RING-box protein

Overview
NameRING-box protein
Smed IDSMED30011320
Length (bp)452
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RING-box protein (SMED30011320) t-SNE clustered cells

Violin plots show distribution of expression levels for RING-box protein (SMED30011320) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RING-box protein (SMED30011320) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RING-box protein (SMED30011320) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011320

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
posterior sideSMED30011320 dd_Smed_v4_3487_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30011320 dd_Smed_v4_3487_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RING-box protein vs. Ensembl Human
Match: RNF7 (ring finger protein 7 [Source:HGNC Symbol;Acc:HGNC:10070])

HSP 1 Score: 118.627 bits (296), Expect = 7.581e-35
Identity = 50/85 (58.82%), Postives = 67/85 (78.82%), Query Frame = 1
Query:   61 LFTLKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRLTECILVWGECNHVFHNCCISQWIKKNNNCPLCQQIWNVRRIGK 315
            +F+LK+WN V +WSW+   + CAICR  VM+ C+ CQ +N+  +C++VWGECNH FHNCC+S W+K+NN CPLCQQ W V+RIGK
Sbjct:   29 MFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK 113          
BLAST of RING-box protein vs. Ensembl Human
Match: RNF7 (ring finger protein 7 [Source:HGNC Symbol;Acc:HGNC:10070])

HSP 1 Score: 93.9745 bits (232), Expect = 2.867e-25
Identity = 45/85 (52.94%), Postives = 56/85 (65.88%), Query Frame = 1
Query:   61 LFTLKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRLTECILVWGECNHVFHNCCISQWIKKNNNCPLCQQIWNVRRIGK 315
            +F+LK+WN V +WSW+   + CAICR  VM                +VWGECNH FHNCC+S W+K+NN CPLCQQ W V+RIGK
Sbjct:   29 MFSLKKWNAVAMWSWDVECDTCAICRVQVM----------------VVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK 97          
BLAST of RING-box protein vs. Ensembl Human
Match: RBX1 (ring-box 1 [Source:HGNC Symbol;Acc:HGNC:9928])

HSP 1 Score: 86.2705 bits (212), Expect = 3.947e-22
Identity = 38/91 (41.76%), Postives = 54/91 (59.34%), Query Frame = 1
Query:   49 TNQNLFTLKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRLT---ECILVWGECNHVFHNCCISQWIKKNNNCPLCQQIWNVRRIG 312
              +  F +K+WN V LW+W+   +NCAICRN +M+ C+ CQ +       EC + WG CNH FH  CIS+W+K    CPL  + W  ++ G
Sbjct:   17 AGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYG 107          
BLAST of RING-box protein vs. Ensembl Human
Match: ANAPC11 (anaphase promoting complex subunit 11 [Source:HGNC Symbol;Acc:HGNC:14452])

HSP 1 Score: 57.3806 bits (137), Expect = 3.692e-11
Identity = 31/82 (37.80%), Postives = 42/82 (51.22%), Query Frame = 1
Query:   70 LKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRLTECILVWGECNHVFHNCCISQWIKK---NNNCPLCQQIWNVRR 306
            +K WN V  W W    ENC ICR      C  C+      +C LVWG+C+H FH  CI +W+       +CP+C+Q W  + 
Sbjct:    5 IKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPG--DDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE 84          
BLAST of RING-box protein vs. Ensembl Human
Match: ANAPC11 (anaphase promoting complex subunit 11 [Source:HGNC Symbol;Acc:HGNC:14452])

HSP 1 Score: 57.3806 bits (137), Expect = 3.692e-11
Identity = 31/82 (37.80%), Postives = 42/82 (51.22%), Query Frame = 1
Query:   70 LKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRLTECILVWGECNHVFHNCCISQWIKK---NNNCPLCQQIWNVRR 306
            +K WN V  W W    ENC ICR      C  C+      +C LVWG+C+H FH  CI +W+       +CP+C+Q W  + 
Sbjct:    5 IKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPG--DDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE 84          
BLAST of RING-box protein vs. Ensembl Celegans
Match: rbx-2 (Yeast RBX (Ring finger protein) homolog [Source:UniProtKB/TrEMBL;Acc:P91404])

HSP 1 Score: 100.908 bits (250), Expect = 2.732e-28
Identity = 43/84 (51.19%), Postives = 61/84 (72.62%), Query Frame = 1
Query:   64 FTLKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRLTECILVWGECNHVFHNCCISQWIKKNNNCPLCQQIWNVRRIGK 315
            F LK+WN + +W+W+   + CAICR  +ME C+ CQ++    EC +VWG+CNH FH+CC++QWI++NN CPLCQ+ W V R  K
Sbjct:   30 FVLKKWNALAVWAWDVECDTCAICRVHLMEECLRCQSEPS-AECYVVWGDCNHSFHHCCMTQWIRQNNRCPLCQKDWVVSRTSK 112          
BLAST of RING-box protein vs. Ensembl Celegans
Match: rbx-1 (RING-box protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q23457])

HSP 1 Score: 85.8853 bits (211), Expect = 2.349e-22
Identity = 40/94 (42.55%), Postives = 57/94 (60.64%), Query Frame = 1
Query:   49 TNQNL---FTLKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRL---TECILVWGECNHVFHNCCISQWIKKNNNCPLCQQIWNVRRIG 312
            TNQ +   F +K+W+ V LW+W+   +NCAICRN +M+ C+ CQ +       EC + WG CNH FH  CIS+W+K    CPL  + W  ++ G
Sbjct:   16 TNQTVKKRFEVKKWSAVALWAWDIQVDNCAICRNHIMDLCIECQANQAAGLKDECTVAWGNCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYG 109          
BLAST of RING-box protein vs. Ensembl Celegans
Match: rbx-1 (RING-box protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q23457])

HSP 1 Score: 85.8853 bits (211), Expect = 2.349e-22
Identity = 40/94 (42.55%), Postives = 57/94 (60.64%), Query Frame = 1
Query:   49 TNQNL---FTLKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRL---TECILVWGECNHVFHNCCISQWIKKNNNCPLCQQIWNVRRIG 312
            TNQ +   F +K+W+ V LW+W+   +NCAICRN +M+ C+ CQ +       EC + WG CNH FH  CIS+W+K    CPL  + W  ++ G
Sbjct:   16 TNQTVKKRFEVKKWSAVALWAWDIQVDNCAICRNHIMDLCIECQANQAAGLKDECTVAWGNCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYG 109          
BLAST of RING-box protein vs. Ensembl Celegans
Match: apc-11 (Anaphase-promoting complex subunit 11 [Source:UniProtKB/Swiss-Prot;Acc:Q20052])

