCVIFPRFYFLSNDELLEILSQTRNPHAVQPHLQKCFDAIAKLEF--GSTVQAPSTPQDQPVTPTGERRKMRYATNDIL-GMISPEGEKVSLGKVSYSHSIETLTLCF--------SWLKDMSNHPLNLHKKISLFSSLMYITWSRSPQYIITSSTTINALFPSHYSLCIVFPMNLNNLAALVRGVLPKLTRNILGALITIDVHARDIVTGMVNAKVDSENNFEWIKQLRYYWDPDLDNCVVRMSNSMYIYGYEYLGASARLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAKQCVVFNCSEGLDFKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLLTIRNAKVAKASRFMFEGREIKLVPSCAAFITMNPGYAGRTELPDNLKALFRPMAMMVPNYALIAEVILYSEGFESSKNLARKMTQMYRLCSEQLSQQDHYDFGMRAVKSVLVMAGALKRSNPDLEEDVVLIRALRDSNLPKFLAADAILFRAILTDLFPGKEIPDHDYGKLQSTIEDCMVAKGLQAIPALVKKVIQLYETMIVRHGVMLVGPTGSGKTTNYMMLQDTLTSLHEQAEDSPYYLPVQTHILNPKSVTMGELYGEVNKLTMEWRDGLMALKVRQCVQETTP-DHKWIVCDGPVDALWIENMNTVLDDNKMLCLANSERIKLNNTIHMLFEVQDLAVASPATVSRCGMVYMDPNELGWRPFVRSWMQKHSDKMKEET-----REYLWNLFDHYVDAGLKF-ASKKCTQAMQQVDISKVTTMCCLFDSFFFPAKGGPDFNLDPTKLHPLICTAFLFVFLWSIGGNLVETCNESFDTFTRDLFA---DTHDVRIPGSGD-------LYSYYVDFDTRRME--PWEKIIPAFKYSSEVPYFDLLVPTVDTVRFGFLMDKLLSVNKSVLYTGTTGVGKSVIAKAILDDISQKSNYMAIMMNFSAQTSSQRTQEMIETKLEKKRKNILGAPAGKRMVIFVDDLNMPKLDTYGSQPPIELLRQYQDFRGFYDREK-LFWKEIHDMTICSACAPPGGGRNPVTPRFLRHFSMFCIPSSAEHTLGHIFKSIVSGFLLDFPAEVRECADAIVGASVEIYARMSTDLLPTPAKSHYVFNLRDLSKCIQGVLQADPGVIRDKGQIFRLFCHEASRVFQDRLINKEDKTFFNTIMSEMAHKHFQQARSPEKFE-SNPILFGDFMKMGADPADKLYEELTDLKKVKNLLTDYLDDYNMNSSKEMKLVFFMDAIEHISRIARMVRQPRGNALLVGVGGTGKQSLTRLACHMSAYKCFQIELTRGYDYSAFREDLKKLYDVAGVKGENTVFLFTDTQIVVEEFLEDINNILNSGEVPNLFEPEEYEAVLNGTRPLAKEAGIPEGDRDGVFDYFISRVRNNLHIVLCMSPVGDAFRTRCRMFPSLVNCCTIDWFTEWPREALLSVSSNFF-EEVDLGAEGVKDKVAEMCVEIHTSVSTMADRFYAELRRRYYTTPTSYLELITLYLSMLDEKRKQLIGARDRVKNGLKKLLETN----DLVDTMQVELVALEPQLKQKSLDVEKLMEKLQVDQEEADKVRNVVQAEEAVAKEKADETSAIAAEAQKDLDEALPALEAAQKALDSLDKSDISELRVFTKPPELVMTVMESICILLGVKP-DWPSAKTMLGDAGFLKKLMDYDKDKIPDSTLRKLKKYIDNPKFVVEVVEKVSKACRSMVMWVRAMDLYARVYRTVEPKRAKLAAAQAELEVVMSTLREKQASLAEVESKIAELQAAYDHSIAEKETLTKNIAQTAARLKRASKLTTALGDEQGRWTENVAAFELEIGNVVGNVFVAAACVAYFGAFTSLYRHELINS-WIEQCKELGVPVSDDFSLINVLADPYEIRQWNSDGLPRDSLKAIEDRILKLLNMRSTLFL----KANRWIRTKEAKNGLKIIKLTDNNFLRTLENCIRIGMPVLLEEVGESLDPALEPILLKQTFVQGGRLLIRLGDSDIDYDKNFRFYMTTKLANPHYLPEVCIKVTIINFTVTKSGLEDQLLSDVVRLERPDLEDQRNQLIVRINSDKNQLKAIEDRILKLLFHSEGNILDDEVLINTLNESKVTSGVISTRLKEAERTEEKITIAREKYRPVATRGSVMYFVVASLAEVDPMYQYSLKYFKQLFNACIESSEKTDDLDRRLEILLNNCTESVYVNVARGLFEKDKLVFSFMLCGDIMRQQEIITDEEWNFFLRGTGGLDKERPAKPDVPWLTDFMWNTCCDLEDVLHSFKGFKGDFVKAPITISM--GNLQQSE------VGDD--DQAEKPRSWQDRLTSFERLIFIKAFKEEKVVFAAVDFVCENLGKTFVESPSIDLPVLFENVSNMIPLIFILSTGSDPMNAFLRFARDMNY-TERIQAISLGQGQGPVAEKLIANASKNGDWVFLQNCHLAASWMLAMETTIKDLTNNEAEVHEDFRLFLSSMPTKAFPVTVLQNSVKVTNEPPKGLRANTKRAFGELMADPFESHVLGVRWRKLVFGICFFHAIIQERKKFGPLGWNIKYEFNDSDRMCALENLKMFLV------DENIPWDALTFITGQITYGGRVTDEWDQRCLTTILGRFFSPKILEDNYKF----SESGIYFPPGFESLHDYREYVDNLPLTDEPEVFGMHENANIAFQTQETHQLIYTVLEVQPRLASSGGGKTNDEIVYELADSILGKLMDVLDMEKAEKSLFETDAKGRYNSLTTVLGQEVDRFNNLLKVIKNSLTQLQKAIKGLVVMSLELDKVYTSFLNNQVPDMWANSSYPSLKPLGSWVKDLVLRTMFVEQWIIHGPPKSFWISGFFFPQGFLTGTLQNHARKYNLPIDQLTFSYNVLPQYRNQEEVAEETAKLEYGQALPLDEELDCPDDGVLVHGLYLDGARWDDDSMMLGDARYGEMNPPLPILHMEP-QMNLVPDPSQYMSPLYKTSARAGVLSTTGHSTNFVVSVYLPTDLPQAFWIEKGTALL 3889          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Medaka
Match: si:dkeyp-86b9.1 (dynein axonemal heavy chain 10 [Source:NCBI gene;Acc:101170214])

HSP 1 Score: 2305.02 bits (5972), Expect = 0.000e+0
Identity = 1194/2445 (48.83%), Postives = 1655/2445 (67.69%), Query Frame = 1
Query: 2485 VDFGFEINEIITETRNLELLGYKVPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISDYIEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFKLQSGNKF--LKCKEFFEFMESERTSDFEHLGRKYSTIGPLITKLQGEIIGDRDVNPFEKFQPFYEFWEKRIFDRVYNMVLKNLQDYQNMLRDENFPTCLFEVDLMLAGTDVIGNPQTTEIYKLAIQDLRDAVEATRVFIRWKRNSCIETTGMKIDGQDELFYFTFYLDIGNSVEITYFCEQIANYYRNIIGKLRKYQDKWKKHKRVFIPNKQAQIDKWLTKDPTVMDFYERIRDTIDRKEELLNQPVIRKIGFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDLSLIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSNHPIDQEEIEESDKLRQLFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTREGMNQDTIEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLD-RFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSENAKSDKDYAMTDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEK 9810
            V+F  ++ EI++ETR L LLGY VPELA++VALQ+E++   V  L  +V +Y+S+++ L      ++  +IK  ++ I  G +R+N     I+D+I +   A+  FE+ +  I K   DIE KL+ I  A L K    +K   L  +EF + +E ER      L R Y  IG L   +   +I D +       + +Y +WEKR+F+ +  MVL ++Q +  +L  +   T LF+++ +L+   +   P+++EI  L +Q +++ +E+T+ F RW R +CIE    K+ G+DEL  FTF+ D+  S +I+     ++   +N++  + ++   WK++K +       +I+++  K+P+   +  +++   +  +E+  + + +    I VN+  L+S + +  +      C+ L++ AK  L  +++        +   P   E+LK++L TI  I+ +SL+ E R+ D++ERYR++ +       +E+E    + Q++ +L  ES+ V+  L  V+  F+ I  EE+  F +DL  FA+ F   GPG++G DL+  L ++ KF  EL+ I  +++ L    +L +L +  YPE+ ++QK +  L QIY +Y A K+A+  W++TLW N DIK+L +GI+GF++   ++ ++V+ +  A  L   LKEF+ +L L  DLK+ ALR+ HW +LM +TG++FD+N   FTL ++F++EL+++ + I EIVTSA KELSIE        TW   KF++QP LK  +ER ++LGA+D +L  LD++ M LQ M+ SRF GPFL ++Q WEKNL+L SE +++W+ VQ KWM LE IF G DI SQLPEEAKK   I K F +IM  T  +P IK+ C VP RLS L  L + LE+ QK+L ++LDSKRN FPRFF ISDDELL++LGS D  C+QEH+IKM+DNI SLR    +S +    AM+S+E E+MEFR PV +E RVEDW+  +  EM+RT+R+ITKEAV+ Y      V W+  YQ M+ L  N++WWTWEVE+  + + KG K ALK YA+ +H QIDE+V  +  P  ++DR K++ VL+ DVHARDIVD+FV  SI +  +FEWESQLRFYW++E D + ++QC     YGYEYMGLNGRL ITPLT RIYLTLTQALSMYLGGA AGPAG GKTET KDLAKALGL CVVT+C E MD  ++GKI +GL +CG WGCFDEFNRI  SVLSV+S+Q++ I+N L      F FEGQ+I LD  +GI+ITMNP Y  R ELPESVK  FRPVVV+ PD+QQICEIMLFSQGFL AK LAKKMT LY+ +  QLSKQ HYDFGL + KSVL MAG+++R+  +LSED VLMRALRD+NLPK + ED P+FLGLI D+FPGLD  RV +P F ++VEE L +  Y +L DQ DK+VQ+YE M T+  TM+VG T GGKSVVI  LC +QT L L TKL P+NPK  SV ELYG  DP TRDWTDG+ S +FREIN+ TDK E RY+LFDGDVD+ W+ENMNSV+DDNKLLTLANG+RIRLQ+HCALLFEVGDLQ+ASPATVSRC +V++DPK+L Y P+WQ W+  + N+        L++KY+P  ID  +            +TI+P T++N+V+QLC MLD  L  +  + + +E  F++++Y SLG  L+E  ++KFD+ +KSL  +   ++E   A  GE+P   PTL+D++FD  +EK  W+PW++LVP+Y+HNP  KF++IL PT+DT R  W+L + +KI+RPVLLVGE GTSKTA+ Q  L+NT  D  I L INFSS+TTSLD+QRNLE+N+EKRTKD+YGPP+GK+LLVF DD+NMP+VD +GTQQP+A+L+L+L++ G YDR + L++K ++D+G++AAM K GGGRN+VDPRF+SLFSVFN   P+  SL  IY+SI+ GH + F   I+     IT+ T+ ++  II  LPPTPSKFHY F+ R+LSRIY G+  T  D      +QF RVWR+E  R   DRL ++ DK  V   I++ + E  ++D +  + DPILFGDYR A E  E R+YED+ +Y+ +K +FQ                LF+DA++HLTR+HR +R D GHALL+G  GS  Q+LTKLAA+T  C++FEI L RGY+E + R +LKTLY KLGIEN+ TVF+F D H+VEEGFLE INNML S +VP LF DDE+E+II Q+ +EA   G G SKES+WQYF+ K A+NLHIVLC+S  G+ L+TRCRNFP +++NT IDW+ PW  QAL+AVA   +  EN  IP      ++ H  MVH S+ ++SK+ + K +R NY T K++LDFI++Y  LLE+K++    QC  L+G L +L EA  Q+ ELN KLA QKV + +KT  C   L+EI     I+  K
Sbjct:  510 VNFAPQLKEIMSETRYLVLLGYSVPELAQSVALQEEHF-LYVSDLNHLVSSYNSIMEGLSQTHAIMVAPQIKAAQKEIDFGCKRIN-----IADFISRGQKAVSNFETVLNQILKNERDIESKLQSIQTANLLKCPVPDKSNELPIREFCDHLERERVKTVALLSRNYKDIG-LTIIMTEHMIMDTNSGKASLMETYYTYWEKRVFNSLEKMVL-SIQTFNLLLMGD---TALFQINAILSAPKIELQPKSSEISMLLLQCVKNCIESTKQFPRWMRGTCIECPPQKVVGEDELVTFTFFTDVWQSSQISENAFTVSQNIKNLLFSVDQFFTHWKRYKLLLKMKVATEIERFAKKNPSCAMYDNKLQYFENLNQEVKQEVLCKTEHIIHVNMMPLVSSLRNIAESRISTLCSFLNKPAKEELFILRDKFMQLQEKMHQRPDTFEDLKSILGTISDIRDMSLDVEIRVADIKERYRMMAM------YDELELVANIGQIWSNLFAESRQVDQSLKDVRETFSKIKMEEMEAFKQDLSIFAESFNTHGPGTVGNDLE-KLNIIGKFEKELSKIMAKQEHLTKTAKLLDLQLAEYPEIISIQKYLSGLSQIYNIYKAHKEAKTKWSQTLWVNFDIKLLQDGIDGFIESLMQLSKDVQTLPVAFFLDSHLKEFRVSLSLLLDLKNTALRD-HWNKLMERTGKSFDMNLQRFTLETLFSLELHKYANDIDEIVTSALKELSIEM-------TWKRTKFNMQPQLKVNQERVFLLGAVDNILVNLDNDVMKLQCMAGSRFGGPFLDAIQQWEKNLTLFSETIEIWLQVQHKWMNLENIFCGEDICSQLPEEAKKLKKITKKFTEIMKSTENEPNIKKCCTVPGRLSSLWVLRNDLERIQKNLANHLDSKRNEFPRFFLISDDELLNVLGSVDPACIQEHVIKMYDNIESLRLGVDSSGQTVVGAMVSNEGEVMEFRKPVPLEARVEDWIMAVLQEMKRTSRLITKEAVYHY------VDWIRSYQCMMVLAANRVWWTWEVENAIKNVNKGDKYALKKYAEQIHRQIDELVTCLGRPTKESDRLKISNVLVTDVHARDIVDNFVGRSIKEVHDFEWESQLRFYWVKEHDSLFVRQCNTSLSYGYEYMGLNGRLAITPLTSRIYLTLTQALSMYLGGALAGPAGAGKTETVKDLAKALGLFCVVTHCTEDMDTITLGKIISGLAKCGFWGCFDEFNRIGASVLSVVSSQIQAIRNALTSHFKMFQFEGQQISLDDHMGIYITMNPSYERRPELPESVKVFFRPVVVVTPDVQQICEIMLFSQGFLQAKELAKKMTVLYKTAGIQLSKQPHYDFGLHSQKSVLKMAGKMKRDSLELSEDVVLMRALRDINLPKLVSEDVPVFLGLISDIFPGLDSSRVGFPSFRETVEEILQKSNYTILPDQVDKVVQIYEIMLTQQATMIVGQTCGGKSVVINTLCQAQT-LGLCTKLYPLNPKATSVDELYGSFDPETRDWTDGIFSKLFREINQSTDKKE-RYILFDGDVDSQWLENMNSVLDDNKLLTLANGDRIRLQSHCALLFEVGDLQHASPATVSRCAVVFIDPKHLSYTPYWQRWMKNRLNR--------LFEKYVPSCIDVTLNS----------ETIVPRTDVNMVSQLCLMLDVLLESKNSSAEVLECYFLEALYCSLGATLVESGRLKFDKLVKSLSCLSTVDDEKAAAGPGEIP-YLPTLYDFHFDETQEK--WVPWSSLVPEYIHNPAMKFADIL-PTVDTTRTHWILEQMVKIKRPVLLVGECGTSKTAIIQNLLKNTSTDSSISLTINFSSKTTSLDLQRNLEANIEKRTKDTYGPPIGKKLLVFFDDINMPKVDDFGTQQPVALLRLLLDQGGLYDRKQKLSFKTIKDLGYIAAMRKTGGGRNEVDPRFLSLFSVFNIPPPATESLHLIYASIIKGHTRPFKAAIQEVCQTITECTLKLFTTIITDLPPTPSKFHYTFSQRELSRIYCGLTLTKPDFSCLTVEQFVRVWRNECLRNFHDRLTDETDKALVHGHIKKLVEEYFETDSEAVLADPILFGDYRAAREECEQRVYEDIGDYDVSKAIFQ----------------LFEDAVEHLTRVHRILRSDRGHALLIGADGSWTQALTKLAAFTADCEVFEIILRRGYNELNFRNDLKTLYLKLGIENRRTVFLFTDAHIVEEGFLEQINNMLIS-MVPTLFADDEKESIIKQINSEALQEGAGSSKESVWQYFLRKSANNLHIVLCLSATGDALKTRCRNFP-LMSNTVIDWYLPWSAQALHAVAQCVL--ENPTIPKAHFGAVIDHICMVHASLCDFSKQLLLKHQRCNYATSKSFLDFISSYSTLLEEKNEHV-LQCKCLEGSLNRLREAREQIDELNLKLADQKVVLAKKTATCTAFLEEIDKNQTISFAK 2877          

HSP 2 Score: 1488.01 bits (3851), Expect = 0.000e+0
Identity = 737/1333 (55.29%), Postives = 972/1333 (72.92%), Query Frame = 1
Query: 9937 LDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLK-TATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKRKKPYLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLTKPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQL-KYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTGKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQW-VENGEPNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMGVGLVVEADLATTEHPSHWVLQGVCLILNTD 13926
            L++++KN  +   SFAKPPK VQVV ECI V +  KE+NW  AK MM++  FL SL  MD D+I+    + ++  L  L+ +++EM+S+SKAG G+LKFV + + Y D+A+E++PK+++V RLEK F Q+K ELE +KN+++ ++ E   L ++YE A  E++   +E  +M+RRL AADKL+ GL+SE + W  DL+ LK Q   LLGDCL+ +AFLSY GAF+W+FR  MVY +W  DV ++ IP+S PF++E+ LTN +EIS W SEGLPPDE S+QNGILTT+ SRFPLCIDPQQQALNWI  KE+ NNLK  ++ NDPDFLKQLEL+IKYG PFL +DV+E IDP+I NVLE+N+   +GR  ++LGDKEV++DPNF+L+L+T L+NP+Y P++F K++VINY+ TL+GLEDQLLSV   F  K  ++Q   L++E S+NK LLK L DSLL EL TSTGNMLDNTELI TLE+TK++ASE  +KL +    + E    R+GYR  AKRGA+LFF L++M+ +N MYQYSL++YL +F+ SL++SL   NLQ+RL+N+++TLT NV+ Y    +F KHKLLF+  +T+K+E  +G + Q ELDF IK N S +  K +KP+ W+ D +WQD+TKL E+ P +FS L  DIE++  +WK W +   PE A  P  YS  L +FQKL LLRC R DR++RA+  YV   MG   V PP++NF  I+++ST FSPIVFI+S GSDP +D++K AE+SG   TK   I++GQGQE     LL+ A++ G WLILQNCHLLVKWL++LEK LE++T P+ +FR+W+TT   + FPIGILQ+S KVV EPP  +KLN+++TY KI+  +L++  H AF SLV+ LAFFHAVVQER KYGK GW++P +FN+SDF   +++L TYL K  +QGDS IPW SL+YLIGEV+YGGRAID FDRRIL+ YMDEYFGDFLF  FQ FHF+ +K   Y IP    G   +   IE +PL  TPEV GL S  EIGYYT A +EMW+ L  +QP+T + G     DE I+  A  I+ +LP+LFD++ + ++ G D+SPT VVLLQEL RFN LV  M +S+  L+RAL GEVGMS E DD+A +  N  +P +WKRLAP+TLKSL +W++H   RY QYS W V  GEP VMWLSGLH+PESYL A+VQA CRK GWPLD+ST +T VT++ T  ++ +R  Q C++ GL+LEGA WD    CL R KPK L+  LP++KVIP++ + L+ +NT  TPVY TS RRNA G GLV EADL TT H SHWVL GVCL LN+D
