Acyl-protein thioesterase 1

Overview
NameAcyl-protein thioesterase 1
Smed IDSMED30011313
Length (bp)963
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Acyl-protein thioesterase 1 (SMED30011313) t-SNE clustered cells

Violin plots show distribution of expression levels for Acyl-protein thioesterase 1 (SMED30011313) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Acyl-protein thioesterase 1 (SMED30011313) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Acyl-protein thioesterase 1 (SMED30011313) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011313

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30011313SMESG000058272.1 dd_Smed_v4_638_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30011313SMESG000058272.1 dd_Smed_v4_638_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Human
Match: LYPLA1 (lysophospholipase 1 [Source:HGNC Symbol;Acc:HGNC:6737])

HSP 1 Score: 220.32 bits (560), Expect = 1.447e-70
Identity = 110/216 (50.93%), Postives = 148/216 (68.52%), Query Frame = 1
Query:  136 IIEAAGKHTSTLIFLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLRIL-GLSEVQFKIYPYMDHSSCDEEMQDLSKFLKTVL 780
            I+ AA K T+ +IFLHGLGDTG GWA           K ICPHA  RPVTLN    MPSWFDIIGL+PDS +DE+GIKQA++ +  ++++E++NGIP+N+I +GGFSQGGA++L+ AL+    K A V ALS WLPL +SF   P I   ++++ +LQCHG  DPLVP+  G +T + L+ L   + V FK Y  M HSSC +EM D+ +F+  +L
Sbjct:   13 IVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQ-QKLAGVTALSCWLPLRASFPQGP-IGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLL 226          
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Human
Match: LYPLA2 (lysophospholipase 2 [Source:HGNC Symbol;Acc:HGNC:6738])

HSP 1 Score: 217.238 bits (552), Expect = 1.996e-69
Identity = 104/218 (47.71%), Postives = 150/218 (68.81%), Query Frame = 1
Query:  130 AEIIEAAGKHTSTLIFLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLR-ILGLSEVQFKIYPYMDHSSCDEEMQDLSKFLKTVL 780
            A  +  A + T+ +IFLHGLGDTG  WA  L        K ICPHA   PVTLN    MPSWFD++GL+PD+P+DEAGIK+A++ +  ++  E++NGIPAN+I +GGFSQGGA++L+ AL+ P    A ++ALS WLPLH +F    +     K++ +LQCHG++DP+VP++ G +T + LR ++  + VQFK YP + HSSC +EM  + +FL+ +L
Sbjct:   14 AATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCP-HPLAGIVALSCWLPLHRAFPQAAN--GSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLL 228          
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Human
Match: LYPLA1 (lysophospholipase 1 [Source:HGNC Symbol;Acc:HGNC:6737])

HSP 1 Score: 190.274 bits (482), Expect = 5.072e-59
Identity = 100/216 (46.30%), Postives = 138/216 (63.89%), Query Frame = 1
Query:  136 IIEAAGKHTSTLIFLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLRIL-GLSEVQFKIYPYMDHSSCDEEMQDLSKFLKTVL 780
            I+ AA K T+ +IFLHGLGDTG GWA           K ICPHA                FDIIGL+PDS +DE+GIKQA++ +  ++++E++NGIP+N+I +GGFSQGGA++L+ AL+    K A V ALS WLPL +SF   P I   ++++ +LQCHG  DPLVP+  G +T + L+ L   + V FK Y  M HSSC +EM D+ +F+  +L
Sbjct:   13 IVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHA----------------FDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQ-QKLAGVTALSCWLPLRASFPQGP-IGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLL 210          
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Human
Match: LYPLA1 (lysophospholipase 1 [Source:HGNC Symbol;Acc:HGNC:6737])

HSP 1 Score: 177.948 bits (450), Expect = 1.708e-54
Identity = 95/203 (46.80%), Postives = 129/203 (63.55%), Query Frame = 1
Query:  136 IIEAAGKHTSTLIFLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLRIL-GLSEVQFKIYPYMDHSSCDE 741
            I+ AA K T+ +IFLHGLGDTG GWA           K ICPHA                FDIIGL+PDS +DE+GIKQA++ +  ++++E++NGIP+N+I +GGFSQGGA++L+ AL+    K A V ALS WLPL +SF   P I   ++++ +LQCHG  DPLVP+  G +T + L+ L   + V FK Y  M HSSC +
Sbjct:   13 IVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHA----------------FDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQ-QKLAGVTALSCWLPLRASFPQGP-IGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQ 197          
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Human
Match: LYPLA1 (lysophospholipase 1 [Source:HGNC Symbol;Acc:HGNC:6737])