HSP 1 Score: 52.7582 bits (125), Expect = 2.043e-9
Identity = 31/93 (33.33%), Postives = 44/93 (47.31%), Query Frame = 1
Query:   40 VKFTNQNLFTLKRWNLVGLWSW-ECTSENCAICRNGVMEPCVHCQNDNRLTECILVWGECNHVFHNCCISQWIKKNNN-----CPLCQQIWNV 300
            +K   +   T+K+ ++ G W W +   + C ICR      C  C+      +C LV G C H FH  CI +WI    N     CPLC+Q W +
Sbjct:   43 LKTNTRMSITVKKLHVCGEWKWLQGGEDTCGICRMEFESACNMCKFPG--DDCPLVLGICRHAFHRHCIDKWIAAPTNQPRAQCPLCRQDWTI 133          
BLAST of RING-box protein vs. Ensembl Celegans
Match: apc-11 (Anaphase-promoting complex subunit 11 [Source:UniProtKB/Swiss-Prot;Acc:Q20052])

HSP 1 Score: 52.7582 bits (125), Expect = 2.043e-9
Identity = 31/93 (33.33%), Postives = 44/93 (47.31%), Query Frame = 1
Query:   40 VKFTNQNLFTLKRWNLVGLWSW-ECTSENCAICRNGVMEPCVHCQNDNRLTECILVWGECNHVFHNCCISQWIKKNNN-----CPLCQQIWNV 300
            +K   +   T+K+ ++ G W W +   + C ICR      C  C+      +C LV G C H FH  CI +WI    N     CPLC+Q W +
Sbjct:   43 LKTNTRMSITVKKLHVCGEWKWLQGGEDTCGICRMEFESACNMCKFPG--DDCPLVLGICRHAFHRHCIDKWIAAPTNQPRAQCPLCRQDWTI 133          
BLAST of RING-box protein vs. Ensembl Fly
Match: Roc2 (gene:FBgn0044020 transcript:FBtr0302211)

HSP 1 Score: 115.546 bits (288), Expect = 7.782e-34
Identity = 53/107 (49.53%), Postives = 75/107 (70.09%), Query Frame = 1
Query:   10 SYMKMTDNSDVKFTNQNLFTLKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRLT-----ECILVWGECNHVFHNCCISQWIKKNNNCPLCQQIWNVRRIGK 315
            S  + TD+ D     + +FTLK+WN V +WSW+   + CAICR  VM+ C+ CQ DN+       +C++VWGECNH FH+CC+S W+K+NN CPLCQQ W+++R+GK
Sbjct:    8 SVDRPTDDGDAG-KPEKMFTLKKWNAVAMWSWDVECDICAICRVQVMDSCLRCQADNKRDVMGRQDCVVVWGECNHSFHHCCMSLWVKQNNRCPLCQQEWSIQRMGK 113          
BLAST of RING-box protein vs. Ensembl Fly
Match: Roc2 (gene:FBgn0044020 transcript:FBtr0088085)

HSP 1 Score: 115.546 bits (288), Expect = 7.782e-34
Identity = 53/107 (49.53%), Postives = 75/107 (70.09%), Query Frame = 1
Query:   10 SYMKMTDNSDVKFTNQNLFTLKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRLT-----ECILVWGECNHVFHNCCISQWIKKNNNCPLCQQIWNVRRIGK 315
            S  + TD+ D     + +FTLK+WN V +WSW+   + CAICR  VM+ C+ CQ DN+       +C++VWGECNH FH+CC+S W+K+NN CPLCQQ W+++R+GK
Sbjct:    8 SVDRPTDDGDAG-KPEKMFTLKKWNAVAMWSWDVECDICAICRVQVMDSCLRCQADNKRDVMGRQDCVVVWGECNHSFHHCCMSLWVKQNNRCPLCQQEWSIQRMGK 113          
BLAST of RING-box protein vs. Ensembl Fly
Match: Roc1a (gene:FBgn0025638 transcript:FBtr0343564)

HSP 1 Score: 87.4261 bits (215), Expect = 6.979e-23
Identity = 38/90 (42.22%), Postives = 56/90 (62.22%), Query Frame = 1
Query:   52 NQNLFTLKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRLT---ECILVWGECNHVFHNCCISQWIKKNNNCPLCQQIWNVRRIG 312
            ++  F +K+WN V LW+W+   +NCAICRN +M+ C+ CQ +       EC + WG CNH FH  CIS+W+K    CPL  + W+ ++ G
Sbjct:   18 DKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWDFQKYG 107          
BLAST of RING-box protein vs. Ensembl Fly
Match: Roc1a (gene:FBgn0025638 transcript:FBtr0070122)

HSP 1 Score: 87.4261 bits (215), Expect = 6.979e-23
Identity = 38/90 (42.22%), Postives = 56/90 (62.22%), Query Frame = 1
Query:   52 NQNLFTLKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRLT---ECILVWGECNHVFHNCCISQWIKKNNNCPLCQQIWNVRRIG 312
            ++  F +K+WN V LW+W+   +NCAICRN +M+ C+ CQ +       EC + WG CNH FH  CIS+W+K    CPL  + W+ ++ G
Sbjct:   18 DKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWDFQKYG 107          
BLAST of RING-box protein vs. Ensembl Fly
Match: Roc1a (gene:FBgn0025638 transcript:FBtr0308651)

HSP 1 Score: 84.7297 bits (208), Expect = 1.618e-21
Identity = 40/92 (43.48%), Postives = 56/92 (60.87%), Query Frame = 1
Query:   52 NQNLFTLKR--WNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRLT---ECILVWGECNHVFHNCCISQWIKKNNNCPLCQQIWNVRRIG 312
            N + F L+R  WN V LW+W+   +NCAICRN +M+ C+ CQ +       EC + WG CNH FH  CIS+W+K    CPL  + W+ ++ G
Sbjct:   44 NTSSFPLRRKQWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWDFQKYG 135          
BLAST of RING-box protein vs. Ensembl Zebrafish
Match: rnf7 (ring finger protein 7 [Source:ZFIN;Acc:ZDB-GENE-050220-12])

HSP 1 Score: 118.627 bits (296), Expect = 6.198e-35
Identity = 50/85 (58.82%), Postives = 67/85 (78.82%), Query Frame = 1
Query:   61 LFTLKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRLTECILVWGECNHVFHNCCISQWIKKNNNCPLCQQIWNVRRIGK 315
            +F+LK+WN V +WSW+   + CAICR  VM+ C+ CQ +N+  +C++VWGECNH FHNCC+S W+K+NN CPLCQQ W V+RIGK
Sbjct:   29 MFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK 113          
BLAST of RING-box protein vs. Ensembl Zebrafish
Match: rbx1 (ring-box 1, E3 ubiquitin protein ligase [Source:ZFIN;Acc:ZDB-GENE-041008-106])