Sbjct: 2864 LEEIDKNQTI---SFAKPPKQVQVVCECILVLRGKKELNWLTAKKMMSEAGFLHSLMQMDCDSISNSHISTIK-FLKNLQTSVEEMQSISKAGSGILKFVESFMSYWDIAKEVQPKKDQVKRLEKEFLQSKAELECIKNDLNNMQKEASSLKEKYEDANLEKELQLDEAKLMERRLTAADKLVLGLTSE-REWTKDLEELKQQHECLLGDCLIAAAFLSYAGAFNWDFRNNMVYDKWTQDVKQKGIPLSQPFKIENFLTNQLEIS-WGSEGLPPDEQSVQNGILTTKGSRFPLCIDPQQQALNWIKNKEKDNNLKQVSSLNDPDFLKQLELSIKYGYPFLLQDVNEDIDPIIINVLERNVVVSEGRTVIVLGDKEVNYDPNFKLFLHTTLANPQYSPSVFEKALVINYS-TLRGLEDQLLSVTTGFLEKVFQQQHLLLVEEISENKTLLKSLGDSLLMELGTSTGNMLDNTELIQTLEKTKTEASETIKKLSVAQSKTVEFANLREGYRPVAKRGAVLFFALSDMALVNRMYQYSLTSYLSLFELSLQESLAHPNLQQRLENIINTLTYNVHNY----LFGKHKLLFSMNMTVKIEQTEGGVPQKELDFLIK-NLSGDGTKVQKPHEWIPDQAWQDITKLAELFPEQFSSLPSDIEQNSTNWKSWWDLRAPEQAPFPLQYSESLSAFQKLLLLRCLRADRLHRAMADYVTVTMGN-CVHPPLINFTTIYERSTAFSPIVFIMSSGSDPTTDLIKFAEKSG---TKFTLIAVGQGQEQVVLKLLEKAVSIGSWLILQNCHLLVKWLKDLEKALEKITNPNINFRMWITTNAIDDFPIGILQKSQKVVAEPPEDIKLNMKATYSKISQQTLSSCQHPAFCSLVYVLAFFHAVVQERSKYGKTGWSVPCNFNDSDFSASLEVLSTYLTKCHEQGDSFIPWESLQYLIGEVVYGGRAIDSFDRRILKVYMDEYFGDFLFSPFQHFHFFRNKDVGYKIP--PPGRKHVYTEIEKMPLITTPEVAGLPSTVEIGYYTQAVEEMWTHLRVLQPET-QVGRGIGGDEHISHIAQDIQKQLPELFDINLVGEELGTDLSPTSVVLLQELRRFNKLVLCMQQSVVELLRALTGEVGMSKESDDLAHAFCNDLVPAMWKRLAPETLKSLDDWMSHLRRRYEQYSNWQVREGEPKVMWLSGLHVPESYLAAVVQAACRKKGWPLDQSTFHTEVTRYRTEDDIDDRLKQ-CYLSGLFLEGADWDMENGCLARSKPKVLVVELPILKVIPVQKNSLRLRNTLRTPVYTTSLRRNASGAGLVFEADLFTTMHTSHWVLSGVCLYLNSD 4176          

HSP 3 Score: 281.952 bits (720), Expect = 6.872e-75
Identity = 170/419 (40.57%), Postives = 249/419 (59.43%), Query Frame = 1
Query:  883 RAAVQARDEFLISLKKFTSIVDQTIIQIASEVKLEIPDLDLFENDKENLSDKEIMEMIESTVLKWDQQITGTLESLQKIVPHGPSPLAEIDFWRERNAXXXXXXXXXXXPKVKRILNLYSLAEGPV---FDTQNNELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIAWNLSDRVARLIDVNTIFNLPLEHVLKDTAEAEKMLRVWNDTYFEVRASIEASGRDARWEFDRKRLFEKTNYMADICHDLNEIAMILQEFYNIFGPELKSVTNEAKRIXXXXXXXXXXXXPLKEMPFNPFNLMKHKYDWSNFMEDFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEVESIDQL 2130
            RA VQ RD     +K+  +I+ +       E++L IPDLDL       ++  +++E +E  V+ W  QIT  L+  Q   P GP PL E+  W  R  +L AL EQLK P V++IL +  +A   +   F+    EL  +H+E+  N+++L  +ERHF ++  G +F    ++IP +M+ L+ +W+ SRHYN +ERMVPLMERIAW L + VA+ I V T+F    E V      A+++L  W  +YFE RA IE  GR +RWEFDR++LF+ ++YMA +C D++ +  +L+E YNIF PELK +    K I EV+ +V+ LV P + + FNPF +  +K  W   MEDF   V  IE +A   I+  F    S+  AFD+L+RF+  RSR AI+  +  KF D+++QY KEV    QL
Sbjct:  111 RAVVQPRD-----MKEAVNIMCKLFD--FDEIQLHIPDLDLEPEVDALITSPDMVENLEQCVMIWQTQITIVLQEQQSKQPEGPGPLPELTLWERRATVLGALTEQLKQPAVEKILKVLGMANAGIAQTFEGTIIELTNYHLESNSNSRYLKTMERHFLNLQRGAHFSLHLETIPTLMERLQTMWLSSRHYNSNERMVPLMERIAWQLCENVAQEIHVQTLFEKQKE-VKSQVFLAKQVLEKWKLSYFENRAEIEKLGRSSRWEFDREKLFKMSDYMASVCQDIHNVFQVLEELYNIFSPELKGM----KGINEVISRVDGLVLPFQRVSFNPFRI-SNKKTWKTIMEDFSVTVKDIEEEAAHIIDMFFTNTLSSAHAFDILMRFKQNRSRDAISLHLLGKFEDVLTQYCKEVNFAPQL 516          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 2078.52 bits (5384), Expect = 0.000e+0
Identity = 1241/3524 (35.22%), Postives = 1976/3524 (56.07%), Query Frame = 1
Query: 3535 LTKDPTVMDFYERIRDTIDRKEELLNQPVIRKIGFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDLSLIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSNHPIDQEEIEESDKLRQLFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIG---RDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYIL---GALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDL-TNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILG-SSDCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRT-NRVITKEAVFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHF-EGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKE-NKFE------NDTLAGLYKKYIPPTIDRV--IEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTREGMNQDTIEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYVHNPE--KKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGH-CQM--FSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTF----VQKAIEEQLSENAKSDKDYAMT---------DPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEAV--SPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRN--EASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVF-------------KNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAK-RKKPYLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLTKPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSK--IPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTGKSGSSQSRDEIINEKASGIKSKLPK---LFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGEPNVMWLSGLHIPESYLTALVQATCRKN-GWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMGVGLVVEADLATTEHPSHWVLQGVCLILNT 13923
            LT +P +  F  +I    D + ++ ++P    +G +++   +L + +     +W + Y    ++  +  L  I   I+     L+    DL++++  ++ I  I+   +  E +I  ++E Y +L     P+ +EE E+ + LR  +D L F S  V   L  ++ KF    +  +    ++ +NF   + ++GP  +G   +D+   L++   F ++   +  +        +LF + +T +P+L  ++ E+  L ++Y LY+   +    + + LW N++I+ ++  +  F    RK+P+ +K      +L   + EF +  PL   +  +A+  RHWK +   TG N D+  + F L ++   +  ++++ I +I  SA KE  IE+ ++EV   W    F+      G K RG +L    +  E++  L+D+ M L S+ ++R+  PF   +Q W + LS  S++++ WM+VQ  W+YLE +F+GGDI  QLP+EAK F +IDK++ KIMT   + P + Q+C     +  L  +L + L+ CQKSL  YL+ KR  FPRFFF+SD  LL ILG +SD   +Q H++ +FDNI S++F +     + A +  S E+E ME   P+  EG VE W+  +  E +R+ + VI + A+    E    + ++  +   V L   Q+ WT + E+        +    K     L N ++ ++      L   +R+K  T++ I VH RDI D   R  I +  +FEW  Q RFY+  ++D++ I      F Y  E++G   RLVITPLTDR Y+TL QAL M +GGAPAGPAGTGKTET KD+ + LG   VV NC + MD+R +G+IF GL Q G+WGCFDEFNRIE+ VLSV + Q+  +      +   F F +G  + ++   GIF+TMNPGYAGR ELPE++K  FR V ++VPD Q I  + L S GF+    LA K  TLY+L +EQLSKQ HYDFGLR + SVL   G  +R +P  +E  ++ R L+DMNL K I ED  LFL LI+DLFPG++  +  YP+   ++++ + E   I       K++Q+YET + RH  M +GP+G GK+  I+IL  + T+     + + MNPK  +  +++G LD  T DWTDG+ S ++R+  K   K E  +++ DG VDA+W+EN+NSV+DDN+ LTLANG+RI +  +C ++FE  ++  ASPATVSR GMV++    LG++P  + WL ++  N+ E      + + + LY+  +     ++  +E  +  Q +  L+ +IPL       + C     +L RE +     E ++I ++ WS G  L  + + K + + +    + +S  E  P        R  T+FDYY   +  +  W+ W+  V +Y++ P+   K+S ILVP +D VR  +L+    K  + VLL+GE GT+KT + ++F+   DP+  +   +NFSS TT L  QR +ES V+KR   +YGPP GK++ + IDD+NMP V+++G Q    +++ ++E++G Y+  K   +  + D+ FLAAM  PGGGRND+  R    FS+FN T PS +S+  I+  I  GH C    F +E++ T+P +  +T  ++    +++ PTP+KFHYIFNLRDLSRI+QGM  T  +          +W+HE  RVI DR    DD  +    + K +E+QL E  K   D  +           P   G+     +    ++YE + ++E+ K      + +Y++++  + M +V F DA+ HL ++ R IR  GG+ALLVGVGGSGKQSLT+LA++     IF+I L+R Y+  +L E+LK+LY   G + K   F++ D  + EE FLE +NN+LSSG V  LF  +E + I+S +    +       P+ E+++ YF+++   NLH+VLC SPVGE  R R   FP +++  T+DWF  WP+ AL  V+  F+   +       + E+V+        V E   ++  ++RR  +VTPK+YL FI  Y      K  + E + + +  GLQKL EAS  +A L+ +L +++  +       + +LKE+T + + +   K   Q+     +     I  +K  AE  L  A P LE+A  AL  ++ +D+  +R+ ++PP  +    +C+ +               N+   +W+ +  +M   SFL  L+    D I  +   +++   +     I+  R+ S    GLL +  A+  +  + +E+ P +  +A  E        +LEK + E+D  ++EL  +   YE A+ E+  L E+    +R++  A  LI+GL+ E +RW    +    Q  RL+GD L+ +AFLSY G F+ EFR  ++ + W+ ++ +R IP  +   + ++L +   +S+WN +GLP DELSI NGI+ T+A+RFPL IDPQ Q   WI  KE  N L+  + N   F   LE ++  G P L +DV E +DPV+DNVLEKN         V +GDKEVD    F+LY+ TKL NP Y P I  ++ +I++TVT++GLEDQLL  ++  E++E+E++R  L+++ + NKR +K+LED+LL  L ++ G+++D+  LI  L  TK  A EV++KL++   T  +I+  R+ YR  A RG+IL+F++ EMS +N MYQ SL+ +L +F  SL +S    N  +R+++++  +T  VY Y   G++E+HK LFT  +TLK++M   N+T  E    IKG  S+++    +KP  W+ D+SW ++ +L+++   +FS +L+ I   E  WK W + E PE   LP  Y + L  F++L L+RC+  DR       Y+ + MGE+Y    IL+ E   ++S P +P++  LS GSDP   ++ L ++    T   +++SMGQGQE +A+ LL   +A G W +LQNCHL + ++ EL   +      +  FRLW+TTE  + FPI +LQ S+K   EPP GLK  L+ TY  I    L+  N   +  +++ +AF H+ VQERRK+G +GWNIPY+FN++DF   +Q +Q +L    D  D+K  + W +++Y+IGE+ YGGR  DD+D+R+L T+   +F   +F+  + F+FY      Y IP+C + D  L YI+ LP  +TPEVFGLH NA+I + +  AK++   ++ IQP+   SG  ++R+  ++  A  +  KLP     F++ RL+K   L   P  + L QE++R   ++  +  +L  L  A+ G + MS  L D    +Y+ +IP  W +    +  +L  W T   +R  Q+  W+  G PN  W++G   P+ +LTA+ Q   R N GW LD+  L   VT++    ++     +G +V+GLYLEGA WDR+   L   KPK L + +PVI +   E + +K    +  P+Y    R +   +  +    L TT+ P HWVL+GV L+ + 
Sbjct:  657 LTTNPLLSKFESQIVYYQDLETKINSEPDYINVGALALFTASLKTSLTVETMQWMNDYQMCCNKKYQQELEQILAIIDEAGKKLNRPIKDLDDIRIAMAAIDKIRKDQISIELQIGPIEESYAMLNKYKFPVQKEEGEKVETLRLYWDKLMFRSTEVQSELETLQPKFKKELESNMIVLQEECQNFYQDYDKDGPMGVGLAPQDVSDRLIM---FQNQFDNLFLKYTTYCDGAKLFGITVTQHPQLMKIRTELTLLQKLYGLYNNVIETVNGYYDILWTNINIEKINNELLDFQTRCRKLPQALKEWQAFLDLKRTIDEFSECCPLLELMTSKAMMARHWKRITEVTGHNLDVESENFKLRNIMEADPLKYKEEIEDICISAVKERDIEQKLKEVITEWDNKTFT----FAGFKNRGELLLRGDSTSELIASLEDSLMVLGSLMSNRYNTPFKAQIQKWVQYLSNTSDIIEHWMIVQNLWIYLEAVFVGGDIAKQLPKEAKLFSSIDKSWMKIMTRAHEMPNVVQSCVGDVTMGQLLPHLLEQLDSCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVQFHEKIYDRILAVS--SREKETMELDRPITAEGNVEVWLNALLKESQRSLHLVIRQAALAIQNEGFELIDFLNSFSAQVGLLGIQMIWTRDSEEALTNAHYDRGIMSKTNQHFL-NLLNTLIDMTTKDLGAVERTKYETLITIHVHQRDIFDDLCRLHIDNPSDFEWLKQCRFYFNEDSDKMTINITDVSFDYQNEFLGCTERLVITPLTDRCYITLAQALGMCMGGAPAGPAGTGKTETIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMNPGYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPSDTESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIELNKEGYPELEAAIDKKIQETGLINHPPWKLKVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMTECGQPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLK-AKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQRSPNEAEVLRQLFSSSFSELYRFSVQSLEFKMDMLEAFVIMQCINMLQGLIPLK------EQCG----ELPREHL-----ERLYIFALMWSAGALLELEDRKKMELWFRGNDVIRRSLPEIPPG-------REETMFDYY---VTAEGHWVHWSTRVEEYIYPPDVTPKYSSILVPNVDNVRTDFLIDTISKQGKAVLLIGEQGTAKTVIMKSFMSKYDPEIQLGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGEFTNIVDVQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFGVIGEGHFCAQRGFIEEVQRTIPQLVLLTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMLCTNAEVINSVHVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQLGEEHKKVVDCGVERYFVDFLRDPPEATGEEPEESDFDMPKVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTRLYNTTNLMEDLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRRPPTNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVEVSHHFLSAFDIDCSPQVKSEVVQCMGSFQDCVAEKCVDYFLRYRRSTHVTPKSYLSFIQGY------KTIYVEKRAEVMNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAEASELVKVEVQKVKDKAQAIVDSITADKAIAEEKLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNPVEINAETNFITSSWQESLNLMTSGSFLSELKQFPKDTINEETVELLQPYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLPLKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRS-LLLNEWQCELKQRSIPFGNNLDITELLIDASTVSEWNLQGLPNDELSIHNGIIVTKAARFPLLIDPQTQGKTWIKNKEAKNELQITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNVLEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVILTEKREMEKERTDLLEDVTYNKRKMKELEDNLLYRLTSTQGSLVDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLARSSKSSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHKEFLTLIKGGASLDLKTCPQKPAEWILDMSWLNLVELSKL--WQFSEILDQISHHEKLWKSWFDKEAPEEEVLPNSYQS-LDCFRRLLLIRCWCPDRTIAQARKYIRDAMGEKYTEGVILDVEGTWEESNPRTPLICFLSMGSDPTDSIIALGKKLKIET---RYVSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLNFMDELMDTVIETECINDSFRLWITTEVHKNFPITLLQMSIKFTNEPPQGLKAGLKRTYGGINQDLLDVSNTNQWKPMLYCVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHL----DDMDTKQLVSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVWFNKNMFE--RDFNFYKG----YGIPKCSSVDQYLAYIQGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSSSGGGETREAAVSRMADDMLEKLPPDYIPFEVKRLQKMGPL--KPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIPARWMKSWASS--TLGFWFTELLERNRQFQTWLFKGRPNCFWMTGFFNPQGFLTAMKQEIARANKGWALDRMVLCNEVTKW-MKDDIPHPPAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWMYA-ENNVVKDPRLYSCPIYKKPTRTD---INCIASVGLKTTQPPEHWVLRGVALLCDV 4112          

HSP 2 Score: 77.0258 bits (188), Expect = 7.176e-13
Identity = 105/494 (21.26%), Postives = 208/494 (42.11%), Query Frame = 1
Query: 1135 SPLAEIDFWRERNAXXXXXXXXXXXPKVKRILNLYSLAEGPVFDTQ---NNELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIAWNLSDRVARLIDVN---TIFNLPLEHVLKDTAEAEKMLRVWNDTYFEVRASIEASGRDARWEFDRKRLFEKTNYMADICHDLNEIAMILQEFYNIFGPELKSVTNEAKRIXXXXXXXXXXXXPLKEMPFNPFNLMKHKYDWSNFMEDFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQ-KFNDIMSQYEKEVESIDQLFKTNMNNPPLYHFKSCVAGGISWERHLFYNIKRPILRFLTMDEMMQSDNGKRIRTKYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILALANSENFVSENVPEETIDKMDDDLRVDFGFEINEIITETRNLELLGYKVPELARNVALQDEY 2595