HSP 1 Score: 176.022 bits (445), Expect = 8.822e-54
Identity = 93/216 (43.06%), Postives = 126/216 (58.33%), Query Frame = 1
Query:  136 IIEAAGKHTSTLIFLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLRIL-GLSEVQFKIYPYMDHSSCDEEMQDLSKFLKTVL 780
            I+ AA K T+ +IFLHGLGDTG GWA           K ICPHA  RPVTLN    MPSWFDIIGL+PDS +DE+GIKQA++ +  ++++E++NGIP+N+I +GGFSQ           GPI                            ++++ +LQCHG  DPLVP+  G +T + L+ L   + V FK Y  M HSSC +EM D+ +F+  +L
Sbjct:   13 IVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQ-----------GPIGGA-------------------------NRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLL 192          
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Celegans
Match: ath-1 (Acyl protein THioesterase family [Source:UniProtKB/TrEMBL;Acc:A0A061ACY0])

HSP 1 Score: 181.8 bits (460), Expect = 4.396e-56
Identity = 91/220 (41.36%), Postives = 135/220 (61.36%), Query Frame = 1
Query:  112 ASSKFSAEIIEAAGKHTSTLIFLHGLGDTGSGWAMNLKHYVPK-SCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLRILGLSEVQFKIYPYMDHSSCDEEMQDLSKFL 768
            A S  +  I+   G+H  TLIFLHGLGD G GWA   K      + K ICPH++ RPVTLN G  MP+WFD+ GL P++ +DE GI +A++ ++ +++ E+  GIPA++IA+GGFS GGA+A++  L+ P  K   ++ LS++    + F   P     +   P+   HG  D LVP+Q GQ++ Q+++     +V+   Y  M HSSC EEM+D+  FL
Sbjct:    3 AVSNGNPSIVSPRGEHKGTLIFLHGLGDQGHGWADAFKTEAKHDNIKFICPHSSERPVTLNMGMRMPAWFDLFGLDPNAQEDEQGINRATQYVHQLIDAEVAAGIPASRIAVGGFSMGGALAIYAGLTYP-QKLGGIVGLSSFFLQRTKF---PGSFTANNATPIFLGHGTDDFLVPLQFGQMSEQYIKKFN-PKVELHTYRGMQHSSCGEEMRDVKTFL 217          
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Celegans
Match: ath-1 (Acyl protein THioesterase family [Source:UniProtKB/TrEMBL;Acc:A0A061ACY0])

HSP 1 Score: 181.8 bits (460), Expect = 4.396e-56
Identity = 91/220 (41.36%), Postives = 135/220 (61.36%), Query Frame = 1
Query:  112 ASSKFSAEIIEAAGKHTSTLIFLHGLGDTGSGWAMNLKHYVPK-SCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLRILGLSEVQFKIYPYMDHSSCDEEMQDLSKFL 768
            A S  +  I+   G+H  TLIFLHGLGD G GWA   K      + K ICPH++ RPVTLN G  MP+WFD+ GL P++ +DE GI +A++ ++ +++ E+  GIPA++IA+GGFS GGA+A++  L+ P  K   ++ LS++    + F   P     +   P+   HG  D LVP+Q GQ++ Q+++     +V+   Y  M HSSC EEM+D+  FL
Sbjct:    3 AVSNGNPSIVSPRGEHKGTLIFLHGLGDQGHGWADAFKTEAKHDNIKFICPHSSERPVTLNMGMRMPAWFDLFGLDPNAQEDEQGINRATQYVHQLIDAEVAAGIPASRIAVGGFSMGGALAIYAGLTYP-QKLGGIVGLSSFFLQRTKF---PGSFTANNATPIFLGHGTDDFLVPLQFGQMSEQYIKKFN-PKVELHTYRGMQHSSCGEEMRDVKTFL 217          
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Celegans
Match: ath-1 (Acyl protein THioesterase family [Source:UniProtKB/TrEMBL;Acc:A0A061ACY0])