HSP 1 Score: 86.6557 bits (213), Expect = 1.834e-22
Identity = 38/91 (41.76%), Postives = 55/91 (60.44%), Query Frame = 1
Query:   49 TNQNLFTLKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRLT---ECILVWGECNHVFHNCCISQWIKKNNNCPLCQQIWNVRRIG 312
             ++  F +K+WN V LW+W+   +NCAICRN +M+ C+ CQ +       EC + WG CNH FH  CIS+W+K    CPL  + W  ++ G
Sbjct:   17 ASKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYG 107          
BLAST of RING-box protein vs. Ensembl Zebrafish
Match: anapc11 (APC11 anaphase promoting complex subunit 11 homolog (yeast) [Source:ZFIN;Acc:ZDB-GENE-061013-383])

HSP 1 Score: 58.9214 bits (141), Expect = 5.443e-12
Identity = 31/82 (37.80%), Postives = 43/82 (52.44%), Query Frame = 1
Query:   70 LKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRLTECILVWGECNHVFHNCCISQWI---KKNNNCPLCQQIWNVRR 306
            +K+WN V  W W    ENC ICR      C  C+      +C LVWG+C+H FH  CI +W+   +    CP+C+Q W  + 
Sbjct:    5 IKQWNGVASWLWVANDENCGICRASFNGCCPDCKVPG--DDCPLVWGQCSHCFHMHCILKWLNSQQVQQQCPMCRQEWKFKE 84          
BLAST of RING-box protein vs. Ensembl Zebrafish
Match: anapc11 (APC11 anaphase promoting complex subunit 11 homolog (yeast) [Source:ZFIN;Acc:ZDB-GENE-061013-383])

HSP 1 Score: 58.9214 bits (141), Expect = 5.443e-12
Identity = 31/82 (37.80%), Postives = 43/82 (52.44%), Query Frame = 1
Query:   70 LKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRLTECILVWGECNHVFHNCCISQWI---KKNNNCPLCQQIWNVRR 306
            +K+WN V  W W    ENC ICR      C  C+      +C LVWG+C+H FH  CI +W+   +    CP+C+Q W  + 
Sbjct:    5 IKQWNGVASWLWVANDENCGICRASFNGCCPDCKVPG--DDCPLVWGQCSHCFHMHCILKWLNSQQVQQQCPMCRQEWKFKE 84          
BLAST of RING-box protein vs. Ensembl Zebrafish
Match: anapc11 (APC11 anaphase promoting complex subunit 11 homolog (yeast) [Source:ZFIN;Acc:ZDB-GENE-061013-383])

HSP 1 Score: 58.9214 bits (141), Expect = 5.443e-12
Identity = 31/82 (37.80%), Postives = 43/82 (52.44%), Query Frame = 1
Query:   70 LKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRLTECILVWGECNHVFHNCCISQWI---KKNNNCPLCQQIWNVRR 306
            +K+WN V  W W    ENC ICR      C  C+      +C LVWG+C+H FH  CI +W+   +    CP+C+Q W  + 
Sbjct:    5 IKQWNGVASWLWVANDENCGICRASFNGCCPDCKVPG--DDCPLVWGQCSHCFHMHCILKWLNSQQVQQQCPMCRQEWKFKE 84          
BLAST of RING-box protein vs. Ensembl Xenopus
Match: rnf7 (ring finger protein 7 [Source:NCBI gene;Acc:100135737])

HSP 1 Score: 118.627 bits (296), Expect = 4.549e-35
Identity = 50/89 (56.18%), Postives = 68/89 (76.40%), Query Frame = 1
Query:   49 TNQNLFTLKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRLTECILVWGECNHVFHNCCISQWIKKNNNCPLCQQIWNVRRIGK 315
            +   +F+LK+WN V +WSW+   + CAICR  VM+ C+ CQ +N+  +C++VWGECNH FHNCC+S W+K+NN CPLCQQ W V+RIGK
Sbjct:   11 SGPKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK 99          
BLAST of RING-box protein vs. Ensembl Xenopus
Match: RBX1 (ring-box 1, E3 ubiquitin protein ligase [Source:NCBI gene;Acc:100379935])

HSP 1 Score: 86.6557 bits (213), Expect = 3.104e-22
Identity = 38/91 (41.76%), Postives = 55/91 (60.44%), Query Frame = 1
Query:   49 TNQNLFTLKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRLT---ECILVWGECNHVFHNCCISQWIKKNNNCPLCQQIWNVRRIG 312
             ++  F +K+WN V LW+W+   +NCAICRN +M+ C+ CQ +       EC + WG CNH FH  CIS+W+K    CPL  + W  ++ G
Sbjct:   29 ASKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYG 119          
BLAST of RING-box protein vs. Ensembl Xenopus
Match: RBX1 (ring-box 1, E3 ubiquitin protein ligase [Source:NCBI gene;Acc:100379935])

HSP 1 Score: 84.7297 bits (208), Expect = 2.169e-21
Identity = 37/89 (41.57%), Postives = 54/89 (60.67%), Query Frame = 1
Query:   49 TNQNLFTLKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRLT---ECILVWGECNHVFHNCCISQWIKKNNNCPLCQQIWNVRR 306
             ++  F +K+WN V LW+W+   +NCAICRN +M+ C+ CQ +       EC + WG CNH FH  CIS+W+K    CPL  + W  ++
Sbjct:   17 ASKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQK 105          
BLAST of RING-box protein vs. Ensembl Xenopus
Match: gnb1l (guanine nucleotide binding protein (G protein), beta polypeptide 1-like [Source:Xenbase;Acc:XB-GENE-1010503])

HSP 1 Score: 56.6102 bits (135), Expect = 6.083e-11
Identity = 31/82 (37.80%), Postives = 42/82 (51.22%), Query Frame = 1
Query:   70 LKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRLTECILVWGECNHVFHNCCISQWI---KKNNNCPLCQQIWNVRR 306
            LK WN V  W W    +NC ICR      C  C+      +C LVWG C+H FH  CI +W+   +   +CP+C+Q W  + 
Sbjct:    5 LKCWNGVASWQWVANDDNCGICRMAFNGCCPECKIPG--DDCPLVWGHCSHCFHMHCILKWLNSQQVQQHCPMCRQEWKFKE 84          
BLAST of RING-box protein vs. Ensembl Mouse
Match: Rnf7 (ring finger protein 7 [Source:MGI Symbol;Acc:MGI:1337096])

HSP 1 Score: 118.242 bits (295), Expect = 9.078e-35
Identity = 50/85 (58.82%), Postives = 67/85 (78.82%), Query Frame = 1
Query:   61 LFTLKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRLTECILVWGECNHVFHNCCISQWIKKNNNCPLCQQIWNVRRIGK 315
            +F+LK+WN V +WSW+   + CAICR  VM+ C+ CQ +N+  +C++VWGECNH FHNCC+S W+K+NN CPLCQQ W V+RIGK
Sbjct:   29 MFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK 113          
BLAST of RING-box protein vs. Ensembl Mouse
Match: Gm7075 (predicted gene 7075 [Source:MGI Symbol;Acc:MGI:3646561])