             P AE+++W++R +  S LLEQLK P V+ IL +  LA+  + ++    +  +     EAK+N K++  +E  ++ + Y  +       IP ++ A+R I  +SR+YN  E++  L   +   +       I  N   +I++ P + +++    A  + +V           +E +  + +++F    +F K +        + ++  I+  +  +   +++ +   A R + +          L  M    ++ + H    +NF  DF +       Q   F+N+    ++  + A D+L +F+    R  I  L T  K+ DI+ +Y +++E +  +F+    +PP       +AG I W R L   I  P+  F     ++ +   K I   +  +   +  +E+   + W   V      L    ++ L  +                  +L V+F  E+   I ET  +  +  K+P  A  V  Q EY
Sbjct:  119 GPRAELNYWKKRMSRFSYLLEQLKSPHVRTILRVLGLAKSKLIESWIEIDRRITVASNEAKNNVKYVYSLETFYEPL-YKCD---PVRKIPSLINAIRTIHNVSRYYNDSEKITTLFLLVTNQMVSSCKAYITNNGCDSIWDQPRQEIIRKIKAAIHLNQVLKPR------ELEQAPLERQFDFSEAYIFWKFDAFQSRMEKILKMFNIISTYSVLQDSKIEGLETIATRFKPI----------LMSMKNKSYSFLDHSA--TNFETDFEQFCKRTSEQLEKFMNDTIENIQDTQRALDVLHQFE----RLGIPDLGTDTKYQDILLKYGQDIEWVSDIFEKEKLDPPFERDLPPMAGRIMWARILSRRITDPMNFFQQQPGVLSTQEAKNIIKNFNRMTEILLEYEKLHHHNWMTKVTDARLGLEATLLVRLGET-----------------GELFVNFDPELLIQIMETNCMARMNLKIPPFAA-VLQQKEY 568          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Medaka
Match: dnah12 (dynein axonemal heavy chain 12 [Source:NCBI gene;Acc:101164478])

HSP 1 Score: 1855.88 bits (4806), Expect = 0.000e+0
Identity = 1166/3356 (34.74%), Postives = 1830/3356 (54.53%), Query Frame = 1
Query: 4210 LNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKAR----------ENWAETLWKNLDIKVLDEGIEGFLKEWRKMPR--EVKAMVTARNLA------------------------------EKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFT-LSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQ-----LHTKLI--PMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFEN----DTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQL---TREGMNQDTIE----AIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDKPA--KAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQY-VHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTA-VSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHC---QMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSE--NAKSDKDYAM-----------TDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEA-VSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLK-TLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVR--NEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEK-NDVVEIRSFAKPPKPVQVVSECIAVFKNYKEIN--------------WKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDS-LDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEK--LKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKRKKPYLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLE--RLTKPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHT-----AFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTGKSGSSQSRDEIINEKASGI-KSKLPKLFDLDRLRKKYGLDISPTI-VVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGEPNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAM-----GVGLVVEADLATTEHPSHWVLQGVCLILNTD 13926
            +N  E  +   IT YPE+  ++++M+   +++E     +             + W +  + +L+ + ++  ++ F +E  KM +  + K    A+ +A                              E++++FKD +P+ S L +  LR RHW+++    G  FD+ P+  T L  +  ++L  F +    I  +ASKE S+EK ++ + + W  + F  QP+   G     I  ALD++  +LDD  +  Q+M  S F+ PF   ++ WE+ L  I E +D W+ +Q +W+YLE IF   DI  Q+PEE + F  +D+ +++IM    K   + QA  +P  L  L + +  LEK  K LN YL+ KR  FP +             SS+ E V+     +  NIS+                  SE             G VE W+ ++E  M  + R I   +  +  E   R QW+ ++ G V LCT+QI+WT EV              LK Y + L NQ++EIV  VR  L K  R+ L  ++ IDVHARD+V   + + + D  +FEW +QLR+YW+ +   + I  C     Y YEY+G + RLVITPLTDR Y TL  A  + LGGAP GPAGTGKTETTKDLAKAL + CVV NC +G+DY ++GK F GL   GAW CFDEFNRIE+ VLSV++ Q+  IQ  ++ KL  F FEG  +KL+    + ITMNPGYAGR+ELP+++K  FR V ++VP+   I EI L+S GFL+AK L+ K+   YRL  EQLS Q HYD+G+RA+K+VL+ AG L+   P+ +ED +L+R+++D+N PKF+  D PLF G+  DLFPG+  P   Y  F ++ EEC   H         DK++Q YE M  RH  M+VG +  GK+ V+ +L  + + +         K+I   +NPK  ++ +L+G  D  + +WTDG+++N FRE     +  +R++++FDG +D LW+E+MN+V+DDNK L L +GE I++ N  +L+FE  DL  ASPATVSRCGM+Y++P  LG+ P    W+N   +  ++      +  L+   IPP++      M+     E    ++P TN + V  LC +    L    + G + ++I     A F  S+ WS+GGC   DS+ KF+ FI+   +  ++ E   P   +  E P     L   YF   +EK  WI W + +    +     K  EI+VPTIDTVR T+L+   I  Q P+L VG TGT K+  V    L N D D Y+   INFS+ T++   Q  + S ++KR K  +GPP+GKR ++F+DD+NMP  +Q+G Q P+ +L+  L+  G YD  KD +   + D+ F+AAMG PGGGRN V  RF+   ++ +   P          S +        +FS E       I    M +Y + +  L PTP+K HY FNLRD SR+ QG                R++ HE  RV  DRL++D+D+T++ + +   + +  N   D+ +                +LFGDY N     + RLY ++ + E    + +  +EEY++   + M LV+F   L+HL+RI R ++  GG+ALLVGVGGSG+QS+T+LA       +F+  +S+ Y   + R++LK  L    G++ + TVF+  D  + +E FLE I+++L++G VP LF  DE++ II  +R   +A    +  S  +++ +FV +C  NLH+V+  SP+G+  R R R FP ++N  TIDWF PWPE+AL  VA+ F+  E+  + +++R E++      H S  + S +F  +  R NY+TP +YL+ I T+ +L+  K +   +   R   GL +LA A  ++A++  +L   +  + +  I    +++ I   +     K ++     +   +++ E +  K E E  L EALP LE A  ALD L++ +D+  +++   PP  V++V   + V KN K                 W  +K ++ D +FL+ L+  D DNI +     +R+  +        ++ + S A  GL K++TA+  Y  VA+ + PK+ K+A  +++    K  L++ + E+ ++E  L  L + +E   +E+ RL+ + +   R+L  A+KLI GLS E K W      L++    L GD L+ +  ++Y+G F+  FR+      W      + IP SD F L   L N +EI  WN  GLP D  SI NG++  R SR PL IDPQ QA  W+   E+ NNL      D D+++ LE  I++G P L ++V E +DP ++ +L K     QG E + LG++ +++  +FR Y+ T+L NP Y P +  K  ++N+ +T +GLEDQLL ++V  +  ELEE+R  LI ++++NKR LK++EDS+L  L +S GN+L++   I  L+  K  ++E+++K  +++  +T  +I + R+GYRE AK  +ILFF +A+++ I+ MYQYSL  +++++  S+ + +    L++RL+ +    T N+Y   C  +FEK KLLF+F +   L + +  +   +L F + G   ++         WL D SW ++ + +E+   +    LE   ++   +K   +   P +  LP  +  KL   QK+ + RC R D +  A+T +V   +G+++V PP  +  +    S    P+VF+LSPG+DP + ++K A       ++ + IS+GQGQ   A  ++  A+  G W+ LQNCHL V W+  LEK  E   LT  H DFRLWLT+ P+  FP+GILQ  +K+  E P GL+LNL  +Y    +S  N FN        +  L+F L FFHA+VQER+K+G +GWNIPY FNESD  + ++ LQ ++ +       K+P+ ++ YL GE  YGGR  DD+DRR+L T + +++ +   D  + F +  S    Y  P   + +D +++IE+LP+   PEVFGLH N +I       K ++  L+  Q      G S   D  + + A+ I   +LP  FD + +  KY +    ++  VL+QE+ER+N L   +  SL  L++AL G V M +EL+ VA +L  G++P+ W + +  +LK L ++IT F  R      W ENG+P V WLSG    +++LT ++Q   RK   P+D  T    V     +    E    G +V+GL+L+GA WD+ +  L    P+ L  S+P+I V P + + ++  + ++ P+Y TS+R+  +         V+   L+T + P HW+ +GV ++L  D
Sbjct:  437 INKEEAFYKWEITCYPEVKAMKEQMEPYQKVFECILKWQHTESINLTFHTLLKRWMDGSFLDLNGETMETQVDEFYREIYKMLKFFQQKQSKAAQEVAKTYGKAEGQPDEKNSSKQECPTVNLCSIVIEQIQKFKDYIPVVSILCNPGLRGRHWEKMSQIAG--FDLTPNFGTSLRKLLQLKLEPFLEEFETISVAASKEFSLEKAMQTMTQVWDGVSFHHQPHKDTGVS---IFTALDDIQMMLDDQIVKTQTMMGSPFVKPFQSEMKQWEERLLHIQESIDEWLKLQAQWLYLEPIFSSQDIMQQIPEEGRLFQTVDRNWREIMGHCVKDSKVLQATSLPGLLERLQDSNALLEKIMKGLNAYLEKKRLFFPMY-------------SSEGERVE-----LIQNIST------------------SEAN-----------GAVEKWLLQLEDGMISSVRDIIDRSRAY--EKTARNQWVKEWPGQVVLCTSQIFWTLEVHKAL---------GLKKYYQQLQNQLNEIVELVRGELPKQTRTTLGALVTIDVHARDVVKDLI-EKVSDETDFEWLAQLRYYWMNDNVRVHIINC--DVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFHLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQVLCIQRAIMHKLEYFDFEGTMLKLNPNCFVSITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSAKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLLAAGNLKLKFPNENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGVSLPVADYKLFLEAAEECCKIHNVQPTKVFTDKLIQTYEMMIVRH-FMLVGESFAGKTKVLHVLADTLSLMNERGHGEEEKVIFRTLNPKSITMGQLFGQFDLVSHEWTDGVVANTFREF-ALAETPDRKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSNQMSLIFEANDLSQASPATVSRCGMIYMEPSQLGWKPLVISWINTLPDPLQSPDNRSLILDLFHWLIPPSLQ-----MLRRHCRE----VVPTTNSHTVVALCRLFKMILDEPVKTGPDDESIRTWIMAAFASSLVWSVGGCCDTDSREKFNDFIRQTVS-GKNKEHPIPETIERWECPINEKGLVYDYFYEFKEKGRWIHWNDTIENINLGEINTKGQEIIVPTIDTVRYTYLMDLCIS-QGPLLFVGPTGTGKSVYVKDKLLNNLDKDCYLPFFINFSAHTSANQTQNIIMSKMDKRRKGVFGPPLGKRYVLFVDDLNMPAREQFGAQPPVELLRQFLD-HGHYDL-KDTSKISLVDVQFIAAMGPPGGGRNAVTSRFLRHLNIISIN-PFSDDTMVHIFSSIVAFSMKKNLFSPEFVIVGNQIVTAMMEVYKKAMANLLPTPAKSHYTFNLRDFSRVIQGCLLLKKGSLEGKQTLIRLFVHEVYRVYHDRLVDDEDRTWLYQLMNSIVKDHFNVPFDQVFGQLKQGDKLEEKDMQNLLFGDYMNPDLEGDERLYTEVPSIETFAEVVKSCLEEYNQMHKNRMNLVIF-YLLEHLSRISRVLKQPGGNALLVGVGGSGRQSITRLATSMAHMTLFQPEISKNYGMTEWRDDLKQMLLRNAGVKGQKTVFLITDTQIKDEAFLEDIDSVLNTGEVPNLFAVDEKQEIIETIRPIAQAGKKSVELSPLTLFAFFVARCKENLHVVVAFSPIGKAFRKRLRQFPSLINCCTIDWFQPWPEEALERVANSFL--ESLEMSENERQEVITICKTFHTSANQLS-DFQAELGRYNYITPTSYLELIATFQQLISQKRETIMNAKQRYINGLDQLAFAESEVAKMKKELVDLQPKLEQAKIDNTKMMEVIEVESIEVEAKSRVVHVDEEAAAMKANEAQALKSECENDLAEALPALEAALTALDTLKQPSDISIVKAMKNPPSGVKLVMAAVCVMKNVKPDRIPDPAGTGKKILDYWGPSKKLLGDMNFLRDLKEYDKDNIPVPVMQTIRNEFMTNPDFDPSKVANASSAAEGLCKWITAMEVYDKVAKVVAPKKAKLAEAQESLAATKAVLDQKRAELKEVEDRLTALQKTFEEKTEEKARLEMQVESCARKLERAEKLIGGLSGE-KIWSKAADDLQNTYDNLTGDVLISAGVIAYLGPFTSGFRQNCT-KLWTTLCQSKNIPSSDDFSLSKTLGNPIEIRAWNIAGLPNDSFSIDNGVI-VRNSRRPLMIDPQGQANKWVKNLEKDNNLNVIKLTDGDYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLKQT-FKQGVESIKLGERVIEYSADFRFYVTTRLKNPHYLPEVATKVSLLNFMITPEGLEDQLLGIVVA-KEPELEEERTALILQSANNKRQLKEIEDSILETLQSSKGNILEDESAIQILDSAKIMSNEITKKQQIQIAEKTELKIAESREGYREVAKHSSILFFSIADLTNIDPMYQYSLIWFVNLYINSI-QDIKSKVLKQRLEYLKDHFTYNLYCNVCRSLFEKDKLLFSFLLCCNL-LARKEIEHSDLMFLLTGGIGLQNTVANPDPSWLQDKSWDEICRASELPGFQG---LEAFIKNPEDFKLIYDSREPCSIDLPAPWCEKLTDLQKMIIFRCLRPDMV-PAVTKFVTRNLGKKFVQPPAFDLTKSFLDSNSTIPLVFVLSPGADPMA-LLKFASDKKMDGSRFQSISLGQGQGPIAAKMIFTAMQNGSWVCLQNCHLAVSWMSNLEKICEDFSLTTCHQDFRLWLTSYPSPKFPVGILQNGVKMTNEQPTGLRLNLLQSYLTDPVSDPNFFNGCPDKKPVWEKLLFGLCFFHALVQERKKFGPLGWNIPYGFNESDLHISMRQLQQFVNEY-----DKVPFEAITYLTGECNYGGRVTDDWDRRLLMTTLADFYCE---DIIKTFRYPLSPSGKYFAPPKSSYEDYIQFIENLPISQQPEVFGLHENVDISKDLQQTKLLFDSLLLTQGGGAMGGVSSGGDNTLYDIANNILTQQLPPTFDREAVLLKYPVLYEESMNTVLVQEMERYN-LCSTICVSLQNLLKALKGLVVMDSELEAVAGNLIVGKVPEKWAKFSYPSLKPLGSYITDFLARLKFLQVWYENGQPKVFWLSGFFFTQAFLTGVMQNFARKYQIPIDLLTFDFEVLPIDKSETPPE---DGVYVNGLFLDGARWDK-EGVLTEQHPRILFDSMPIIWVKPEKKNMIQTDSLYVCPLYKTSERKGTLSTTGHSTNFVIAMMLSTKKRPQHWIKRGVAMLLQLD 3681          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 1803.49 bits (4670), Expect = 0.000e+0
Identity = 1217/3860 (31.53%), Postives = 1956/3860 (50.67%), Query Frame = 1
Query: 2701 EVKRTIRPGLRRLNWNSLGISDYIE--KCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFKLQSGNKFLKCKEF----------------FEFMESERTSD--FEHLGRKYSTIGPLITKLQGEIIGDRDVNPF---------------EKFQPFYEFWEKRIFDRVYNMVLKNLQDYQNMLRDENFPTCLFEVDLMLAGTDVIGNPQTTEIYKLAIQDLRDAVEATRVFIRWKRNSCIETTGMKIDGQDELFYFTFYLDIGNSVEITYFCEQIANYYRNIIGKL-----------RKYQDKWKKHKRVF-----------IPNKQAQIDKWLTKDPTVMDFYERIRDTIDRKEELLNQPVIRKIGFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDLSLIPCDLEELKALLSTIQTIQLLSLEFESRITDV-QERYRVLTLSNHPIDQEEIEESDKLRQLFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYIL---GALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDL-TNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILG-SSDCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRT-NRVITKEAVFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHF-EGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKE-NKFE------NDTLAGLYK---KYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTREGMNQDTIEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYVHNPE--KKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQM--FSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTF----VQKAIEEQLSENAKSDKDYA--------MTDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEAV--SPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRN--EASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVF-------------KNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKRKKPYLWLSDISWQDVTKLTEMIPIKFSMLL-EDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDR-IYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLTKPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSK--IPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTGKSGSSQSRDEIINEKASGIKSKLPK---LFDL---DRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGEPNVMWLSGLHIPESYLTALVQATCRKN-GWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMGVGLVVEADLATTEHPSHWVLQGVCLILNT 13923