HSP 1 Score: 182.185 bits (461), Expect = 2.944e-55
Identity = 91/220 (41.36%), Postives = 135/220 (61.36%), Query Frame = 1
Query:  112 ASSKFSAEIIEAAGKHTSTLIFLHGLGDTGSGWAMNLKHYVPK-SCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLRILGLSEVQFKIYPYMDHSSCDEEMQDLSKFL 768
            A S  +  I+   G+H  TLIFLHGLGD G GWA   K      + K ICPH++ RPVTLN G  MP+WFD+ GL P++ +DE GI +A++ ++ +++ E+  GIPA++IA+GGFS GGA+A++  L+ P  K   ++ LS++    + F   P     +   P+   HG  D LVP+Q GQ++ Q+++     +V+   Y  M HSSC EEM+D+  FL
Sbjct:   84 AVSNGNPSIVSPRGEHKGTLIFLHGLGDQGHGWADAFKTEAKHDNIKFICPHSSERPVTLNMGMRMPAWFDLFGLDPNAQEDEQGINRATQYVHQLIDAEVAAGIPASRIAVGGFSMGGALAIYAGLTYP-QKLGGIVGLSSFFLQRTKF---PGSFTANNATPIFLGHGTDDFLVPLQFGQMSEQYIKKFN-PKVELHTYRGMQHSSCGEEMRDVKTFL 298          
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Fly
Match: CG18815 (gene:FBgn0042138 transcript:FBtr0076105)

HSP 1 Score: 197.978 bits (502), Expect = 2.550e-62
Identity = 101/211 (47.87%), Postives = 133/211 (63.03%), Query Frame = 1
Query:  136 IIEAAGKHTSTLIFLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLRILGLSEVQFKIYPYMDHSSCDEEMQDLSKFL 768
            I+EA  K T+TLIF+HGLGDTG GW+  L    P   KVICP A T+PV+LN G  MPSWFD+  L    P+DE GI+ A   ++ ++ KEI  GIPAN+I +GGFSQGGA+AL++AL+      A V+ALS WLPLH  F   P       +VP+ Q HG  DP+VP + GQ++   L+   +  V FK Y  + HSS D+EM D+   +
Sbjct:    6 IVEATVKQTATLIFMHGLGDTGHGWSSALAAIRPPFMKVICPTAPTQPVSLNAGFRMPSWFDLKTLDIGGPEDEPGIQSARDSVHGMIQKEISAGIPANRIVLGGFSQGGALALYSALTYD-QPLAGVVALSCWLPLHKQF---PGAKVNSDDVPIFQAHGDYDPVVPYKFGQLSASLLKSF-MKNVTFKTYSGLSHSSSDDEMDDVKDII 211          
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Fly
Match: CG18815 (gene:FBgn0042138 transcript:FBtr0076103)

HSP 1 Score: 197.978 bits (502), Expect = 2.550e-62
Identity = 101/211 (47.87%), Postives = 133/211 (63.03%), Query Frame = 1
Query:  136 IIEAAGKHTSTLIFLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLRILGLSEVQFKIYPYMDHSSCDEEMQDLSKFL 768
            I+EA  K T+TLIF+HGLGDTG GW+  L    P   KVICP A T+PV+LN G  MPSWFD+  L    P+DE GI+ A   ++ ++ KEI  GIPAN+I +GGFSQGGA+AL++AL+      A V+ALS WLPLH  F   P       +VP+ Q HG  DP+VP + GQ++   L+   +  V FK Y  + HSS D+EM D+   +
Sbjct:    6 IVEATVKQTATLIFMHGLGDTGHGWSSALAAIRPPFMKVICPTAPTQPVSLNAGFRMPSWFDLKTLDIGGPEDEPGIQSARDSVHGMIQKEISAGIPANRIVLGGFSQGGALALYSALTYD-QPLAGVVALSCWLPLHKQF---PGAKVNSDDVPIFQAHGDYDPVVPYKFGQLSASLLKSF-MKNVTFKTYSGLSHSSSDDEMDDVKDII 211          
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Fly
Match: CG18815 (gene:FBgn0042138 transcript:FBtr0076104)