HSP 1 Score: 116.316 bits (290), Expect = 5.103e-34
Identity = 49/85 (57.65%), Postives = 66/85 (77.65%), Query Frame = 1
Query:   61 LFTLKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRLTECILVWGECNHVFHNCCISQWIKKNNNCPLCQQIWNVRRIGK 315
            +F+LK+WN V +WSW+   + CA CR  VM+ C+ CQ +N+  +C++VWGECNH FHNCC+S W+K+NN CPLCQQ W V+RIGK
Sbjct:   28 MFSLKKWNAVAMWSWDVECDTCATCRVQVMDACLRCQAENKQKDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK 112          
BLAST of RING-box protein vs. Ensembl Mouse
Match: Rbx1 (ring-box 1 [Source:MGI Symbol;Acc:MGI:1891829])

HSP 1 Score: 86.2705 bits (212), Expect = 2.710e-22
Identity = 38/91 (41.76%), Postives = 54/91 (59.34%), Query Frame = 1
Query:   49 TNQNLFTLKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRLT---ECILVWGECNHVFHNCCISQWIKKNNNCPLCQQIWNVRRIG 312
              +  F +K+WN V LW+W+   +NCAICRN +M+ C+ CQ +       EC + WG CNH FH  CIS+W+K    CPL  + W  ++ G
Sbjct:   17 AGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYG 107          
BLAST of RING-box protein vs. Ensembl Mouse
Match: Rbx1 (ring-box 1 [Source:MGI Symbol;Acc:MGI:1891829])

HSP 1 Score: 58.5362 bits (140), Expect = 8.147e-12
Identity = 25/60 (41.67%), Postives = 36/60 (60.00%), Query Frame = 1
Query:   49 TNQNLFTLKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRLT---ECILVWGECN 219
              +  F +K+WN V LW+W+   +NCAICRN +M+ C+ CQ +       EC + WG CN
Sbjct:   17 AGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCN 76          
BLAST of RING-box protein vs. Ensembl Mouse
Match: Anapc11 (anaphase promoting complex subunit 11 [Source:MGI Symbol;Acc:MGI:1913406])

HSP 1 Score: 56.9954 bits (136), Expect = 2.790e-11
Identity = 31/82 (37.80%), Postives = 43/82 (52.44%), Query Frame = 1
Query:   70 LKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRLTECILVWGECNHVFHNCCISQWI---KKNNNCPLCQQIWNVRR 306
            +K WN V  W W    ENC ICR      C  C+      +C LVWG+C+H FH  CI +W+   +   +CP+C+Q W  + 
Sbjct:    5 IKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPG--DDCPLVWGQCSHCFHMHCILKWLNAQQVQQHCPMCRQEWKFKE 84          
BLAST of RING-box protein vs. UniProt/SwissProt
Match: sp|Q9UBF6|RBX2_HUMAN (RING-box protein 2 OS=Homo sapiens OX=9606 GN=RNF7 PE=1 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 3.641e-34
Identity = 50/85 (58.82%), Postives = 67/85 (78.82%), Query Frame = 1
Query:   61 LFTLKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRLTECILVWGECNHVFHNCCISQWIKKNNNCPLCQQIWNVRRIGK 315
            +F+LK+WN V +WSW+   + CAICR  VM+ C+ CQ +N+  +C++VWGECNH FHNCC+S W+K+NN CPLCQQ W V+RIGK
Sbjct:   29 MFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK 113          
BLAST of RING-box protein vs. UniProt/SwissProt
Match: sp|Q9WTZ1|RBX2_MOUSE (RING-box protein 2 OS=Mus musculus OX=10090 GN=Rnf7 PE=3 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 6.350e-34
Identity = 50/85 (58.82%), Postives = 67/85 (78.82%), Query Frame = 1
Query:   61 LFTLKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRLTECILVWGECNHVFHNCCISQWIKKNNNCPLCQQIWNVRRIGK 315
            +F+LK+WN V +WSW+   + CAICR  VM+ C+ CQ +N+  +C++VWGECNH FHNCC+S W+K+NN CPLCQQ W V+RIGK
Sbjct:   29 MFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK 113          
BLAST of RING-box protein vs. UniProt/SwissProt
Match: sp|Q08273|RBX1_YEAST (RING-box protein HRT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HRT1 PE=1 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 1.055e-24
Identity = 42/92 (45.65%), Postives = 56/92 (60.87%), Query Frame = 1
Query:   49 TNQNLFTLKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQND---NRLTECILVWGECNHVFHNCCISQWIKKNNNCPLCQQIWNVRRIGK 315
            T +  F +K+W  V  WSW+   +NCAICRN +MEPC+ CQ     +   EC+  WG CNH FH  CI++WIK  + CPL  Q W + R G+
Sbjct:   30 TKKKRFEIKKWTAVAFWSWDIAVDNCAICRNHIMEPCIECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWIKTRDACPLDNQPWQLARCGR 121          
BLAST of RING-box protein vs. UniProt/SwissProt
Match: sp|Q54K33|RBX1_DICDI (RING-box protein 1 OS=Dictyostelium discoideum OX=44689 GN=rbx1 PE=3 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 6.570e-23
Identity = 42/98 (42.86%), Postives = 58/98 (59.18%), Query Frame = 1
Query:   31 NSDVKFTNQNLFTLKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQND---NRLTECILVWGECNHVFHNCCISQWIKKNNNCPLCQQIWNVRRIGK 315
            +S    T +  F +KRWN V LW W+   +NCAICRN +M+ C+ CQ +   N   EC + WG CNH FH  CIS+W+K    CPL  + W  ++ G+
Sbjct:    7 SSSASKTPKKKFEVKRWNAVALWIWDIVVDNCAICRNHIMDLCIECQANQASNTSEECTVAWGICNHAFHFHCISRWLKSRQVCPLDNRDWEFQKYGR 104          
BLAST of RING-box protein vs. UniProt/SwissProt
Match: sp|Q9W5E1|RBX1A_DROME (RING-box protein 1A OS=Drosophila melanogaster OX=7227 GN=Roc1a PE=1 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 6.995e-22
Identity = 38/90 (42.22%), Postives = 56/90 (62.22%), Query Frame = 1
Query:   52 NQNLFTLKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRLT---ECILVWGECNHVFHNCCISQWIKKNNNCPLCQQIWNVRRIG 312
            ++  F +K+WN V LW+W+   +NCAICRN +M+ C+ CQ +       EC + WG CNH FH  CIS+W+K    CPL  + W+ ++ G
Sbjct:   18 DKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWDFQKYG 107          
BLAST of RING-box protein vs. TrEMBL
Match: W4Z1L4 (RING-type domain-containing protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 1.286e-34
Identity = 53/94 (56.38%), Postives = 74/94 (78.72%), Query Frame = 1
Query:   34 SDVKFTNQNLFTLKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRLTECILVWGECNHVFHNCCISQWIKKNNNCPLCQQIWNVRRIGK 315
            ++ K ++Q LF+LK+WN+V +WSW+   + CAICR  VM+ C+ CQ +N+  EC++VWG+CNH FHNCC+S W+K+NN CPLCQQ W V+RIGK
Sbjct:   31 TNAKPSDQRLFSLKKWNIVAMWSWDVECDTCAICRVQVMDACLRCQTENKQEECVVVWGDCNHSFHNCCMSLWVKQNNRCPLCQQEWMVQRIGK 124          
BLAST of RING-box protein vs. TrEMBL
Match: A0A0P6BUL0 (RING-box protein OS=Daphnia magna OX=35525 GN=APZ42_031744 PE=4 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 8.912e-34
Identity = 57/109 (52.29%), Postives = 77/109 (70.64%), Query Frame = 1
Query:    1 LYKSYMKMTDNSDVKFTNQNLFTLKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNR----LTECILVWGECNHVFHNCCISQWIKKNNNCPLCQQIWNVRRIGK 315
            + K   K+T N+D    ++ +F+LKRWN V +WSW+   E CAICR  VM+ C+ CQ +NR      EC+++WGECNH FHNCC+  W+K+NN CPLCQQ W+V+RIGK
Sbjct:    7 MEKPAEKVTVNNDCVMKSEKMFSLKRWNAVAMWSWDVECEICAICRVQVMDACLRCQAENRNDKEQEECVVIWGECNHSFHNCCMKLWVKQNNRCPLCQQEWSVQRIGK 115          
BLAST of RING-box protein vs. TrEMBL
Match: A0A0B6YZ48 (RING-type domain-containing protein OS=Arion vulgaris OX=1028688 GN=ORF40821 PE=4 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.972e-33
Identity = 55/99 (55.56%), Postives = 74/99 (74.75%), Query Frame = 1
Query:   25 TDNSDVKFT--NQNLFTLKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRLTECILVWGECNHVFHNCCISQWIKKNNNCPLCQQIWNVRRIGK 315
            TD SD +     + +FTLK+WNLV +WSW+   + CAICR  VM+ C+ CQ++N+  +C++VWGECNH FHNCC+S W+K+NN CPLCQQ W V+R GK
Sbjct:    7 TDQSDKEGVPKAEKMFTLKKWNLVAMWSWDVECDTCAICRVQVMDACLRCQSENKQDDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQEWVVQRTGK 105          
BLAST of RING-box protein vs. TrEMBL
Match: A0A2I4C0X2 (RING-box protein 2 OS=Austrofundulus limnaeus OX=52670 GN=rnf7 PE=4 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 2.416e-33
Identity = 52/95 (54.74%), Postives = 72/95 (75.79%), Query Frame = 1
Query:   31 NSDVKFTNQNLFTLKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRLTECILVWGECNHVFHNCCISQWIKKNNNCPLCQQIWNVRRIGK 315
            +S +K +   +F+LK+WN V +WSW+   + CAICR  VM+ C+ CQ +N+  +C++VWGECNH FHNCC+S W+K+NN CPLCQQ W V+RIGK
Sbjct:   16 SSSLKSSGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK 110          
BLAST of RING-box protein vs. TrEMBL
Match: V4AH00 (RING-type domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_231871 PE=4 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 2.653e-33
Identity = 52/85 (61.18%), Postives = 69/85 (81.18%), Query Frame = 1
Query:   61 LFTLKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRLTECILVWGECNHVFHNCCISQWIKKNNNCPLCQQIWNVRRIGK 315
            +FTLK+WNLV +WSW+   + CAICR  VM+ C+ CQ++N+  +C++VWGECNH FHNCC+S W+K+NN CPLCQQ W V+RIGK
Sbjct:   24 MFTLKKWNLVAMWSWDVECDTCAICRVQVMDACLRCQSENKQDDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQEWVVQRIGK 108          
BLAST of RING-box protein vs. Ensembl Cavefish
Match: rnf7 (ring finger protein 7 [Source:NCBI gene;Acc:103026563])