            +V   I+PGL  L W SL I  Y+   K  L L    ++V  +  V   I+  L+E+    L  L   N  + C+E                 ++ M  E+ ++     L  ++ + G LI+K      G    +P                E+ Q     +  R  D +  M    L+    MLR ++F   +F VD++L+  D++ NP   ++ +   Q +   V  ++   +W ++       + +   DE    +   D   S       E +A  +R++ G +           R Y     ++K V               K  Q +  L+K  + + +Y+ +   I+ + + +N   +  +   ++ ++T+         +W + Y    ++  +  L  I   I+     L+    DL++++  ++ I  I+   +  E +I  + QE Y +L     P+ +EE E+ + LR  +D L F S  V   L  ++ KF    +  +    ++ +NF   + +               V   + D                +LF + +T +P+L  ++ E+  L ++Y LY+   +    + + LW N++I+ ++  +  F +  RK+P+ +K      +L   + EF +  PL   +  +A+  RHWK                                +  +I  SA KE  IE+ ++EV   W    F+      G K RG +L    +  E++  L+D+ M L S+  S +  PF   +Q W + LS  S++++ WM+VQ  W+YLE +F+GGDI  QLP+EAK F +IDK++ KIMT   + P + Q+C     +  L  +L + L+ CQKSL  YL+ KR  FPRFFF+SD  LL ILG +SD   +Q H++ +FDNI S++F +         A+ S E+E ME   P+  EG VE W+  +  E +R+ + VI + A+    E    + ++  +   V L   Q+ WT + E+        +    K     L N ++ ++      L   +R+K  T++ I VH RDI D   R  I +  +FEW  Q RFY+  ++D++ I      F Y  E++G   RLVITPLTD                            T KD+ + LG   VV NC + MD+R +G+IF  L Q G+WGCFDEFNRIE+ VLSV + Q+  +      +   F F +G  + ++   GIF+TMNPGYAGR ELPE++K  FR V ++VPD Q I  + L S GF+    LA K  TLY+L +EQLSKQ HYDFGLR + SVL   G  +R +P  +E  ++ R L+DMNL K I ED  LFL LI+DLFPG++  +  YP+   ++++ + E   I       K++Q+YET + RH  M +GP+G GK+  I+IL  + T  Q H ++  MNPK  +  +++G LD  T DWTDG+ S ++R+  K   K E  +++ DG VDA+W+EN+NSV+DDN+ LTLANG+RI +  +C ++FE  ++  ASPATVSR GMV++    LG++P  + WL ++  N+ E      + + + LY+   + +   +D ++E  +  Q +  L+ +IPL       + C     +L RE +     E ++I ++ WS G  L  + + K + + +    + +S  E  P        R  T+FDYY  +    + W+ W+  V +Y++ P+   K+S ILVP +D VR  +L+    K  + VLL+GE GT+KT + ++F+   DP+  +   +NFSS TT L  QR +ES V+KR   +YGPP GK++ + IDD+NMP V+++G Q    +++ ++E++G Y+  K   +  + D+ FLAAM  PGGGRND+  R    FS+FN T PS +S+  I+       C    F +E++ T+P +  +T  ++    +++ PTP+KFHYIFNLRDLSRI+QGM  T  +          +W+HE  RVI DR    DD  +    + K +E+QL E  K   D          + DP    +     +    ++YE + ++E+ K      + +Y++++  + M +V F DA+ HL ++ R IR  GG+ALLVGVGGSGKQSLT+LA++     IF+I L+  Y+  +L E+LK+LY   G + K   F++ D  + EE FLE +NN+LSSG V  LF  +E + I+S +    +       P+ E+++ YF+++   NLH+VLC SPVGE  R R   FP +++  T+DWF  WP+ AL   +  F+   +       + E+V+        V E   ++                 F+NT                     GLQKL EAS  +A L+ +L +++  +       + +LKE+T + + +   K   Q+     +     I  +K  AE  L  A P LE+A  AL  ++ +D+  +R+ ++PP  +    +C+ +               N+   +W+ +  +M   SFL  L+    D I  +   +++   +     I+  R+ S    GLL +  A+  +  + +E+ P +  +A  E        +LEK + E+D  ++EL  +   YE A+ E+  L E+    +R++  A  LI+GL+ E +RW    +    Q  RL+ D L+ +AFLSY G F+ EFR  ++ + W+ ++ +R IP  +   + ++L +   +S+W                                             NL+  + N   F   LE ++  G P L +DV E +DPV+DNVLEKN         V +GDKEVD    F+LY+ TKL NP Y P I  ++ +I++TVT++GLEDQLL                                     R + T   +++D+  LI  L  TK  A EV++KL++   T  +I+  R+ YR A  RG+IL+F++ EMS +N MYQ SL+ +L +F  SL  S    N  +R+++++  +T  VY Y   G++E+HK LFT  +TLK++M   N+T  E    IKG +       +KP  W+ D+SW ++ +L+++   +FS +L + I   E  WK W + E PE   LP  Y + L  F++L L+RC+  DR I +    Y+ + MGE+Y    IL+ E   ++S P +P++  LS GSDP   ++ L ++    T   +++SMGQGQE +A+ LL   +A G W +LQNCHL + ++ EL   +      +  FRLW+TTE  + FPI +LQ S+K   EPP GLK  L+ TY  I    L+  N   +  +++ +AF H+ VQERRK+G +GWNIPY+FN++DF   +Q +Q +L    D  D+K  + W +++Y+IGE+ YGGR  DD+D+R+L T+   +F   +F+  + F+FY      Y IP+C + D  L YI+ LP  +TPEVFGLH NA+I + +  AK++   ++ IQP+   SG  ++R+  ++  A  +  KLP     F++   +RL+K   L   P  + L QE++R   ++  +  +L  L  A+ G + MS  L D    +Y+ +IP  W +       +L  W T   +R  Q+  W+  G PN  W++G   P+ +LTA+ Q   R N GW LD+  L   VT++    ++     +G +V+GLYLEGA WDR+   L   KPK L + +PVI +     + +K    +  P+Y    R +   +  +    L TT+ P HWVL+GV L+ + 
Sbjct:  609 QVDEAIQPGLTYLTWTSLNIDKYLRDTKKALDLELLMNRVNDL--VEYRIDTILQEMSMVTLCVLPEDNP-VTCEELVHTTRELCKKQAQNLHYKSMLVEKAANELINMLMDEHQSEGHLISKTTLPQSGSTGPSPSLVKRKKKMDLKDVMEEEAQKLLSHFNHRNLDALLKMTRNTLE----MLR-KHFSQAVFRVDVVLSIPDIVINPALEKVQEALNQIVECVVSVSKGVGQWSKDR------LSLGKMDERCMISLEQDNSESA-----AEDVATTHRSLAGSISSASVIQAFPFRNYYKNVSENKEVLKLVSILSSSITSTKKFNQTNPLLSKFESQIVYYQDLETKINSEPDYIN---VGALALFTLTVETM---------QWMNDYQMCCNKKYQQELEQILAIIDEAGKKLNRPIKDLDDIRIAMAAIDKIRKDQISIELQIGPIEQESYAMLNKYKFPVQKEEGEKVETLRLYWDKLMFRSTEVQSELETLQPKFKKELESNMIVLQEECQNFYQDYDK---------------VYTTYCD--------------GAKLFGITVTQHPQLMKIRTELTLLQKLYGLYNNVIETVNGYYDILWTNINIEKINNELLDF-QTCRKLPQALKEWQAFLDLKRTIDEFSECCPLLELMTSKAMMARHWKR-------------------------------ITEDICISAVKERDIEQKLKEVITEWDNKTFT----FAGFKNRGELLLRGDSTSELIASLEDSLMVLGSL-MSNYNTPFKAQIQKWVQYLSNTSDIIEHWMIVQNLWIYLEAVFVGGDIAKQLPKEAKLFSSIDKSWMKIMTRAHEMPNVVQSCVGDVTMGQLLPHLLEQLDSCQKSLT-YLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVQFHEKYD---RILAVSSREKETMELDRPITAEGNVEVWLNALLKESQRSLHLVIRQAALAIQNEGFELIDFLNSFSAQVGLLGIQMIWTRDSEEALTNAHYDRGIMSKTNQHFL-NLLNTLIDMTTKDLGAVERTKYETLITIHVHQRDIFDDLCRLHIDNPSDFEWLKQCRFYFNEDSDKMTINITDVSFDYQNEFLGCTERLVITPLTDE---------------------------TIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFK-LAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMNPGYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPSDTESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIELNKEGYPELEAAIDKKIQETGLINHPPWKLKVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMTCGQPHREM-RMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKA--KKEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQRSPNEAEVLRQLFSSSFSELYRFSVQSLEFKMD-MLEAFVIMQCINMLQGLIPL------KEQCG----ELPREHL-----ERLYIFALMWSAGALLELEDRKKMELWFRGNDVIRRSLPEIPPG-------REETMFDYYVTA----EHWVHWSTRVEEYIYPPDVTPKYSSILVPNVDNVRTDFLIDTISKQGKAVLLIGEQGTAKTVIMKSFMSKYDPEIQLGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGEFTNIVDVQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFVIGEGHFCAQRGFIEEVQRTIPQLVLLTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMLCTNAEVINSVHVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQLGEEHKKVVDCGVERYFVDFLRDPPEATEEPEESDFDMPKVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTL-YNTTNLMEDLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRRPPTNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVE-SHHFLSAFDIDCSPQVKSEVVQCMGSFQDCVAEKCVDY-----------------FMNT---------------------GLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAEASELVKVEVQKVKDKAQAIVDSITADKAIAEEKLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNPVEINAETNFITSSWQESLNLMTSGSFLSELKQFPKDTINEETVELLQPYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLPLKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLV-DVLLATAFLSYSGPFNQEFRS-LLLNEWQCELKQRSIPFGNNLDITELLIDASTVSEW---------------------------------------------NLQITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNVLEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLG------------------------------------RVILTEKRSLVDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRPAT-RGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLASS-KSSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHKEFLTLIKGASLDLKTCPQKPAEWILDMSWLNLVELSKL--WQFSEILDQQISHHEKLWKSWFDKEAPEEEVLPNSYQS-LDCFRRLLLIRCWCPDRTIAQQARKYIRDAMGEKYTEGVILDVEGTWEESNPRTPLICFLSMGSDPTDSIIALGKKLKIET---RYVSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLNFMDELMDTVIETECINDSFRLWITTEVHKNFPITLLQMSIKFTNEPPQGLKAGLKRTY-GINQDLLDVSNTNQWKPMLYCVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHL----DDMDTKQLVSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVWFNKNMFE--RDFNFYKG----YGIPKCSSVDQYLAYIQGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSSSGGGETREAAVSRMADDMLEKLPPDYIPFEIQVRERLQKMGPL--KPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIPARWMKQESWASSTLGFWFTELLERNRQFQTWLFKGRPNCFWMTGFFNPQGFLTAMKQEIARANKGWALDRMVLCNEVTKW-MKDDIPHPPAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWMYA--ENNVKDPRLYSCPIYKKPTRTD---INCIASVGLKTTQPPEHWVLRGVALLCDV 4158          

HSP 2 Score: 64.3142 bits (155), Expect = 4.418e-9
Identity = 44/148 (29.73%), Postives = 82/148 (55.41%), Query Frame = 1
Query: 1054 IESTVLKWDQQITGTLESLQKI--VPHGPSPLAEIDFWRERNAXXXXXXXXXXXPKVKRILNLYSLAEGPVFDTQNNELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIAW 1491
            +E+ +  W QQI   L    ++  V     P AE+++W++R +  S LLEQLK P V+ IL +  LA+  + +  +  +     EAK+N K++  +E  ++ + Y  + +A+  ++P ++ A+R I  +SR+YN  E++  L+    W
Sbjct:  213 LEACMKGWIQQIELILSESNQLRKVTDDLGPRAELNYWKKRMSRFSYLLEQLKSPHVRTILRVLGLAKSKLIEEIDRRITVASNEAKNNVKYVYSLETFYEPL-YKCDPVAIVKAVPSLINAIRTIHNVSRYYNDSEKITTLLHYQQW 359          
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 1689.47 bits (4374), Expect = 0.000e+0
Identity = 1001/2729 (36.68%), Postives = 1557/2729 (57.05%), Query Frame = 1
Query: 5896 YMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHF-EGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQL---TREGMNQDTIEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYVHNPE--KKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGH-CQM--FSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGM-CQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTF----VQKAIEEQLSENAKSDKD---------YAMTDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEAV--SPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRN--EASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVF-------------KNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAK-RKKPYLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLTKPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSK--IPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTGKSGSSQSRDEIINEKASGIKSKLPK---LFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGEPNVMWLSGLHIPESYLTALVQATCRKN-GWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFL-------TPVYVTSQRRNAMGVGLVVEADLATTEHPSHWVLQGVCLILN 13920
            +M  NG  ++T      Y+TL QAL M +GGAPAGPAGTGKTET KD+ + LG   VV NC + MD+R +G+IF GL Q G+WGCFDEFNRIE+ VLSV + Q+  +      +   F F +G  + ++   GIF+TMNPGYAGR ELPE++K  FR V ++VPD Q I  + L S GF+    LA K  TLY+L +EQLSKQ HYDFGLR + SVL   G  +R +P  +E  ++ R L+DMNL K I ED  LFL LI+DLFPG++  +  YP+   ++++ + E   I       K++Q+YET + RH  M +GP+G GK+  I+IL  + T+     + + MNPK  +  +++G LD  T DWTDG+ S ++R+  K   K E  +++ DG VDA+W+EN+NSV+DDN+ LTLANG+RI +  +C ++FE  ++  ASPATVSR GMV++    LG++P  + WL K+ +  E + L  L+               +   +V+ L+  + +    ++ Q  NML   +    R  +NQ  +E ++I ++ WS G  L  + + K + + +    + +S  E  P        R  T+FDYY   +  +  W+ W+  V +Y++ P+   K+S ILVP +D VR  +L+    K  + VLL+GE GT+KT + ++F+   DP+  +   +NFSS TT L  QR +ES V+KR   +YGPP GK++ + IDD+NMP V+++G Q    +++ ++E++G Y+  K   +  + D+ FLAAM  PGGGRND+  R    FS+FN T PS +S+  I+  I  GH C    F +E++ T+P +  +T  ++    +++ PTP+KFHYIFNLRDLSRI+QGM C     R         +W+HE  RVI DR    DD  +    + K +E+QL E  K   D         +    P   G+     +    ++YE + ++E+ K      + +Y++++  + M +V F DA+ HL ++ R IR  GG+ALLVGVGGSGKQSLT+LA++     IF+I L+R    + L   LK+LY   G + K   F++ D  + EE FLE +NN+LSSG V  LF  +E + I+S +    +       P+ E+++ YF+++   NLH+VLC SPVGE  R R   FP +++  T+DWF  WP+ AL  V+  F+   +       + E+V+        V E   ++  ++RR  +VTPK+YL FI  Y  +  +K    +   +R+  GLQKL EAS  +A L+ +L +++  +       + +LKE+T + + +   K   Q+     +     I  +K  AE  L  A P LE+A  AL  ++ +D+  +R+ ++PP  +    +C+ +               N+   +W+ +  +M   SFL  L+    D I  +   +++   +     I+  R+ S    GLL +  A+  +  + +E+ P +  +A  E        +LEK + E+D  ++EL  +   YE A+ E+  L E+    +R++  A  LI+GL+ E +RW    +    Q  RL+GD L+ +AFLSY G F+ EFR  ++ + W+ ++ +R IP  +   + ++L +   +S+WN +GLP DELSI NGI+ T+A+RFPL IDPQ Q   WI  KE  N L+  + N   F   LE ++  G P L +DV E +DPV+DNVLEKN         V +GDKEVD    F+LY+ TKL NP Y P I  ++ +I++TVT++GLEDQLL  ++  E++E+E++R  L+++ + NKR +K+LED+LL  L ++ G+++D+  LI  L  TK  A EV++KL++   T  +I+  R+ YR  A RG+IL+F++ EMS +N MYQ SL+ +L +F  SL +S    N  +R+++++  +T  VY Y   G++E+HK LFT  +TLK++M   N+T  E    IKG  S+++    +KP  W+ D+SW ++ +L+++   +FS +L+ +   E  WK W + E PE   LP  Y + L  F++L L+RC+  DR       Y+ + MGE+Y    IL+ E   ++S P +P++  LS GSDP   ++ L ++    T   +++SMGQGQE +A+ LL   +A G W +LQNCHL + ++ EL   +      +  FRLW+TTE  + FPI +LQ S+K   EPP GLK  L+ TY  I    L+  N   +  +++ +AF H+ VQERRK+G +GWNIPY+FN++DF   +Q +Q +L    D  D+K  + W +++Y+IGE+ YGGR  DD+D+R+L T+   +F   +F+  + F+FY      Y IP+C + D  L YI+ LP  +TPEVFGLH NA+I + +  AK++   ++ IQP+   SG  ++R+  ++  A  +  KLP     F++ RL+K   L   P  + L QE++R   ++  +  +L  L  A+ G + MS  L D    +Y+ +IP  W + +  +  +L  W T   +R  Q+  W+  G PN  W++G   P+ +LTA+ Q   R N GW LD+  L   VT++    ++     +G +V+GLYLEGA WDR+   L   KPK L + +PVI +        +K+   +        P+Y    R +   +  +    L TT+ P HWVL+GV L+ +