HSP 1 Score: 197.978 bits (502), Expect = 2.550e-62
Identity = 101/211 (47.87%), Postives = 133/211 (63.03%), Query Frame = 1
Query:  136 IIEAAGKHTSTLIFLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLRILGLSEVQFKIYPYMDHSSCDEEMQDLSKFL 768
            I+EA  K T+TLIF+HGLGDTG GW+  L    P   KVICP A T+PV+LN G  MPSWFD+  L    P+DE GI+ A   ++ ++ KEI  GIPAN+I +GGFSQGGA+AL++AL+      A V+ALS WLPLH  F   P       +VP+ Q HG  DP+VP + GQ++   L+   +  V FK Y  + HSS D+EM D+   +
Sbjct:    6 IVEATVKQTATLIFMHGLGDTGHGWSSALAAIRPPFMKVICPTAPTQPVSLNAGFRMPSWFDLKTLDIGGPEDEPGIQSARDSVHGMIQKEISAGIPANRIVLGGFSQGGALALYSALTYD-QPLAGVVALSCWLPLHKQF---PGAKVNSDDVPIFQAHGDYDPVVPYKFGQLSASLLKSF-MKNVTFKTYSGLSHSSSDDEMDDVKDII 211          
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Fly
Match: CG18815 (gene:FBgn0042138 transcript:FBtr0331544)

HSP 1 Score: 197.593 bits (501), Expect = 4.126e-62
Identity = 101/211 (47.87%), Postives = 133/211 (63.03%), Query Frame = 1
Query:  136 IIEAAGKHTSTLIFLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLRILGLSEVQFKIYPYMDHSSCDEEMQDLSKFL 768
            I+EA  K T+TLIF+HGLGDTG GW+  L    P   KVICP A T+PV+LN G  MPSWFD+  L    P+DE GI+ A   ++ ++ KEI  GIPAN+I +GGFSQGGA+AL++AL+      A V+ALS WLPLH  F   P       +VP+ Q HG  DP+VP + GQ++   L+   +  V FK Y  + HSS D+EM D+   +
Sbjct:    6 IVEATVKQTATLIFMHGLGDTGHGWSSALAAIRPPFMKVICPTAPTQPVSLNAGFRMPSWFDLKTLDIGGPEDEPGIQSARDSVHGMIQKEISAGIPANRIVLGGFSQGGALALYSALTYD-QPLAGVVALSCWLPLHKQF---PGAKVNSDDVPIFQAHGDYDPVVPYKFGQLSASLLKSF-MKNVTFKTYSGLSHSSSDDEMDDVKDII 211          
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Fly
Match: CG18815 (gene:FBgn0042138 transcript:FBtr0331545)

HSP 1 Score: 197.208 bits (500), Expect = 6.617e-62
Identity = 101/211 (47.87%), Postives = 133/211 (63.03%), Query Frame = 1
Query:  136 IIEAAGKHTSTLIFLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLRILGLSEVQFKIYPYMDHSSCDEEMQDLSKFL 768
            I+EA  K T+TLIF+HGLGDTG GW+  L    P   KVICP A T+PV+LN G  MPSWFD+  L    P+DE GI+ A   ++ ++ KEI  GIPAN+I +GGFSQGGA+AL++AL+      A V+ALS WLPLH  F   P       +VP+ Q HG  DP+VP + GQ++   L+   +  V FK Y  + HSS D+EM D+   +
Sbjct:    6 IVEATVKQTATLIFMHGLGDTGHGWSSALAAIRPPFMKVICPTAPTQPVSLNAGFRMPSWFDLKTLDIGGPEDEPGIQSARDSVHGMIQKEISAGIPANRIVLGGFSQGGALALYSALTYD-QPLAGVVALSCWLPLHKQF---PGAKVNSDDVPIFQAHGDYDPVVPYKFGQLSASLLKSF-MKNVTFKTYSGLSHSSSDDEMDDVKDII 211          
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Zebrafish
Match: lypla2 (lysophospholipase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1715])

HSP 1 Score: 213.772 bits (543), Expect = 3.282e-68
Identity = 105/231 (45.45%), Postives = 151/231 (65.37%), Query Frame = 1
Query:   97 ISANMASSKFSAEIIEAAG--KHTSTLIFLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLR-ILGLSEVQFKIYPYMDHSSCDEEMQDLSKFLKTVL 780
            +  N  S    AE +   G  K T+ +IFLHGLGDTG GWA  +        K ICPHA   PVTLN    MPSWFD++GL+P+SP+DEAGIK+A++ +  I++ E++NGIP+N+I +GGFSQGGA++L+ AL+    + A V+ LS WLPLH +F         +K+ P+LQCHG+MDP++P+Q G +T + L+ I+    + F+ YP + HSSC +EM  +  F++  L
Sbjct:    1 MCGNNMSVPLLAEAVTVPGTEKETAVVIFLHGLGDTGHGWADAMTSIRLPYIKYICPHAPRIPVTLNLKMTMPSWFDLMGLSPESPEDEAGIKRAAENIKAIIDHEVKNGIPSNRIVLGGFSQGGALSLYTALTSQ-QQLAGVVGLSCWLPLHKTFPQAAGA-SANKDTPILQCHGEMDPMIPVQFGAMTAEKLKTIVSPENITFRTYPGLMHSSCPQEMSAVKDFIEKQL 229          
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Zebrafish
Match: lypla2 (lysophospholipase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1715])