HSP 1 Score: 118.627 bits (296), Expect = 5.323e-35
Identity = 50/85 (58.82%), Postives = 67/85 (78.82%), Query Frame = 1
Query:   61 LFTLKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRLTECILVWGECNHVFHNCCISQWIKKNNNCPLCQQIWNVRRIGK 315
            +F+LK+WN V +WSW+   + CAICR  VM+ C+ CQ +N+  +C++VWGECNH FHNCC+S W+K+NN CPLCQQ W V+RIGK
Sbjct:   35 MFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK 119          
BLAST of RING-box protein vs. Ensembl Cavefish
Match: rbx1 (ring-box 1, E3 ubiquitin protein ligase [Source:ZFIN;Acc:ZDB-GENE-041008-106])

HSP 1 Score: 85.8853 bits (211), Expect = 4.649e-22
Identity = 40/103 (38.83%), Postives = 58/103 (56.31%), Query Frame = 1
Query:   13 YMKMTDNSDVKFTNQNLFTLKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRLT---ECILVWGECNHVFHNCCISQWIKKNNNCPLCQQIWNVRRIG 312
            Y   T +      ++  F +K+WN V LW+W+   +NCAICRN +M+ C+ CQ +       EC + WG CNH FH  CIS+W+K    CPL  + W  ++ G
Sbjct:   20 YGVDTPSGTNSGASKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYG 122          
BLAST of RING-box protein vs. Ensembl Cavefish
Match: anapc11 (anaphase promoting complex subunit 11 [Source:NCBI gene;Acc:103021554])

HSP 1 Score: 58.5362 bits (140), Expect = 7.224e-12
Identity = 31/82 (37.80%), Postives = 43/82 (52.44%), Query Frame = 1
Query:   70 LKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRLTECILVWGECNHVFHNCCISQWI---KKNNNCPLCQQIWNVRR 306
            +K+WN V  W W    ENC ICR      C  C+      +C LVWG+C+H FH  CI +W+   +    CP+C+Q W  + 
Sbjct:    5 IKQWNGVASWLWVANDENCGICRAPFNGCCPDCKVPG--DDCPLVWGQCSHCFHMHCILKWLNSQQVQQQCPMCRQEWKFKE 84          
BLAST of RING-box protein vs. Ensembl Cavefish
Match: ttc3 (tetratricopeptide repeat domain 3 [Source:ZFIN;Acc:ZDB-GENE-090313-3])