Sbjct:    7 FMFTNGTYLMT----WCYITLAQALGMCMGGAPAGPAGTGKTETIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMNPGYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPSDTESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIELNKEGYPELEAAIDKKIQETGLINHPPWKLKVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMTECGQPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLK-AKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWL-KQRSPNEAEVLRQLFSSSF---------SELYRFSVQSLEFKMDMLEAFVIMQCINMLQGLIPLKVRLKLNQH-LERLYIFALMWSAGALLELEDRKKMELWFRGNDVIRRSLPEIPPG-------REETMFDYY---VTAEGHWVHWSTRVEEYIYPPDVTPKYSSILVPNVDNVRTDFLIDTISKQGKAVLLIGEQGTAKTVIMKSFMSKYDPEIQLGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGEFTNIVDVQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFGVIGEGHFCAQRGFIEEVQRTIPQLVLLTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMLCTNHSSRNIIFQVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQLGEEHKKVVDCGVERYFVDFLRDPPEATGEEPEESDFDMPKVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTRSGLLEGLIAYLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRRPPTNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVEVSHHFLSAFDIDCSPQVKSEVVQCMGSFQDCVAEKCVDYFLRYRRSTHVTPKSYLSFIQGYKTIYVEKRAEVQMLANRMNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAEASELVKVEVQKVKDKAQAIVDSITADKAIAEEKLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNPVEINAETNFITSSWQESLNLMTSGSFLSELKQFPKDTINEETVELLQPYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLPLKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRS-LLLNEWQCELKQRSIPFGNNLDITELLIDASTVSEWNLQGLPNDELSIHNGIIVTKAARFPLLIDPQTQGKTWIKNKEAKNELQITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNVLEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVILTEKREMEKERTDLLEDVTYNKRKMKELEDNLLYRLTSTQGSLVDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLARSSKSSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHKEFLTLIKGGASLDLKTCPQKPAEWILDMSWLNLVELSKL--WQFSEILDQVHHHEKLWKSWFDKEAPEEEVLPNSYQS-LDCFRRLLLIRCWCPDRTIAQARKYIRDAMGEKYTEGVILDVEGTWEESNPRTPLICFLSMGSDPTDSIIALGKKLKIET---RYVSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLNFMDELMDTVIETECINDSFRLWITTEVHKNFPITLLQMSIKFTNEPPQGLKAGLKRTYGGINQDLLDVSNTNQWKPMLYCVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHL----DDMDTKQLVSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVWFNKNMFE--RDFNFYKG----YGIPKCSSVDQYLAYIQGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSSSGGGETREAAVSRMADDMLEKLPPDYIPFEVKRLQKMGPL--KPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIPARWMKESWAS-STLGFWFTELLERNRQFQTWLFKGRPNCFWMTGFFNPQGFLTAMKQEIARANKGWALDRMVLCNEVTKW-MKDDIPHPPAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWMYAENNGSSEKKKKIVKDPRLYSCPIYKKPTRTD---INCIASVGLKTTQPPEHWVLRGVALLCD 2685          
BLAST of Dynein heavy chain 10, axonemal vs. Planmine SMEST
Match: SMESG000051829.1 (SMESG000051829.1)

HSP 1 Score: 9218.58 bits (23920), Expect = 0.000e+0
Identity = 4627/4627 (100.00%), Postives = 4627/4627 (100.00%), Query Frame = 1
Query:   46 MDDIRIVWIKNQLYNCLDITDDSIFEDFIDREDGENERALATYLNETQDEQHQAIIFYTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGDAENSIQKTEQREKDSAKANEENEVNIDKTDSNEQNGELXXXXXXXXXXXXXXXXXXXXXXNYIVLQMARTPLVNAEDTLCFFLVRTTDDMVVLPSNINEANSELPSYFESGTLKGDMLLLLSQLIHSVYDYMLSYHQHRVTSDLGMSRASTPASQGRIPKKSQSDGDKIESIDEKVHETRAAVQARDEFLISLKKFTSIVDQTIIQIASEVKLEIPDLDLFENDKENLSDKEIMEMIESTVLKWDQQITGTLESLQKIVPHGPSPLAEIDFWRERNAXXXXXXXXXXXPKVKRILNLYSLAEGPVFDTQNNELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIAWNLSDRVARLIDVNTIFNLPLEHVLKDTAEAEKMLRVWNDTYFEVRASIEASGRDARWEFDRKRLFEKTNYMADICHDLNEIAMILQEFYNIFGPELKSVTNEAKRIXXXXXXXXXXXXPLKEMPFNPFNLMKHKYDWSNFMEDFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEVESIDQLFKTNMNNPPLYHFKSCVAGGISWERHLFYNIKRPILRFLTMDEMMQSDNGKRIRTKYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILALANSENFVSENVPEETIDKMDDDLRVDFGFEINEIITETRNLELLGYKVPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISDYIEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFKLQSGNKFLKCKEFFEFMESERTSDFEHLGRKYSTIGPLITKLQGEIIGDRDVNPFEKFQPFYEFWEKRIFDRVYNMVLKNLQDYQNMLRDENFPTCLFEVDLMLAGTDVIGNPQTTEIYKLAIQDLRDAVEATRVFIRWKRNSCIETTGMKIDGQDELFYFTFYLDIGNSVEITYFCEQIANYYRNIIGKLRKYQDKWKKHKRVFIPNKQAQIDKWLTKDPTVMDFYERIRDTIDRKEELLNQPVIRKIGFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDLSLIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSNHPIDQEEIEESDKLRQLFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTREGMNQDTIEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSENAKSDKDYAMTDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKRKKPYLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLTKPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTGKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGEPNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMGVGLVVEADLATTEHPSHWVLQGVCLILNTD 13926
            MDDIRIVWIKNQLYNCLDITDDSIFEDFIDREDGENERALATYLNETQDEQHQAIIFYTEIKEKEIEEEIEIDAFEIDDNNEENVNNCDENTNEVNEEGDAENSIQKTEQREKDSAKANEENEVNIDKTDSNEQNGELITENEEIKQKEIKIMKKIIKKINYIVLQMARTPLVNAEDTLCFFLVRTTDDMVVLPSNINEANSELPSYFESGTLKGDMLLLLSQLIHSVYDYMLSYHQHRVTSDLGMSRASTPASQGRIPKKSQSDGDKIESIDEKVHETRAAVQARDEFLISLKKFTSIVDQTIIQIASEVKLEIPDLDLFENDKENLSDKEIMEMIESTVLKWDQQITGTLESLQKIVPHGPSPLAEIDFWRERNALLSALLEQLKLPKVKRILNLYSLAEGPVFDTQNNELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIAWNLSDRVARLIDVNTIFNLPLEHVLKDTAEAEKMLRVWNDTYFEVRASIEASGRDARWEFDRKRLFEKTNYMADICHDLNEIAMILQEFYNIFGPELKSVTNEAKRIEEVLQKVEELVQPLKEMPFNPFNLMKHKYDWSNFMEDFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEVESIDQLFKTNMNNPPLYHFKSCVAGGISWERHLFYNIKRPILRFLTMDEMMQSDNGKRIRTKYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILALANSENFVSENVPEETIDKMDDDLRVDFGFEINEIITETRNLELLGYKVPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISDYIEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFKLQSGNKFLKCKEFFEFMESERTSDFEHLGRKYSTIGPLITKLQGEIIGDRDVNPFEKFQPFYEFWEKRIFDRVYNMVLKNLQDYQNMLRDENFPTCLFEVDLMLAGTDVIGNPQTTEIYKLAIQDLRDAVEATRVFIRWKRNSCIETTGMKIDGQDELFYFTFYLDIGNSVEITYFCEQIANYYRNIIGKLRKYQDKWKKHKRVFIPNKQAQIDKWLTKDPTVMDFYERIRDTIDRKEELLNQPVIRKIGFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDLSLIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSNHPIDQEEIEESDKLRQLFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTREGMNQDTIEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPSKSSLFSIYSSILSGHCQMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSENAKSDKDYAMTDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSKEIEKEKGEAEAALVEALPVLEQARLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFERKELEEQRERLIQETSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKRKKPYLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLTKPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTGKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGEPNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMGVGLVVEADLATTEHPSHWVLQGVCLILNTD
Sbjct:    1 MDDIRIVWIKNQLYNCLDITDDSIFEDFIDREDGENERALATYLNETQDEQHQAIIFYTEIKEKEIEEEIEIDAFEIDDNNEENVNNCDENTNEVNEEGDAENSIQKTEQREKDSAKANEENEVNIDKTDSNEQNGELITENEEIKQKEIKIMKKIIKKINYIVLQMARTPLVNAEDTLCFFLVRTTDDMVVLPSNINEANSELPSYFESGTLKGDMLLLLSQLIHSVYDYMLSYHQHRVTSDLGMSRASTPASQGRIPKKSQSDGDKIESIDEKVHETRAAVQARDEFLISLKKFTSIVDQTIIQIASEVKLEIPDLDLFENDKENLSDKEIMEMIESTVLKWDQQITGTLESLQKIVPHGPSPLAEIDFWRERNALLSALLEQLKLPKVKRILNLYSLAEGPVFDTQNNELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIAWNLSDRVARLIDVNTIFNLPLEHVLKDTAEAEKMLRVWNDTYFEVRASIEASGRDARWEFDRKRLFEKTNYMADICHDLNEIAMILQEFYNIFGPELKSVTNEAKRIEEVLQKVEELVQPLKEMPFNPFNLMKHKYDWSNFMEDFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEVESIDQLFKTNMNNPPLYHFKSCVAGGISWERHLFYNIKRPILRFLTMDEMMQSDNGKRIRTKYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILALANSENFVSENVPEETIDKMDDDLRVDFGFEINEIITETRNLELLGYKVPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISDYIEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFKLQSGNKFLKCKEFFEFMESERTSDFEHLGRKYSTIGPLITKLQGEIIGDRDVNPFEKFQPFYEFWEKRIFDRVYNMVLKNLQDYQNMLRDENFPTCLFEVDLMLAGTDVIGNPQTTEIYKLAIQDLRDAVEATRVFIRWKRNSCIETTGMKIDGQDELFYFTFYLDIGNSVEITYFCEQIANYYRNIIGKLRKYQDKWKKHKRVFIPNKQAQIDKWLTKDPTVMDFYERIRDTIDRKEELLNQPVIRKIGFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDLSLIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSNHPIDQEEIEESDKLRQLFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTREGMNQDTIEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPSKSSLFSIYSSILSGHCQMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSENAKSDKDYAMTDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSKEIEKEKGEAEAALVEALPVLEQARLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFERKELEEQRERLIQETSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKRKKPYLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLTKPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTGKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGEPNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMGVGLVVEADLATTEHPSHWVLQGVCLILNTD 4627          
BLAST of Dynein heavy chain 10, axonemal vs. Planmine SMEST
Match: SMESG000073407.1 (SMESG000073407.1)

HSP 1 Score: 2975.27 bits (7712), Expect = 0.000e+0
Identity = 1592/3417 (46.59%), Postives = 2251/3417 (65.88%), Query Frame = 1
Query:  589 FLVRTTDDMVVLPSNINEANSELPSYFESGTLKGDMLLLLSQLIHSVYDYMLSYHQHRVTSDLGMSRASTPASQGRIPKKSQSDGDKIESIDEKVHETRAAVQARDEFLISLKKFTSIVDQTIIQIASEVKLEIPDLDLFENDKENLSDKEIMEMIESTVLKWDQQITGTLESLQKIVPHGPSPLAEIDFWRERNAXXXXXXXXXXXPKVKRILNLYSLAEGPVFDTQNNELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIAWNLSDRVARLIDVNTIFNLPLEHVLKDTAEAEKMLRVWNDTYFEVRASIEASGRDARWEFDRKRLFEKTNYMADICHDLNEIAMILQEFYNIFGPELKSVTNEAKRIXXXXXXXXXXXXPLKEMPF-NPFNLMKHKYDWSNFMEDFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEVESIDQLFKTNMNNPPLYHFKSCVAGGISWERHLFYNIKRPILRFLTMDEMM-QSDNGKRIRTKYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILA--LANSENFV---SENVPEETID---KMDDDLRVDFGFEINEIITETRNLELLGYKVPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISDYIEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFKLQSGNKFL--KCKEFFEFMESERTSDFEHLGRKYSTIGPLITKLQG--EIIGDRDVNPFEKFQPFYEFWEKRIFDRVYNMVLKNLQDYQNMLRDENFPTCLFEVDLMLAGTDVIGNPQTTEIYKLAIQDLRDAVEATRVFIRWKRNSCIETTGMKIDGQDELFYFTFYLDIGNSVEI----TYFCEQIANYYRNIIGKLRKYQDKWKKHKRVFIPNKQAQIDKWLTKDPTVMDFYERIRDTIDRKEELLNQPVIRK------IGFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDLSLIPCDLEELKALLSTIQTIQL-LSLEFESRITDVQERYRVLTLSNHPIDQEEIEESDKLRQLFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGG-KERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLT--------------REGMNQDT-----IEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNE-EDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSENAKSDKDYAMTDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEA-VSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRL 10698