HSP 1 Score: 213.772 bits (543), Expect = 3.282e-68
Identity = 105/231 (45.45%), Postives = 151/231 (65.37%), Query Frame = 1
Query:   97 ISANMASSKFSAEIIEAAG--KHTSTLIFLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLR-ILGLSEVQFKIYPYMDHSSCDEEMQDLSKFLKTVL 780
            +  N  S    AE +   G  K T+ +IFLHGLGDTG GWA  +        K ICPHA   PVTLN    MPSWFD++GL+P+SP+DEAGIK+A++ +  I++ E++NGIP+N+I +GGFSQGGA++L+ AL+    + A V+ LS WLPLH +F         +K+ P+LQCHG+MDP++P+Q G +T + L+ I+    + F+ YP + HSSC +EM  +  F++  L
Sbjct:    1 MCGNNMSVPLLAEAVTVPGTEKETAVVIFLHGLGDTGHGWADAMTSIRLPYIKYICPHAPRIPVTLNLKMTMPSWFDLMGLSPESPEDEAGIKRAAENIKAIIDHEVKNGIPSNRIVLGGFSQGGALSLYTALTSQ-QQLAGVVGLSCWLPLHKTFPQAAGA-SANKDTPILQCHGEMDPMIPVQFGAMTAEKLKTIVSPENITFRTYPGLMHSSCPQEMSAVKDFIEKQL 229          
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Zebrafish
Match: lypla1 (lysophospholipase 1 [Source:ZFIN;Acc:ZDB-GENE-050417-87])

HSP 1 Score: 213.386 bits (542), Expect = 3.744e-68
Identity = 107/216 (49.54%), Postives = 149/216 (68.98%), Query Frame = 1
Query:  136 IIEAAGKHTSTLIFLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLR-ILGLSEVQFKIYPYMDHSSCDEEMQDLSKFLKTVL 780
            I+ AA K T+ +IFLHGLGDTG GWA  +        K ICPHA   PVTLN    MPSWFDII L P++ +DE+GIK+A++ +  ++++E++NGIP+++I +GGFSQGGA++LF AL+    K   VIALS WLPL +S     S++  +K++ VLQCHG+ DPLVP+  GQ+T + L+ +L  S V FK Y  M HS+C EEM D+ +F++  L
Sbjct:   13 IVPAACKATAAVIFLHGLGDTGHGWAQAMAGIRTPHVKYICPHAPVMPVTLNMNMAMPSWFDIISLNPNAQEDESGIKRAAENVKALIDQEVKNGIPSHRIVLGGFSQGGALSLFTALTTH-QKLGGVIALSCWLPLRNSLSK--SVISKNKDISVLQCHGEADPLVPLIFGQLTVEKLKSMLKPSNVTFKTYSGMTHSACPEEMMDIKQFIEKQL 225          
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Zebrafish
Match: lypla2 (lysophospholipase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1715])

HSP 1 Score: 205.682 bits (522), Expect = 3.188e-65
Identity = 101/218 (46.33%), Postives = 144/218 (66.06%), Query Frame = 1
Query:   97 ISANMASSKFSAEIIEAAG--KHTSTLIFLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLR-ILGLSEVQFKIYPYMDHSSCDE 741
            +  N  S    AE +   G  K T+ +IFLHGLGDTG GWA  +        K ICPHA   PVTLN    MPSWFD++GL+P+SP+DEAGIK+A++ +  I++ E++NGIP+N+I +GGFSQGGA++L+ AL+    + A V+ LS WLPLH +F         +K+ P+LQCHG+MDP++P+Q G +T + L+ I+    + F+ YP + HSSC +
Sbjct:    1 MCGNNMSVPLLAEAVTVPGTEKETAVVIFLHGLGDTGHGWADAMTSIRLPYIKYICPHAPRIPVTLNLKMTMPSWFDLMGLSPESPEDEAGIKRAAENIKAIIDHEVKNGIPSNRIVLGGFSQGGALSLYTALTSQ-QQLAGVVGLSCWLPLHKTFPQAAGA-SANKDTPILQCHGEMDPMIPVQFGAMTAEKLKTIVSPENITFRTYPGLMHSSCPQ 216          
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Zebrafish
Match: lypla1 (lysophospholipase 1 [Source:ZFIN;Acc:ZDB-GENE-050417-87])