HSP 1 Score: 45.0542 bits (105), Expect = 8.973e-6
Identity = 17/47 (36.17%), Postives = 27/47 (57.45%), Query Frame = 1
Query:  151 EPCVHCQNDNRLTE-CILVWGECNHVFHNCCISQWIKKNNNCPLCQQ 288
            +PC+ C  D    + C+L   EC H FH  CI  W+++ + CP C++
Sbjct: 1470 DPCIICHEDMATEDLCVL---ECRHSFHRECIKSWLREQSTCPTCRE 1513          
BLAST of RING-box protein vs. Ensembl Sea Lamprey
Match: rbx1 (ring-box 1, E3 ubiquitin protein ligase [Source:ZFIN;Acc:ZDB-GENE-041008-106])

HSP 1 Score: 78.9518 bits (193), Expect = 1.448e-20
Identity = 36/82 (43.90%), Postives = 50/82 (60.98%), Query Frame = 1
Query:   76 RWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRLT---ECILVWGECNHVFHNCCISQWIKKNNNCPLCQQIWNVRRIG 312
            +WN V LW+W+   +NCAICRN +M+ C+ CQ +       EC + WG CNH FH  CIS+W+K    CPL  + W  ++ G
Sbjct:    1 QWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYG 82          
BLAST of RING-box protein vs. Ensembl Sea Lamprey
Match: rnf111 (ring finger protein 111 [Source:ZFIN;Acc:ZDB-GENE-070808-2])

HSP 1 Score: 43.5134 bits (101), Expect = 5.534e-6
Identity = 16/47 (34.04%), Postives = 25/47 (53.19%), Query Frame = 1
Query:  169 QNDNRLTECILVWGE--------CNHVFHNCCISQWIKKNNNCPLCQ 285
            +N+ + T C+ V  E        C H+FH  C+ QW+  N  CP+C+
Sbjct:  843 ENEEKCTICLSVLEEEEDVRRLPCMHLFHQVCVDQWLTTNKKCPICR 889          
BLAST of RING-box protein vs. Ensembl Yeast
Match: HRT1 (RING-H2 domain core subunit of multiple ubiquitin ligase complexes; subunit of Skp1-Cullin-F-box (SCF) that tethers the Cdc34p (E2) and Cdc53p (cullin) SCF subunits, and is required for degradation of Gic2p, Far1p, Sic1p and Cln2p; subunit of the Rtt101p-Mms1p-Mms22p ubiquitin ligase that stabilizes replication forks after DNA lesions; subunit of the Cul3p-Elc1p-Ela1p ubiquitin ligase involved in Rpb1p degradation as part of transcription-coupled repair [Source:SGD;Acc:S000005493])

HSP 1 Score: 94.7449 bits (234), Expect = 1.519e-26
Identity = 42/92 (45.65%), Postives = 56/92 (60.87%), Query Frame = 1
Query:   49 TNQNLFTLKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQND---NRLTECILVWGECNHVFHNCCISQWIKKNNNCPLCQQIWNVRRIGK 315
            T +  F +K+W  V  WSW+   +NCAICRN +MEPC+ CQ     +   EC+  WG CNH FH  CI++WIK  + CPL  Q W + R G+
Sbjct:   30 TKKKRFEIKKWTAVAFWSWDIAVDNCAICRNHIMEPCIECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWIKTRDACPLDNQPWQLARCGR 121          
BLAST of RING-box protein vs. Ensembl Nematostella
Match: EDO46054 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR57])

HSP 1 Score: 120.168 bits (300), Expect = 3.105e-36
Identity = 50/88 (56.82%), Postives = 69/88 (78.41%), Query Frame = 1
Query:   52 NQNLFTLKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRLTECILVWGECNHVFHNCCISQWIKKNNNCPLCQQIWNVRRIGK 315
            +Q +F+LK+WN + +WSW+   + CAICR  VM+ C+ CQ+DN+  EC++VWGECNH FHNCC+S W+ +NN CPLCQQ W V+RIG+
Sbjct:   12 SQKMFSLKKWNAIAMWSWDVECDTCAICRVQVMDACLRCQSDNKQEECVVVWGECNHSFHNCCMSLWVVQNNRCPLCQQEWVVQRIGR 99          
BLAST of RING-box protein vs. Ensembl Nematostella
Match: EDO37895 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEK8])

HSP 1 Score: 87.4261 bits (215), Expect = 2.492e-23
Identity = 44/112 (39.29%), Postives = 60/112 (53.57%), Query Frame = 1
Query:   16 MKMTDNSDVKFTNQ---------NLFTLKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRLT---ECILVWGECNHVFHNCCISQWIKKNNNCPLCQQIWNVRRIGK 315
            M   D  DV  T Q           F +K+WN V LW+W+   +NCAICRN +M+ C+ CQ +       EC + WG CNH FH  CIS+W+K    CPL  + W  ++ G+
Sbjct:    1 MADEDRMDVDDTAQPSTSAGPAKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGR 112          
BLAST of RING-box protein vs. Ensembl Nematostella
Match: EDO29393 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T3S1])

HSP 1 Score: 70.8626 bits (172), Expect = 6.027e-17
Identity = 32/75 (42.67%), Postives = 46/75 (61.33%), Query Frame = 1
Query:   64 FTLKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDN---RLTECILVWGECNHVFHNCCISQWIKKNNNCPL 279
            F +K+WN V LW+W+   +NCAICRN +M+ C      +    LT+C++ W    H FH  CIS+W+K +  CPL
Sbjct:   20 FEVKKWNAVALWAWDIVVDNCAICRNHIMDLCKFFMVGSLCADLTKCLIAWQVVYHAFHFHCISRWLKTSQVCPL 94          
BLAST of RING-box protein vs. Ensembl Nematostella
Match: EDO36209 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJC0])

HSP 1 Score: 57.3806 bits (137), Expect = 7.289e-12
Identity = 31/83 (37.35%), Postives = 41/83 (49.40%), Query Frame = 1
Query:   64 FTLKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRLTECILVWGECNHVFHNCCISQWIKKNNN---CPLCQQIWNVR 303
            F   RW  V  W W    +NC ICR      C  C+      +C LVWG C+HVFH  CI +W+    +   CP+C+Q W  +
Sbjct:    8 FHSGRWVGVATWKWMANDDNCGICRMPFDGCCPDCKVPG--DDCPLVWGRCSHVFHMHCILKWLNSQLHQQLCPMCRQEWQFK 88          
BLAST of RING-box protein vs. Ensembl Medaka
Match: rnf7 (ring finger protein 7 [Source:NCBI gene;Acc:101175180])