            +++R+  + +    ++  AN  LP YFE G +  + L     +++ +Y+ ML YH   V                  P KS   G KI+  +EK+ E +     RDEF+I++ K+  I+D+T   +    KL IPD ++ +  +  + DK +   I+ST+ +W+  I   L++          PL  I +WR R+ L+++++E+LK+P ++ + ++Y+       +     LN  + E KDN +FL ++ERHFK+I YGVNF  V D++ P+ Q+LR+IW ISR YNKDERM PL+ +I W + DRV  ++D+  +F+  +  ++     A K+L  +   Y   RA++EA  +  RWEFDR  LF  + YM +IC DL E+A   +EFY++FGPELK++T E++ + +VLQ V+ L Q L+   F +PF L K+   W    E+F  +V +I+ +A  FIN+ F  +     AFD+L +F+ I++R AI  L+ +K+ D++  + KE+  +D LF+     P +  +    +G I W R + + +K P+LRF++   ++ +S+ G +I+ +YLNVGR +R +EE  +  W   V   +S++L + IL       ++       N   ET++   ++     V+F  ++  II E + +ELL   +PEL+R V+LQ+ +Y K V  L  ++  Y ++  S++S+ + +L + I+ +   +  G   LNW+SL   +YI  CN AL   E K+  + K  M IE  L  +    LF+  + + F     KEF ++ E  R +D E L  K +    LI+ LQ   E + D   N        Y   E R++  + NMV +NL  + N L  +      F VD +L   D++ +P  T++YK  IQ ++  +E TR FIRWKR +C     ++++  D +FYF++ L++    EI      F ++I++  RN+I    ++ +K  K+  +++ +KQ  +DKWL    T   + +++ + I +   +  Q +++K      IG I++ +  L   ++ + K W  +Y  +L ESA+    + +  IE     L++ P  L+++K  L+ ++ I   LS   ++ I ++ E+YR++ L    I   E + S  L + +  +    K   + + P K KF +   + I  F   +  F  +++  GPG+   +LD G  V+  F  E+  +E  R +L  +E+L +LPI+ YPEL +++ E++ L  +Y+LY  QK A + W+  LWK+++   + + + G+L +++KM +  K +  +R L  ++K+F DAL L  +LK+EALR+RHWK+LM  TG +FDI+PDTFTL SVFAMEL+RF D IA IV +A++EL+IEK + E+++ W    F+++ +      E  YILG+++EV QIL+D+ MNLQS+  SRF+ PF+  V + EK L+ IS+ LD WM+VQ++WMYLE IF   DI  QLP +AK+F +IDK++K IM  T +  ++   C    RL  L  L + LE CQK+LNDYLDSKRN FPRFFFISDDELLSILG ++ E VQEH+IKMFDNI +L        E     M S+E E M F   V  + R+E+WM  +E EMR++N+ ITKEAVF+Y   K RV WM DYQGMV L  NQIW+TWEVED F KIKKGQ+TA+K++ K + NQI EIV+ VRS +SKND  KL TVLIIDVHARDI+  F+RDSI++A+EFEWESQLRFYW R+ D I+I+QC+G+FGYGYEY GLNGRLVITPLTDRIYLTLTQALSM+LGGAPAGPAGTGKTET KDLAKALGLLCVVTNC EGMDY+S GK+ +GLCQCGAWGCFDEFNRI+VSVLSV++TQ+KTIQN LI+KL+ F FEG EIKL S VG+FITMNPGYAGRTELPESVK  FRPVVVI+PDL+ ICEIMLFSQGF +AK LA+KMTT+YRL+KEQLS+Q+HYDFGLRALK VLVMAG +RR +P++SE K+LMRALRDMNLPKFI++D PLF+GLIQDLFP  DCPR+ +P  + +V +      + VL  Q DK+VQL+E + TRH  MVVGPT GGKS VI+  C +  KL++ TKL  +NPK+R+V ELYG LDP +RDWTDGLLS+IFR+IN+ TDK ERR++LFDGDVD LW+ENMNSVMDDN+LLTL NGERIRLQ HC+LLFEVGDLQYASPATVSRCGMVYVDPKNLGY P+W  WL   + + +++ L  L+ KYIP  I+ + +G+   Q  ++LKT+I    ++L+ Q CNM   QL                +  N+ T     +EA+F+ +I WS G  ++ + + KF+  +K +C++P   E E+     G LP+  P LF+Y FD  E K  W  W++ +PQY +N  ++F+EILVPTI+T+++ W++ + + +Q P++L+G+TGTSKTA  QT +R  D  KY  + I+FSS TTSLD+QRNLE+N+EKR K  YGP  GK L+ FIDDMNMP +D+YGTQQPIAMLKL++E++G YDRGK+L WK+M+D+ ++AAMG PGGGRN VDPRFISLFSV      +  S+  I+ +IL+GH   FS +IK ++  IT +T+  Y +I +++ PTP+KFHY  NLRDLS+++QG+CQ+T+DRFTK++Q  R+WRHE  RV  DR+I ++DK  VQ  +   +         Y   +PIL+GDY       E RLYED+ +Y   K  FQE +E Y+E     + LVLFDDAL+HL  IHR +RMDGGHALLVGV GSGK+SL++LAA+      FEI+LS+GY E++ RE+LK +YNKL  EN   +F+FGDQHV +EGFLELINNML+ G+VP LF DDE+E ++  V ++ + +G   +KE IWQYF   C + LHIVL MSPVG TLR RCRNFPG+VNNT IDWF+PWPEQAL++VA   I P+N LIP      ++ H V +H SVE  S+ F  K RR NY+T  N++++I TYL LLE KD   E++  RL  GL KL   + Q+  LN K+A QK+ V EKTI+CE L+ EI   T+ AT KK++ +EKS  +  QSK I KEKGEAE AL  A+P LE A+ +LD+L+KNDV EIR+FA PPKPVQ+V E + +     EI+WK A+G+MAD +F++ LQT+DV+ I LK  N V+D++ K K+T +++R+ SKAG G LKF+ +VLG+ DVAREI+PK+E+V  LE+ F + ++ELE+++ E+ KLE +LK L ++++ A DE +RL +E  IMQR+L AA+KL  GL+SE  RW+ D+   + ++V LLGDCL+ SAFL+Y+G F++E+R  +V + W   +    IP S  F++
Sbjct:  171 YVIRSNLEKLPDCKDLTAANLILPKYFEVGNISINNLNSNIHIMNYIYNTMLRYHAQLV------------------PFKS---GTKIKKGNEKLQEKKHK-PIRDEFMIAMHKYNVIMDETKQAVVGNFKLPIPDNEVPDQLEAVIHDKLLCIKIKSTIAEWNSLIERILDNASLSRNTNAGPLELIVYWRHRSNLITSIIEELKMPYIQNVYHIYNAINKDGINFFQYILNLLY-ETKDNIRFLLVLERHFKNIQYGVNFDVVHDTLAPLFQSLRLIWTISRDYNKDERMFPLLYKIGWAICDRVRNVMDLTKLFDKSINDIIYLCKSAIKLLGSYETIYMTERANVEAMDQANRWEFDRNILFGNSRYMKEICQDLYEMAKSAKEFYHMFGPELKNITGESQTLGDVLQLVDSLFQHLRAEDFPSPF-LEKNVKQWKKLKEEFMDQVKNIDTKAEKFINDYFSHIHCPNSAFDLLEKFKSIQARPAILMLLDEKYMDVLRSFGKELVKLDMLFEDYNEKPRIGRYMPQNSGSIFWSRLILHTMKTPVLRFMSAKPLIFESEEGVKIKNRYLNVGRALRQYEETHYKSWYTNVMSSISQMLLQPILVKDFRKPQDICRIRKSNCNMETVELFSQLFPKYMVNFNNKLWVIIAEAKLMELLDLDIPELSRIVSLQEPHYLKTVLALETILERYDNIRMSVDSLTIVMLEEFIEVLLTLLDRGTFMLNWDSLPFDEYITNCNAALLKVEIKLKDLEKCNMQIENSLSRLKRVNLFRRTTFSPFHIQSAKEFIDYAEQCRENDCEILATKIN--NELISILQRLEESLYDTKTNECSLMNELYFRCEVRLYKELSNMVTRNLWSFVNSLSGKE---TFFYVDAILINADIVLHPVGTDLYKWLIQSIKGCLECTRFFIRWKRRTCKLCPSIRLENSDTMFYFSYLLEMNKCKEIKEPEMVFHQRISSLNRNVI----EFLEKLNKYTILWLQDKQNVVDKWLQTPRTTKHYEQKLLNLISKNRSV--QKILKKDNFHVKIGAIALRVVQLRFAIDANTKEWIKIYLRTLLESAQIMYYNTEKMIESRSEVLNMEPKTLDDMKQFLANMEEINGGLSEYIDNVILEIGEKYRIIRLYGDEIPSNEWDFSKHLHKRWKEILERVKVRTHEILPTKAKFANQIAKTIEMFRAKVAEFIHRYRTSGPGNESENLDRGYNVMSDFTKEVNELEAERLDLLKSERLLDLPISTYPELKDIKAEIEKLIPVYDLYMEQKNATQQWSCVLWKDVNTNEMMQEMNGYLGKFKKMNKITKMIPASRTLLAQMKDFNDALVLIKNLKNEALRDRHWKQLMETTGISFDIDPDTFTLDSVFAMELHRFADEIALIVVNATRELAIEKSIMEIKDVWRETIFTLKIFPSEALTEPSYILGSVEEVQQILNDHMMNLQSIGGSRFVVPFVNMVHHLEKELTTISDTLDAWMLVQKRWMYLESIFKSSDIARQLPNDAKRFHSIDKSYKAIMRHTFEVRLVMACCLTDKRLERLNILHEELEMCQKALNDYLDSKRNTFPRFFFISDDELLSILGGTEPEVVQEHVIKMFDNILNLNIVATVYNEKLIIGMTSTENENMNFLKSVRTDSRIEEWMGAVEFEMRKSNKRITKEAVFYYGYLKTRVSWMLDYQGMVVLAANQIWFTWEVEDTFNKIKKGQRTAMKEFGKKISNQISEIVYAVRSQISKNDMKKLETVLIIDVHARDIISGFIRDSIIEAEEFEWESQLRFYWERDIDCIRIRQCSGEFGYGYEYFGLNGRLVITPLTDRIYLTLTQALSMHLGGAPAGPAGTGKTETVKDLAKALGLLCVVTNCSEGMDYKSFGKLLSGLCQCGAWGCFDEFNRIDVSVLSVVTTQIKTIQNALILKLTTFSFEGHEIKLLSNVGVFITMNPGYAGRTELPESVKTLFRPVVVIIPDLEYICEIMLFSQGFQTAKDLARKMTTIYRLAKEQLSQQHHYDFGLRALKCVLVMAGGIRRENPEVSEKKLLMRALRDMNLPKFIYDDVPLFMGLIQDLFPKADCPRILHPHLSKAVIDYFELENFDVLPSQVDKVVQLFEILLTRHCVMVVGPTCGGKSTVIRAFCQALKKLKIKTKLYTINPKERTVNELYGTLDPASRDWTDGLLSSIFRQINQQTDKEERRFLLFDGDVDPLWIENMNSVMDDNRLLTLVNGERIRLQPHCSLLFEVGDLQYASPATVSRCGMVYVDPKNLGYKPYWIKWLFFHQPESDHEILKRLFDKYIPSLIELIFDGIFRSQQGKRLKTVIVQNPMSLMKQFCNMFSSQLPVQQEELLSSTYSRDYDDSNESTGDLEFLEALFLNAIIWSFGASIVSEDRDKFNDILKQICSLPNMEEDENYSVPKGYLPNSSPNLFNYTFDESEYK--WFNWSHFIPQYSYNSGERFTEILVPTIETIKIIWIVKKHLDLQIPIVLIGDTGTSKTASVQTLIRTLDKTKYSMMKIDFSSCTTSLDVQRNLEANLEKRAKGIYGPTPGKFLVTFIDDMNMPIIDKYGTQQPIAMLKLLIEKKGMYDRGKELTWKRMKDLSYVAAMGLPGGGRNTVDPRFISLFSVTYCPNLTLESMLKIFGAILTGHTFQFSPQIKKSIDKITSITIKAYEEIKLKMLPTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHMPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKV 3550          
BLAST of Dynein heavy chain 10, axonemal vs. Planmine SMEST
Match: SMESG000033128.1 (SMESG000033128.1)

HSP 1 Score: 2307.72 bits (5979), Expect = 0.000e+0
Identity = 1466/4442 (33.00%), Postives = 2409/4442 (54.23%), Query Frame = 1
Query:  901 RDEFLISLKKFTSIVDQTIIQIASEVKLEIPDLDLFENDKENLSDKEIMEMIESTVLKWDQQITGTLESLQKIV-PHGPSPLAEIDFWRERNAXXXXXXXXXXXPKVKRILNLYSLAEGP---VFDTQNNELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQAL----RMIWIISRHYNKDERMVPLMERIAWNLSDRVARLIDVNTIFNLPLEHVLKDTAEAEKMLRVWNDTYFEVRASIEASGRDARWEFDRKRLFEKTNYMADICHDLNEIAMILQEFYN----------IF----GPELKSVTNEAKRIXXXXXXXXXXXXPLKEMPFNPFNLMKHKYDWSNFMEDFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKL---MTQKF-NDIMSQYEKEVESIDQLFKTNMNNPPLYHFKSCVAGGISWERHLFYNIKRPILRFLTMDEMMQSDNGKRIRTKYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILALANSENFVSENVPEETIDKMDDDLRVDFGFEINEIITETRNLELLGYKVPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISDY-IEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFKLQSGNKFLKCKEFFEFMESERTSDFEHLGRKYSTIGPLITKLQGEIIG---------DRDVNPFEKFQPFYEFWEKRIFDRVYNMVLK-NLQDYQNMLRDE--NFPTCLFEVDLMLAGTDVIGNPQTTEIYKLAIQDLRDAVEATRVFIRWKRNSCIETTGMKIDGQDELFYFTFYLDIGNSVEITYFCEQIANYYRNIIGKLRKYQDKWKKHKRVFIPNKQAQIDKWLTKDPTVMDFYERIRDTIDRKEELLNQPVIRKIGFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDLSLIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSNHPIDQEEIEESDKLR----------QLFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVK-----AMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSS-DCECVQEHMIKMFDNISSLRFTKGTSLEMSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEA-VFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKI-KKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLS-RFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKL------QLHTKL-IPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTRE-GMN-QDT------IEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPW-ANLVPQYVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSENAKS--DKDYAMTDP----ILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEY--SEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVA-------SVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAE--ASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKRKKPYL--WLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLT--KPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHT-AFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTGKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQW-VENGEPNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATA-AEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMGVGLVVEA-DLATTEH-PSHWVLQGVCLILNTD 13926
            +++F + L++F S +     ++  +  L IP      + +    +K+ +  +E  ++ W +QI   L +           PL EI++W+ R   LS + +QL    VK I  +   A+      F    +E+     +A+ N KFL+ +    K + + ++     D IP M+  L    RMIW+ S HYN  + M  +  +++  +  R    +D++ IF+  +   +K           + D Y ++   +  +     W  D+  +F + +     C DL EI      F            IF    G E++ +      I ++    E  ++ L++      ++      W +    FR  V  +E    + I   F T+ + +   ++L  F H+++R+ I +    MTQ   N +M ++    + +       + +P +  +    AG   W R L   I+R +L       +  S +    R +Y  +   +     K   E+   +D+   + L   +L    S + +S+ +           L ++F   + ++  E    E L + VP  A ++ ++        E +L +V  Y+ ++++L + E  +  ++IK + + I+PGL ++ W+S G  +Y +  C +     + KV        DI +  + I +  + K+ S N+  +  EF +  E+ R           + +   +  L GEII           +D +  +++   Y     +  +  + + +K +L +    +  +  N P+ LF+V L L   D++  P   E+  +     ++ +E  +   R      I     K+  +  ++ F     I    EIT     I +  ++I   +++    W + + ++  NK+  I ++   +P V      I    +   + L+   +  + F+ ++   L + +  H + W+    N L   A  +L  + N ++     +S IP +LEEL       ++++LL    E R   +QE++  L      +D+ E++ SD +R          Q F     E++ +   +   K KF      +  DF K +      F+  GP +        L  +  F   L  ++ + QE+     LF +   P  E+  ++K++ N++ I++L    +     W    +  L    ++       ++  K  R++K      +   RN   ++ +F+  +PL +DL++EA+R+RHW ++  +  + FD     FTL  +  +  ++  ++I E+  +A+KEL+IE  ++ +E+ W +++  + P+ K  ++  ++L  +D++ Q LDDN   L +M  SRF+ PF   V  WE++LS I E +++ + VQR+W+YLE IF+G DIR QLP+E+  FD I+K ++ IMTE  +    +   +    L     ++  LE  QKSL+ YL++KRN FPRF+FIS+D+LL ILG S + + V  H+ K FDNI+SL+  K  S    A++M SS+ E + F+  + +EG VE W+  +E  MR T R + ++  +   + +  R +W+ ++ G + + ++QI WT +V    + + ++  K  L+   K     +++    +RS L+K  R K+ ++++I+VH RDI++   +    D   FEW SQLRFYW +E D+  I+Q    F YGYEY+G +GRLVITPLTDR Y+TLT AL ++ GG+P GPAGTGKTET KDL K+LG   +V NC EG+DY+S+G++F+GL Q GAWGCFDEFNRI + VLSV++ Q+ +I + L      +F F+G+ I L   VGIFITMNPGYAGRTELP+++K+ FRP+ ++ PD   I EI LF++GF   KVLAKK+ TLY LS +QLSKQ+HYDFGLRAL SVL  AG  +R +P + ++++L+ ++ DMNL K    D PLF G++ DLFPG+D P + Y +  +++E+C    +    +    K+VQLYET  +RH+ M+VG T  GKS   ++L ++  +L      Q    L  P+NPK  S+ ELYG  D NT +WTDG+LS++ R+    T  +E ++++FDG VD LW+E+MNSVMDDNK+LTL NGERI +    +LLFEV +L  ASPATVSRCGMVY D  +LG+ P+ + WL +K +    + L+ ++ KYI       I+  +    +E ++T    +  N V  LC + DC  T E G +  DT      IE  F   + WS+   + ED + K D +I+ +               G  P++  T+++Y+ D+  + + W  W   L   + +N    F +I+VPT+DTVR  +L+   +    PV+LVG  GT KT+V+   L   + D +  L IN S++T+S ++Q  +E+ VEKRTKD++ P  GKR+L F+DD NMP  D +G+Q P+ +++  ++    YDR K    K+++D+    AMG PGGGR  +  R  S F++ N TFP++S+L  I+ S+++   Q F +E+K    IIT+ T+ +YN ++++  