HSP 1 Score: 121.324 bits (303), Expect = 3.759e-36
Identity = 52/95 (54.74%), Postives = 71/95 (74.74%), Query Frame = 1
Query:   31 NSDVKFTNQNLFTLKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRLTECILVWGECNHVFHNCCISQWIKKNNNCPLCQQIWNVRRIGK 315
            +S  K  +  +F+LK+WN V +WSW+   + CAICR  VM+ C+ CQ +N+  +C++VWGECNH FHNCC+S W+K+NN CPLCQQ W V+RIGK
Sbjct:   16 SSGSKTGSDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK 110          
BLAST of RING-box protein vs. Ensembl Medaka
Match: rbx1 (ring-box 1, E3 ubiquitin protein ligase [Source:ZFIN;Acc:ZDB-GENE-041008-106])

HSP 1 Score: 60.8474 bits (146), Expect = 7.065e-13
Identity = 26/64 (40.62%), Postives = 39/64 (60.94%), Query Frame = 1
Query:   49 TNQNLFTLKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRLT---ECILVWGECNHVFH 231
            +++  F +K+WN V LW+W+   +NCAICRN +M+ C+ CQ +       EC + WG CN  F 
Sbjct:   17 SSKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNVSFQ 80          
BLAST of RING-box protein vs. Ensembl Medaka
Match: anapc11 (anaphase promoting complex subunit 11 [Source:NCBI gene;Acc:101154922])

HSP 1 Score: 58.151 bits (139), Expect = 1.020e-11
Identity = 31/83 (37.35%), Postives = 43/83 (51.81%), Query Frame = 1
Query:   67 TLKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRLTECILVWGECNHVFHNCCISQWI---KKNNNCPLCQQIWNVRR 306
             +K+WN V  W W    ENC ICR      C  C+      +C LVWG+C+H FH  CI +W+   +    CP+C+Q W  + 
Sbjct:    4 KIKQWNGVASWLWVANDENCGICRMPFNGCCPDCKVPG--DDCPLVWGQCSHCFHMHCILKWLNSQQVQQQCPMCRQEWKFKE 84          
BLAST of RING-box protein vs. Ensembl Medaka
Match: ENSORLT00000039288.1 (tetratricopeptide repeat domain 3 [Source:NCBI gene;Acc:101161328])

HSP 1 Score: 46.2098 bits (108), Expect = 3.694e-6
Identity = 18/47 (38.30%), Postives = 25/47 (53.19%), Query Frame = 1
Query:  145 VMEPCVHCQNDNRLTECILVWGECNHVFHNCCISQWIKKNNNCPLCQ 285
            V +PC+ C  D    E  ++  EC H FH  CI  W+K+   CP C+
Sbjct: 1646 VEDPCIICHEDMNPDETAVL--ECRHSFHTECIKSWLKEQRTCPTCR 1690          
BLAST of RING-box protein vs. Ensembl Medaka
Match: ENSORLT00000041419.1 (tetratricopeptide repeat domain 3 [Source:NCBI gene;Acc:101161328])

HSP 1 Score: 46.2098 bits (108), Expect = 3.694e-6
Identity = 18/47 (38.30%), Postives = 25/47 (53.19%), Query Frame = 1
Query:  145 VMEPCVHCQNDNRLTECILVWGECNHVFHNCCISQWIKKNNNCPLCQ 285
            V +PC+ C  D    E  ++  EC H FH  CI  W+K+   CP C+
Sbjct: 1646 VEDPCIICHEDMNPDETAVL--ECRHSFHTECIKSWLKEQRTCPTCR 1690          
BLAST of RING-box protein vs. Planmine SMEST
Match: SMESG000017110.1 (SMESG000017110.1)