PTP+K HY+FNLRD+S+I+QGM +T  D     +   R+W HE  RV  DR++ D DK     A  E LSE   S  D+ +    P     +FGDY ++ +      YED+ + E  K   +E+++EY  +  V  M LVLF DA++H+++I R IR   G+ LLVG+GGSG+QSLT+LAAY      F+I +S+ Y +++ R++LK LY + G++NK T+F+F D  VV+E FLE INN+LSSG +P L+  DE + + +Q+ +EA   G+  + +SI+ Y +++   N+H+VLCMSPVGE  R R R FP  VN TTIDWF  WP  AL  VA        +FIG E     D  +  +   F ++H SV + S+  + + +R NYVTP NYL+ ++ Y  LL +K K      ++L+ GL K+ E  A V++  +  + A +K+A+ +K   C++ L  I  + + A ++ +   +  + ++V   +  K +  A A L +A+P LE A  AL+ L K D+ EI+S+ KPP  VQ V E + + +   E  W  AK  + +  F++ L   D DNI+ +    +   + +     D +  VS A   L  +V A+  Y  V R ++PKR+++   E    + + +L   + ++D +  E+K L Q Y   +++++ L+++ +  ++ L+ A KL++GL+ E  RW   +  L++Q   L GDCL+ SAFLSY+G F  ++R+ +V  +W + + + +IP +  F   + L+N  +I  WN +GLP D  S++NG++ TR SR+PL +DPQ QA  WI Q  E   LK    + PDF++ LE+AI++G P L ++V E +DP +D +L K+I    G   + LGDKE++++ +FR Y+ TKL NP Y P I  K+ ++N+ V  +GLE QLL ++V+ ER ELEEQ++ L+   +  KR L +LED +LR L  + G++LD+ +L+NTL+ +K  ++EV+E+L++  +T   ID  R GY   A+R +ILFFVL ++  I+ MYQ++L AY+D+F  S+ KS       +R+ N+    T  VY Y C G+FEKHKLLF+FQI  K+    G +  DE +FF+KG   ++   +       WLSD +W ++++L ++    F  L+   E+    W  W   ++PET++LP ++ N    FQ++ ++R  R DR+    T ++I  +G ++V PP+L+ +++ D S+  + ++F+LSPG DP S +++LAE  G    K   +S+GQGQ   A  +++     G+W+ L NCHL + W+ +L+K +E L   +P P FRLWL++ P   FPI ILQ  +K+ TEPP GLK N++  Y  I     +       +  L+F+L FFH+V+ ERRK+  +GWNIPY+FN+SDF V   +L  YL    DQ ++  PW +LKYLI ++ YGG   DD DRR+L TY+ +YF +      +PF F  S  ++Y IP+  + +   ++I  LP  + PE FG H NA+I       + ++  L+ ++PQ    G     D+++ E +  I  +LP+  D +   K    D  P  VVLLQE++R+N  +D + K L  L + + G V MS++L+D+  S+Y+ ++P++W +  P ++K LA+W      R   + +W +    P V W+S    P  +LTA++Q + R N   +D  TL    T    + A +      G +V GLYL+GAGWD     L+   P +L  ++PVI   PIE  +  ++N+++ P Y    R         +E+ +L T E  P HW  +G  L+++ D
Sbjct:  202 KNDFSLQLQRFMSALTDARWKLEGKTVLYIPAEAALYSVENGAKEKDFINRMEMIMIHWTRQIKEVLSAQNAFEDTESSGPLDEIEYWKNRCDDLSGISKQLDKTGVKHITKILETAKSSYVGAFLKLASEIKFNTQQAQSNLKFLNTL----KDMCHDLSDSKPED-IPSMLSKLINRIRMIWVNSEHYNSRDAMTGMFRKMSNEIIKRCCLSLDLDEIFDGQIVSSMKKLQNCIYCCEQYKDIYDKI-CYVHKTYSSKPWNLDKTNIFAQIDAFIQRCKDLIEICECQAHFARFEDGNKKEMPIFQGARGAEVEMI------ILQIETVFENNIRALRDRKSTILDV--KATSWHDDYNRFRSGVKDLEVMTQNAITTAFETVTTIQQGIEILDVFAHLQNRETIRRTTDKMTQIICNKLMQEFNLVKKELALSTSIGLPHPSIPKY----AGIAIWARTLRKRIERQMLNLDQAFFLPISSSNADFRQQYTQLSVALEEVVRKTHIEFMSGLDRDPLKSLDVTLL----SRSIISQGM-----------LDINFSRALLKLFQELHYWERLQFDVPHYAADIYIRRAELRISRESVLLVVRDYNRILQTLNAEERSLFKEQIKTLDKKIQPGLTKILWSSKGAIEYFVNDCRINAARLQKKVDEYKTANDDIRKYCELISSMLMIKIDS-NRIYENTEFNDSQEAHR-----------AVVKEKLVGLHGEIINQMRETYEIFSKDSSDIQQYWNLYMNKVDKFCEEAFRLNVKYSLNELNKAINGDGRNEPSPLFKVSLNLQMRDLVFIPTLPELTNIVTSLGKNFIEVVKEIPR------IGEVLQKVKLKKSIWEF-----ISTDDEITKIQTNIRHGMQDISSSIQEPLGYWDQFREIWELNKEEFISQYCDLNPHVYSIDADISRYTEVTNKALDAEAMVTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIPQNLEELG------ESMRLLDKLNEER-NHIQEKFHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEWQEFLQALVEAEQM---IKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRRGLNLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTTEMENLANSSFRKATKFSRDLKDKNWEIIEYTRN---RVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPH-KDKEKNHFLLSGIDDLYQTLDDNRNTLSNMKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLMSQGFEASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDE-KWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEELSRMFDKYIEK-----IQNFIKMNCIELIRT----SPTNSVISLCKLFDCLATVENGCDPSDTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIREM--------------EGTFPNK-DTIYEYFVDN--KNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQ-KRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISKIFQGMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKV----AFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMSSTDT-----YEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEE----DRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQK--ECDDYLVVIVQQKREADDQAKSVMQTQERIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRG-AEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREKQAQLAAAQAKLDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVI-KWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQM-EGKKLKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKL--ANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPGVDPTSGLLQLAESLGMA-KKFHALSLGQGQAPIATRMINEGTKEGNWVFLANCHLSLSWMPQLDKIVEELQIEEPDPKFRLWLSSSPHPEFPISILQSGIKMTTEPPKGLKANMKRLYHLIKEDQFSACRKPEKYKKLLFSLCFFHSVLLERRKFLTLGWNIPYEFNDSDFEVSENLLSNYL----DQYET-TPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIK--EPF-FKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVGGDSKEDKVL-EISGNITKQLPENIDYEGTAKILSTDPCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSKAYP-SMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVD--TLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAGISDRPSYIESVELKTGEKAPEHWTKRGTALLMSLD 4512          
BLAST of Dynein heavy chain 10, axonemal vs. Planmine SMEST
Match: SMESG000033128.1 (SMESG000033128.1)

HSP 1 Score: 2285.37 bits (5921), Expect = 0.000e+0
Identity = 1467/4491 (32.67%), Postives = 2412/4491 (53.71%), Query Frame = 1
Query:  901 RDEFLISLKKFTSIVDQTIIQIASEVKLEIPDLDLFENDKENLSDKEIMEMIESTVLKWDQQITGTLESLQKIV-PHGPSPLAEIDFWRERNAXXXXXXXXXXXPKVKRILNLYSLAEGP---VFDTQNNELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQAL----RMIWIISRHYNKDERMVPLMERIAWNLSDRVARLIDVNTIFNLPLEHVLKDTAEAEKMLRVWNDTYFEVRASIEASGRDARWEFDRKRLFEKTNYMADICHDLNEIAMILQEFYN----------IF----GPELKSVTNEAKRIXXXXXXXXXXXXPLKEMPFNPFNLMKHKYDWSNFMEDFRRKVVSIENQAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKL---MTQKF-NDIMSQYEKEVESIDQLFKTNMNNPPLYHFKSCVAGGISWERHLFYNIKRPILRFLTMDEMMQSDNGKRIRTKYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILALANSENFVSENVPEETIDKMDDDLRVDFGFEINEIITETRNLELLGYKVPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISDY-IEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFKLQSGNKFLKCKEFFEFMESERTSDFEHLGRKYSTIGPLITKLQGEIIG---------DRDVNPFEKFQPFYEFWEKRIFDRVYNMVLK-NLQDYQNMLRDE--NFPTCLFEVDLMLAGTDVIGNPQTTEIYKLAIQDLRDAVEATRVFIRWKRNSCIETTGMKIDGQDELFYFTFYLDIGNSVEITYFCEQIANYYRNIIGKLRKYQDKWKKHKRVFIPNKQAQIDKWLTKDPTVMDFYERIRDTIDRKEELLNQPVIRKIGFISVNLKTLLSHVEDHFKRWKDLYCNSLHESAKTNLASIKNDIEGHFTDLSLIPCDLEELKALLSTIQTIQLLSLEFESRITDVQERYRVLTLSNHPIDQEEIEESDKLR----------QLFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIGRDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVK-----AMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGDIRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSS-DCECVQEHMIKMFDNISSLRFTKG-----------------------------------TSLE--------------MSATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEA-VFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKI-KKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLXXXXXXXXXXXXXXXXXDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLS-RFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKL------QLHTKL-IPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTRE-GMN-QDT------IEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPW-ANLVPQYVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSENAKS--DKDYAMTDP----ILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEY--SEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVA-------SVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAE--ASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKRKKPYL--WLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLT--KPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHT-AFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTGKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQW-VENGEPNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATA-AEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMGVGLVVEA-DLATTEH-PSHWVLQGVCLILNTD 13926
            +++F + L++F S +     ++  +  L IP      + +    +K+ +  +E  ++ W +QI   L +           PL EI++W+ R   LS + +QL    VK I  +   A+      F    +E+     +A+ N KFL+ +    K + + ++     D IP M+  L    RMIW+ S HYN  + M  +  +++  +  R    +D++ IF+  +   +K           + D Y ++   +  +     W  D+  +F + +     C DL EI      F            IF    G E++ +      I ++    E  ++ L++      ++      W +    FR  V  +E    + I   F T+ + +   ++L  F H+++R+ I +    MTQ   N +M ++    + +       + +P +  +    AG   W R L   I+R +L       +  S +    R +Y  +   +     K   E+   +D+   + L   +L    S + +S+ +           L ++F   + ++  E    E L + VP  A ++ ++        E +L +V  Y+ ++++L + E  +  ++IK + + I+PGL ++ W+S G  +Y +  C +     + KV        DI +  + I +  + K+ S N+  +  EF +  E+ R           + +   +  L GEII           +D +  +++   Y     +  +  + + +K +L +    +  +  N P+ LF+V L L   D++  P   E+  +     ++ +E  +   R      I     K+  +  ++ F     I    EIT     I +  ++I   +++    W + + ++  NK+  I ++   +P V      I    +   + L+   +  + F+ ++   L + +  H + W+    N L   A  +L  + N ++     +S IP +LEEL       ++++LL    E R   +QE++  L      +D+ E++ SD +R          Q F     E++ +   +   K KF      +  DF K +      F+  GP +        L  +  F   L  ++ + QE+     LF +   P  E+  ++K++ N++ I++L    +     W    +  L    ++       ++  K  R++K      +   RN   ++ +F+  +PL +DL++EA+R+RHW ++  +  + FD     FTL  +  +  ++  ++I E+  +A+KEL+IE  ++ +E+ W +++  + P+ K  ++  ++L  +D++ Q LDDN   L +M  SRF+ PF   V  WE++LS I E +++ + VQR+W+YLE IF+G DIR QLP+E+  FD I+K ++ IMTE  +    +   +    L     ++  LE  QKSL+ YL++KRN FPRF+FIS+D+LL ILG S + + V  H+ K FDNI+SL+  K                                    T++E                A++M SS+ E + F+  + +EG VE W+  +E  MR T R + ++  +   + +  R +W+ ++ G + + ++QI WT +V    + + ++  K  L+   K     +++    +RS L+K  R K+ ++++I+VH RDI++   +    D   FEW SQLRFYW +E D+  I+Q    F YGYEY+G +GRLVITPLTDR Y+TLT AL ++ GG+P GPAGTGKTET KDL K+LG   +V NC EG+DY+S+G++F+GL Q GAWGCFDEFNRI + VLSV++ Q+ +I + L      +F F+G+ I L   VGIFITMNPGYAGRTELP+++K+ FRP+ ++ PD   I EI LF++GF   KVLAKK+ TLY LS +QLSKQ+HYDFGLRAL SVL  AG  +R +P + ++++L+ ++ DMNL K    D PLF G++ DLFPG+D P + Y +  +++E+C    +    +    K+VQLYET  +RH+ M+VG T  GKS   ++L ++  +L      Q    L  P+NPK  S+ ELYG  D NT +WTDG+LS++ R+    T  +E ++++FDG VD LW+E+MNSVMDDNK+LTL NGERI +    +LLFEV +L  ASPATVSRCGMVY D  +LG+ P+ + WL +K +    + L+ ++ KYI       I+  +    +E ++T    +  N V  LC + DC  T E G +  DT      IE  F   + WS+   + ED + K D +I+ +               G  P++  T+++Y+ D+  + + W  W   L   + +N    F +I+VPT+DTVR  +L+   +    PV+LVG  GT KT+V+   L   + D +  L IN S++T+S ++Q  +E+ VEKRTKD++ P  GKR+L F+DD NMP  D +G+Q P+ +++  ++    YDR K    K+++D+    AMG PGGGR  +  R  S F++ N TFP++S+L  I+ S+++   Q F +E+K    IIT+ T+ +YN ++++  PTP+K HY+FNLRD+S+I+QGM +T  D     +   R+W HE  RV  DR++ D DK     A  E LSE   S  D+ +    P     +FGDY ++ +      YED+ + E  K   +E+++EY  +  V  M LVLF DA++H+++I R IR   G+ LLVG+GGSG+QSLT+LAAY      F+I +S+ Y +++ R++LK LY + G++NK T+F+F D  VV+E FLE INN+LSSG +P L+  DE + + +Q+ +EA   G+  + +SI+ Y +++   N+H+VLCMSPVGE  R R R FP  VN TTIDWF  WP  AL  VA        +FIG E     D  +  +   F ++H SV + S+  + + +R NYVTP NYL+ ++ Y  LL +K K      ++L+ GL K+ E  A V++  +  + A +K+A+ +K   C++ L  I  + + A ++ +   +  + ++V   +  K +  A A L +A+P LE A  AL+ L K D+ EI+S+ KPP  VQ V E + + +   E  W  AK  + +  F++ L   D DNI+ +    +   + +     D +  VS A   L  +V A+  Y  V R ++PKR+++   E    + + +L   + ++D +  E+K L Q Y   +++++ L+++ +  ++ L+ A KL++GL+ E  RW   +  L++Q   L GDCL+ SAFLSY+G F  ++R+ +V  +W + + + +IP +  F   + L+N  +I  WN +GLP D  S++NG++ TR SR+PL +DPQ QA  WI Q  E   LK    + PDF++ LE+AI++G P L ++V E +DP +D +L K+I    G   + LGDKE++++ +FR Y+ TKL NP Y P I  K+ ++N+ V  +GLE QLL ++V+ ER ELEEQ++ L+   +  KR L +LED +LR L  + G++LD+ +L+NTL+ +K  ++EV+E+L++  +T   ID  R GY   A+R +ILFFVL ++  I+ MYQ++L AY+D+F  S+ KS       +R+ N+    T  VY Y C G+FEKHKLLF+FQI  K+    G +  DE +FF+KG   ++   +       WLSD +W ++++L ++    F  L+   E+    W  W   ++PET++LP ++ N    FQ++ ++R  R DR+    T ++I  +G ++V PP+L+ +++ D S+  + ++F+LSPG DP S +++LAE  G    K   +S+GQGQ   A  +++     G+W+ L NCHL + W+ +L+K +E L   +P P FRLWL++ P   FPI ILQ  +K+ TEPP GLK N++  Y  I     +       +  L+F+L FFH+V+ ERRK+  +GWNIPY+FN+SDF V   +L  YL    DQ ++  PW +LKYLI ++ YGG   DD DRR+L TY+ +YF +      +PF F  S  ++Y IP+  + +   ++I  LP  + PE FG H NA+I       + ++  L+ ++PQ    G     D+++ E +  I  +LP+  D +   K    D  P  VVLLQE++R+N  +D + K L  L + + G V MS++L+D+  S+Y+ ++P++W +  P ++K LA+W      R   + +W +    P V W+S    P  +LTA++Q + R N   +D  TL    T    + A +      G +V GLYL+GAGWD     L+   P +L  ++PVI   PIE  +  ++N+++ P Y    R         +E+ +L T E  P HW  +G  L+++ D