HSP 1 Score: 200.675 bits (509), Expect = 9.963e-68
Identity = 98/98 (100.00%), Postives = 98/98 (100.00%), Query Frame = 1
Query:   22 MTDNSDVKFTNQNLFTLKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRLTECILVWGECNHVFHNCCISQWIKKNNNCPLCQQIWNVRRIGK 315
            MTDNSDVKFTNQNLFTLKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRLTECILVWGECNHVFHNCCISQWIKKNNNCPLCQQIWNVRRIGK
Sbjct:    1 MTDNSDVKFTNQNLFTLKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRLTECILVWGECNHVFHNCCISQWIKKNNNCPLCQQIWNVRRIGK 98          
BLAST of RING-box protein vs. Planmine SMEST
Match: SMESG000036014.1 (SMESG000036014.1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.075e-22
Identity = 38/86 (44.19%), Postives = 54/86 (62.79%), Query Frame = 1
Query:   64 FTLKRWNLVGLWSWECTSENCAICRNGVMEPCVHCQNDNRLT---ECILVWGECNHVFHNCCISQWIKKNNNCPLCQQIWNVRRIG 312
            F +K+WN V LW+W+   +NCAICRN +M+ C+ CQ ++      EC + WG CNH FH  CIS+W+K    CPL  + W  ++ G
Sbjct:   25 FEIKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANHATATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYG 110          
The following BLAST results are available for this feature:
BLAST of RING-box protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RNF77.581e-3558.82ring finger protein 7 [Source:HGNC Symbol;Acc:HGNC... [more]
RNF72.867e-2552.94ring finger protein 7 [Source:HGNC Symbol;Acc:HGNC... [more]
RBX13.947e-2241.76ring-box 1 [Source:HGNC Symbol;Acc:HGNC:9928][more]
ANAPC113.692e-1137.80anaphase promoting complex subunit 11 [Source:HGNC... [more]
ANAPC113.692e-1137.80anaphase promoting complex subunit 11 [Source:HGNC... [more]
back to top
BLAST of RING-box protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbx-22.732e-2851.19Yeast RBX (Ring finger protein) homolog [Source:U... [more]
rbx-12.349e-2242.55RING-box protein 1 [Source:UniProtKB/Swiss-Prot;A... [more]
rbx-12.349e-2242.55RING-box protein 1 [Source:UniProtKB/Swiss-Prot;A... [more]
apc-112.043e-933.33Anaphase-promoting complex subunit 11 [Source:Uni... [more]
apc-112.043e-933.33Anaphase-promoting complex subunit 11 [Source:Uni... [more]
back to top
BLAST of RING-box protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Roc27.782e-3449.53gene:FBgn0044020 transcript:FBtr0302211[more]
Roc27.782e-3449.53gene:FBgn0044020 transcript:FBtr0088085[more]
Roc1a6.979e-2342.22gene:FBgn0025638 transcript:FBtr0343564[more]
Roc1a6.979e-2342.22gene:FBgn0025638 transcript:FBtr0070122[more]
Roc1a1.618e-2143.48gene:FBgn0025638 transcript:FBtr0308651[more]
back to top
BLAST of RING-box protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rnf76.198e-3558.82ring finger protein 7 [Source:ZFIN;Acc:ZDB-GENE-05... [more]
rbx11.834e-2241.76ring-box 1, E3 ubiquitin protein ligase [Source:ZF... [more]
anapc115.443e-1237.80APC11 anaphase promoting complex subunit 11 homolo... [more]
anapc115.443e-1237.80APC11 anaphase promoting complex subunit 11 homolo... [more]
anapc115.443e-1237.80APC11 anaphase promoting complex subunit 11 homolo... [more]
back to top
BLAST of RING-box protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
rnf74.549e-3556.18ring finger protein 7 [Source:NCBI gene;Acc:100135... [more]
RBX13.104e-2241.76ring-box 1, E3 ubiquitin protein ligase [Source:NC... [more]
RBX12.169e-2141.57ring-box 1, E3 ubiquitin protein ligase [Source:NC... [more]
gnb1l6.083e-1137.80guanine nucleotide binding protein (G protein), be... [more]
back to top
BLAST of RING-box protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rnf79.078e-3558.82ring finger protein 7 [Source:MGI Symbol;Acc:MGI:1... [more]
Gm70755.103e-3457.65predicted gene 7075 [Source:MGI Symbol;Acc:MGI:364... [more]
Rbx12.710e-2241.76ring-box 1 [Source:MGI Symbol;Acc:MGI:1891829][more]
Rbx18.147e-1241.67ring-box 1 [Source:MGI Symbol;Acc:MGI:1891829][more]
Anapc112.790e-1137.80anaphase promoting complex subunit 11 [Source:MGI ... [more]
back to top
BLAST of RING-box protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9UBF6|RBX2_HUMAN3.641e-3458.82RING-box protein 2 OS=Homo sapiens OX=9606 GN=RNF7... [more]
sp|Q9WTZ1|RBX2_MOUSE6.350e-3458.82RING-box protein 2 OS=Mus musculus OX=10090 GN=Rnf... [more]
sp|Q08273|RBX1_YEAST1.055e-2445.65RING-box protein HRT1 OS=Saccharomyces cerevisiae ... [more]
sp|Q54K33|RBX1_DICDI6.570e-2342.86RING-box protein 1 OS=Dictyostelium discoideum OX=... [more]
sp|Q9W5E1|RBX1A_DROME6.995e-2242.22RING-box protein 1A OS=Drosophila melanogaster OX=... [more]
back to top
BLAST of RING-box protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
W4Z1L41.286e-3456.38RING-type domain-containing protein OS=Strongyloce... [more]
A0A0P6BUL08.912e-3452.29RING-box protein OS=Daphnia magna OX=35525 GN=APZ4... [more]
A0A0B6YZ481.972e-3355.56RING-type domain-containing protein OS=Arion vulga... [more]
A0A2I4C0X22.416e-3354.74RING-box protein 2 OS=Austrofundulus limnaeus OX=5... [more]
V4AH002.653e-3361.18RING-type domain-containing protein OS=Lottia giga... [more]
back to top
BLAST of RING-box protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
rnf75.323e-3558.82ring finger protein 7 [Source:NCBI gene;Acc:103026... [more]
rbx14.649e-2238.83ring-box 1, E3 ubiquitin protein ligase [Source:ZF... [more]
anapc117.224e-1237.80anaphase promoting complex subunit 11 [Source:NCBI... [more]
ttc38.973e-636.17tetratricopeptide repeat domain 3 [Source:ZFIN;Acc... [more]
back to top
BLAST of RING-box protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rbx11.448e-2043.90ring-box 1, E3 ubiquitin protein ligase [Source:ZF... [more]
rnf1115.534e-634.04ring finger protein 111 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of RING-box protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
HRT11.519e-2645.65RING-H2 domain core subunit of multiple ubiquitin ... [more]
back to top
BLAST of RING-box protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO460543.105e-3656.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO378952.492e-2339.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO293936.027e-1742.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362097.289e-1237.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RING-box protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rnf73.759e-3654.74ring finger protein 7 [Source:NCBI gene;Acc:101175... [more]
rbx17.065e-1340.63ring-box 1, E3 ubiquitin protein ligase [Source:ZF... [more]
anapc111.020e-1137.35anaphase promoting complex subunit 11 [Source:NCBI... [more]
ENSORLT00000039288.13.694e-638.30tetratricopeptide repeat domain 3 [Source:NCBI gen... [more]
ENSORLT00000041419.13.694e-638.30tetratricopeptide repeat domain 3 [Source:NCBI gen... [more]
back to top
BLAST of RING-box protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000017110.19.963e-68100.00SMESG000017110.1[more]
SMESG000036014.11.075e-2244.19SMESG000036014.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011320 ID=SMED30011320|Name=RING-box protein|organism=Schmidtea mediterranea sexual|type=transcript|length=452bp
CTATATAAATCTTATATGAAAATGACAGATAATTCCGATGTAAAATTTAC
AAATCAAAATTTATTTACTCTAAAGCGTTGGAATTTAGTTGGTCTTTGGA
GTTGGGAATGTACTAGTGAAAATTGTGCTATTTGCCGCAACGGAGTTATG
GAACCTTGTGTTCATTGTCAGAATGACAATCGATTGACAGAATGTATATT
AGTATGGGGTGAATGTAATCACGTATTTCATAATTGCTGCATTTCACAAT
GGATTAAAAAGAATAATAATTGTCCCCTTTGCCAGCAAATTTGGAATGTT
AGACGAATTGGGAAATGATAATTTCTAATCTGATATTTCTTAAACTGATT
TTGTCGTAATAAAATTTTTGATTATTAAAATTTAGTTAATATAAACTTTT
GCATTTGTAATTGTATTTTTGAAATAAATTGTTAAATGACTTTGAAAAAA
AA
back to top

protein sequence of SMED30011320-orf-1

>SMED30011320-orf-1 ID=SMED30011320-orf-1|Name=SMED30011320-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=106bp
LYKSYMKMTDNSDVKFTNQNLFTLKRWNLVGLWSWECTSENCAICRNGVM
EPCVHCQNDNRLTECILVWGECNHVFHNCCISQWIKKNNNCPLCQQIWNV
RRIGK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR013083Znf_RING/FYVE/PHD
IPR024766Znf_RING_H2
IPR001841Znf_RING
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0005507copper ion binding
GO:0019788NEDD8 transferase activity
GO:0046872metal ion binding
GO:0097602cullin family protein binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005737cytoplasm
GO:0005829cytosol
GO:0031466Cul5-RING ubiquitin ligase complex
Vocabulary: biological process
TermDefinition
GO:0016567protein ubiquitination
GO:0045116protein neddylation
GO:0051775response to redox state
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR024766Zinc finger, RING-H2-typePFAMPF12678zf-rbx1coord: 34..89
e-value: 1.9E-20
score: 72.9
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 4..99
e-value: 3.2E-26
score: 93.4
NoneNo IPR availablePANTHERPTHR11210RING BOXcoord: 5..99
NoneNo IPR availablePANTHERPTHR11210:SF27RING-BOX PROTEIN 2coord: 5..99
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 15..96
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 36..89
score: 10.734