Sbjct:  202 KNDFSLQLQRFMSALTDARWKLEGKTVLYIPAEAALYSVENGAKEKDFINRMEMIMIHWTRQIKEVLSAQNAFEDTESSGPLDEIEYWKNRCDDLSGISKQLDKTGVKHITKILETAKSSYVGAFLKLASEIKFNTQQAQSNLKFLNTL----KDMCHDLSDSKPED-IPSMLSKLINRIRMIWVNSEHYNSRDAMTGMFRKMSNEIIKRCCLSLDLDEIFDGQIVSSMKKLQNCIYCCEQYKDIYDKI-CYVHKTYSSKPWNLDKTNIFAQIDAFIQRCKDLIEICECQAHFARFEDGNKKEMPIFQGARGAEVEMI------ILQIETVFENNIRALRDRKSTILDV--KATSWHDDYNRFRSGVKDLEVMTQNAITTAFETVTTIQQGIEILDVFAHLQNRETIRRTTDKMTQIICNKLMQEFNLVKKELALSTSIGLPHPSIPKY----AGIAIWARTLRKRIERQMLNLDQAFFLPISSSNADFRQQYTQLSVALEEVVRKTHIEFMSGLDRDPLKSLDVTLL----SRSIISQGM-----------LDINFSRALLKLFQELHYWERLQFDVPHYAADIYIRRAELRISRESVLLVVRDYNRILQTLNAEERSLFKEQIKTLDKKIQPGLTKILWSSKGAIEYFVNDCRINAARLQKKVDEYKTANDDIRKYCELISSMLMIKIDS-NRIYENTEFNDSQEAHR-----------AVVKEKLVGLHGEIINQMRETYEIFSKDSSDIQQYWNLYMNKVDKFCEEAFRLNVKYSLNELNKAINGDGRNEPSPLFKVSLNLQMRDLVFIPTLPELTNIVTSLGKNFIEVVKEIPR------IGEVLQKVKLKKSIWEF-----ISTDDEITKIQTNIRHGMQDISSSIQEPLGYWDQFREIWELNKEEFISQYCDLNPHVYSIDADISRYTEVTNKALDAEAMVTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIPQNLEELG------ESMRLLDKLNEER-NHIQEKFHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEWQEFLQALVEAEQM---IKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRRGLNLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTTEMENLANSSFRKATKFSRDLKDKNWEIIEYTRN---RVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPH-KDKEKNHFLLSGIDDLYQTLDDNRNTLSNMKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKKVAEQPRVYPSKSSKPIKSSKKAPDRLTTESKKFVQTNVEEDERIRAVKLMSQGFEASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDE-KWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEELSRMFDKYIEK-----IQNFIKMNCIELIRT----SPTNSVISLCKLFDCLATVENGCDPSDTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIREM--------------EGTFPNK-DTIYEYFVDN--KNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQ-KRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISKIFQGMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKV----AFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMSSTDT-----YEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEE----DRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQK--ECDDYLVVIVQQKREADDQAKSVMQTQERIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRG-AEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREKQAQLAAAQAKLDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVI-KWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQM-EGKKLKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKL--ANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPGVDPTSGLLQLAESLGMA-KKFHALSLGQGQAPIATRMINEGTKEGNWVFLANCHLSLSWMPQLDKIVEELQIEEPDPKFRLWLSSSPHPEFPISILQSGIKMTTEPPKGLKANMKRLYHLIKEDQFSACRKPEKYKKLLFSLCFFHSVLLERRKFLTLGWNIPYEFNDSDFEVSENLLSNYL----DQYET-TPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIK--EPF-FKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVGGDSKEDKVL-EISGNITKQLPENIDYEGTAKILSTDPCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSKAYP-SMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVD--TLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAGISDRPSYIESVELKTGEKAPEHWTKRGTALLMSLD 4561          
BLAST of Dynein heavy chain 10, axonemal vs. Planmine SMEST
Match: SMESG000073407.1 (SMESG000073407.1)

HSP 1 Score: 2199.86 bits (5699), Expect = 0.000e+0
Identity = 1125/2203 (51.07%), Postives = 1538/2203 (69.81%), Query Frame = 1
Query: 7444 LNLVTQLCNMLDCQLT--------------REGMNQDT-----IEAIFIQSIYWSLGGCLIEDSQVKFDQFIKSLCAMPQSNE-EDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPXXXXXXXXXXXXXXGHCQMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSENAKSDKDYAMTDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEA-VSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSXXXXXXXXXXXXXXXXXXXXXXXXRLALDDLEKNDVVEIRSFAKPPKPVQVVSECIAVFKNYKEINWKVAKGMMADPSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERKIPMSDPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQ-----KEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKNIKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFXXXXXXXXXXXXXXXTSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKRKKPYLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKFISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKWLRELEKDLERLTKPHPDFRLWLTTEPTEAFPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTAFPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIP----QCDTGDD-QLKYIESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQTG----KSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKY---GLDISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGEPNV--MWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVT--QFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPVIKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMGVGLVVEADLATTEHPSHWVLQGVCLILNTD 13926
            ++L+ Q CNM   QL                +  N+ T     +EA+F+ +I WS G  ++ + + KF+  +K +C++P   E E+     G LP+  P LF+Y FD  E K  W  W++ +PQY +N  ++F+EILVPTI+T+++ W++ + + +Q P++L+G+TGTSKTA  QT +R  D  KY  + I+FSS TTSLD+QRNLE+N+EKR K  YGP  GK L+ FIDDMNMP +D+YGTQQPIAMLKL++E++G YDRGK+L WK+M+D+ ++AAMG PGGGRN VDPRFISLFSV      +  S+  I+ +IL+GH   FS +IK ++  IT +T+  Y +I +++ PTP+KFHY  NLRDLS+++QG+CQ+T+DRFTK++Q  R+WRHE  RV  DR+I ++DK  VQ  +   +         Y   +PIL+GDY       E RLYED+ +Y   K  FQE +E Y+E     + LVLFDDAL+HL  IHR +RMDGGHALLVGV GSGK+SL++LAA+      FEI+LS+GY E++ RE+LK +YNKL  EN   +F+FGDQHV +EGFLELINNML+ G+VP LF DDE+E ++  V ++ + +G   +KE IWQYF   C + LHIVL MSPVG TLR RCRNFPG+VNNT IDWF+PWPEQAL++VA   I P+N LIP      ++ H V +H SVE  S+ F  K RR NY+T  N++++I TYL LLE KD   E++  RL  GL KL   + Q+  LN K+A QK+ V EKTI+CE L+ EI   T+ AT KK++ +EKS  +  QSK I KEKGEAE AL  A+P LE A+ +LD+L+KNDV EIR+FA PPKPVQ+V E + +     EI+WK A+G+MAD +F++ LQT+DV+ I LK  N V+D++ K K+T +++R+ SKAG G LKF+ +VLG+ DVAREI+PK+E+V  LE+ F + ++ELE+++ E+ KLE +LK L ++++ A DE +RL +E  IMQR+L AA+KL  GL+SE  RW+ D+   + ++V LLGDCL+ SAFL+Y+G F++E+R  +V + W   +    IP S  F+++++LT+DVEISKWNS+GLP DELSIQN ILTT+++RFP+CIDPQ+QA+ WI +     K+ES ++K +  ND  FL+ LE +IK+G+P+LF+D DE++DPVIDNVL KNI   +GRE+V+LGD+EVD++P FRLYL +KLSNPK+ P+++ ++ +INYTVTL GLE QLLS +VK ER+ELEE+RE LI ETS+NKR+LK+LED LL ELAT TGN+LDN ELINTLE+TK+KA +V+++L      S +I++ RDGYR AAKRGA+LFFVL  +S IN+MYQ+SL +YL VF  ++++S+PD +L KRL N+++TLT +VY YGCTGIFEKHK+L + QI L+LE D GN+T +E+DFFIKGN +I     +    WL D SW+D+ +L+  IP KFS +L+ +  +E  W+ W   ++PE+  +   Y     SF+KLCLLRC+RIDRI  AIT +V   MG+E+V+PPI  F      STP  PIV I+SPGSDP +++VKLA    F   K+K++SMGQGQE NA  L D A++RG WL+LQN HLL+K++  +EK L+ L KPHPDFRLWLTTEP   FPIGILQ+S K+V EPP+G+K NL  TY KI             P+ +F +                    P+   +      + I    LQ    +  + +PW ++KYLIGEVMYGGRAID FDRRIL+TYMDEYFGDFLFD FQ FHFY      Y IP    +C +  +   +YI+SLP E +P VFGLH NA IGY T+  KE+W  +I++QPQT     ++G   S++++++E   GI  KLP L+D++++++       +ISPT VVLLQEL+RFN+L+ +M  SL+TL +ALVGEVGMS ELDD++KSL NG +P  W+ LAP+T+K L +W+ H   R  QY  W+  G+ ++  +WLSGLH+P+SYLTALVQ  CR+N W LD  TL T +T  +  ++  +T  +  GC+V G+Y+EG GWD    C++  K +QL+QS+P+I++ PIE+H+ K  NT   PVYVTSQRRNAMG+GLV   DL TTEH SHW+LQG+ L LN+D
Sbjct:    1 MSLMKQFCNMFSSQLPVQQEELLSSTYSRDYDDSNESTGDLEFLEALFLNAIIWSFGASIVSEDRDKFNDILKQICSLPNMEEDENYSVPKGYLPNSSPNLFNYTFDESEYK--WFNWSHFIPQYSYNSGERFTEILVPTIETIKIIWIVKKHLDLQIPIVLIGDTGTSKTASVQTLIRTLDKTKYSMMKIDFSSCTTSLDVQRNLEANLEKRAKGIYGPTPGKFLVTFIDDMNMPIIDKYGTQQPIAMLKLLIEKKGMYDRGKELTWKRMKDLSYVAAMGLPGGGRNTVDPRFISLFSVTYCPNLTLESMLKIFGAILTGHTFQFSPQIKKSIDKITSITIKAYEEIKLKMLPTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHMPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVKNERRELEEKRENLILETSENKRILKELEDKLLLELATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLSITIP-KFSDILDQVTNNEDEWRNWYKLQSPESEFIDY-YKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFTSSTPIVPIVVIISPGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKI-------------PNELFFM--------------------PFCKKDDVLERLVGIFHMILQNQIFRKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYFGDFLFDQFQLFHFYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSIWLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDLETTEHNSHWILQGIALTLNSD 2166          
The following BLAST results are available for this feature:
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAH101.647e-660.21dynein axonemal heavy chain 10 [Source:HGNC Symbol... [more]
DNAH100.000e+059.47dynein axonemal heavy chain 10 [Source:HGNC Symbol... [more]
DNAH101.591e-659.47dynein axonemal heavy chain 10 [Source:HGNC Symbol... [more]
DNAH100.000e+067.93dynein axonemal heavy chain 10 [Source:HGNC Symbol... [more]
DNAH24.424e-1234.46dynein axonemal heavy chain 2 [Source:HGNC Symbol;... [more]
back to top
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhc-10.000e+028.52Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-10.000e+028.52Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-10.000e+028.48Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
che-32.492e-15133.30Cytoplasmic dynein 2 heavy chain 1 [Source:UniPro... [more]
dhc-31.840e-2423.16Dynein Heavy Chain [Source:UniProtKB/TrEMBL;Acc:G... [more]
back to top
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dhc98D8.065e-3251.29gene:FBgn0013813 transcript:FBtr0301303[more]
Dhc98D8.771e-3251.29gene:FBgn0013813 transcript:FBtr0301302[more]
Dhc98D4.438e-2751.29gene:FBgn0013813 transcript:FBtr0337034[more]
Dhc93AB0.000e+032.29gene:FBgn0013812 transcript:FBtr0273236[more]
Dhc93AB0.000e+032.19gene:FBgn0013812 transcript:FBtr0336774[more]
back to top
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkeyp-86b9.10.000e+059.69si:dkeyp-86b9.1 [Source:ZFIN;Acc:ZDB-GENE-060531-1... [more]
DNAH100.000e+059.69si:dkeyp-86b9.1 [Source:ZFIN;Acc:ZDB-GENE-060531-1... [more]
DNAH100.000e+058.89si:dkeyp-86b9.1 [Source:ZFIN;Acc:ZDB-GENE-060531-1... [more]
dnah20.000e+033.21dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:Z... [more]
dnah21.290e-1034.22dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAH100.000e+062.12dynein axonemal heavy chain 10 [Source:NCBI gene;A... [more]
DNAH100.000e+061.02dynein axonemal heavy chain 10 [Source:NCBI gene;A... [more]
DNAH100.000e+060.69dynein axonemal heavy chain 10 [Source:NCBI gene;A... [more]
DNAH110.000e+032.80dynein axonemal heavy chain 11 [Source:NCBI gene;A... [more]
DNAH110.000e+032.79dynein axonemal heavy chain 11 [Source:NCBI gene;A... [more]
back to top
BLAST of Dynein heavy chain 10, axonemal vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnah100.000e+060.03dynein, axonemal, heavy chain 10 [Source:MGI Symbo... [more]
Dnah100.000e+059.27dynein, axonemal, heavy chain 10 [Source:MGI Symbo... [more]
Dnah21.966e-1134.52dynein, axonemal, heavy chain 2 [Source:MGI Symbol... [more]
Dnah22.067e-1134.49dynein, axonemal, heavy chain 2 [Source:MGI Symbol... [more]
Dnah90.000e+032.58dynein, axonemal, heavy chain 9 [Source:MGI Symbol... [more]
back to top
BLAST of Dynein heavy chain 10, axonemal vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8IVF4|DYH10_HUMAN0.000e+059.47Dynein heavy chain 10, axonemal OS=Homo sapiens OX... [more]
sp|Q9SMH3|DYH1A_CHLRE0.000e+048.92Dynein-1-alpha heavy chain, flagellar inner arm I1... [more]