HSP 1 Score: 171.4 bits (433), Expect = 3.606e-52
Identity = 89/216 (41.20%), Postives = 127/216 (58.80%), Query Frame = 1
Query:  136 IIEAAGKHTSTLIFLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLR-ILGLSEVQFKIYPYMDHSSCDEEMQDLSKFLKTVL 780
            I+ AA K T+ +IFLHGLGDTG GWA  +        K ICPHA   PVTLN    MPSWFDII L P++ +DE+GIK+A++ +  ++++E++NGIP+++I +GGFSQ                                     S++  +K++ VLQCHG+ DPLVP+  GQ+T + L+ +L  S V FK Y  M HS+C EEM D+ +F++  L
Sbjct:   13 IVPAACKATAAVIFLHGLGDTGHGWAQAMAGIRTPHVKYICPHAPVMPVTLNMNMAMPSWFDIISLNPNAQEDESGIKRAAENVKALIDQEVKNGIPSHRIVLGGFSQ-------------------------------------SVISKNKDISVLQCHGEADPLVPLIFGQLTVEKLKSMLKPSNVTFKTYSGMTHSACPEEMMDIKQFIEKQL 191          
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Xenopus
Match: fuca1 (alpha-L-fucosidase 1 [Source:NCBI gene;Acc:100497659])

HSP 1 Score: 219.935 bits (559), Expect = 1.738e-70
Identity = 109/218 (50.00%), Postives = 149/218 (68.35%), Query Frame = 1
Query:  130 AEIIEAAGKHTSTLIFLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLR-ILGLSEVQFKIYPYMDHSSCDEEMQDLSKFLKTVL 780
            A  + A  + T  +IFLHGLGDTG GWA  L        K ICPHA   PVTLN    MP+WFD++GL+PD+P+DEAGIK+A++ +  I+  E++NGIPAN+I +GGFSQGGA++L+ ALS    K A VI LS WLPLH +F    S   ++K + VLQCHG+ DP++P++ G +T++ L+ +L  S+VQFK YP + HS+  EEM  +  FL+ VL
Sbjct:   14 AVTVPAGERETGAVIFLHGLGDTGHGWAEALSAIRLPHVKYICPHAPRIPVTLNMKMVMPAWFDLMGLSPDAPEDEAGIKKAAESIKTIIEHEVKNGIPANRIVLGGFSQGGALSLYTALSCQ-HKLAGVIGLSCWLPLHKTFPQAAS--GVNKEISVLQCHGEADPMIPVRFGNLTSEKLKSVLNPSKVQFKSYPGVMHSTNQEEMMAVKDFLEKVL 228          
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Xenopus
Match: lypla1 (lysophospholipase 1 [Source:NCBI gene;Acc:448212])

HSP 1 Score: 216.853 bits (551), Expect = 3.048e-69
Identity = 107/216 (49.54%), Postives = 151/216 (69.91%), Query Frame = 1
Query:  136 IIEAAGKHTSTLIFLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLR-ILGLSEVQFKIYPYMDHSSCDEEMQDLSKFLKTVL 780
            I+ AA K T+ +IFLHGLGDTG GWA  +        K ICPHA   PV+LN    MPSWFDIIGL+PD+ +DEAGIK+A++ +  ++++E++NGIP+N+I +GGFSQGGA++L+ AL+    K A V+ALS WLPL SSF    +    +K+V VLQCHG+ DPLVP+  G +T++ L+ I+  + + FK Y  + HSSC++EM D+ +F+   L
Sbjct:   13 IVPAARKATAAVIFLHGLGDTGHGWAEAMASIKSPHVKYICPHAPIMPVSLNMNMAMPSWFDIIGLSPDAQEDEAGIKRAAENVKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQ-QKLAGVVALSCWLPLRSSFPQA-AANSANKDVAVLQCHGESDPLVPLMFGTLTSEKLKTIISPANINFKTYSGLMHSSCNQEMTDIKQFIDKQL 226          
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Xenopus
Match: fuca1 (alpha-L-fucosidase 1 [Source:NCBI gene;Acc:100497659])

HSP 1 Score: 208.764 bits (530), Expect = 4.011e-66
Identity = 103/203 (50.74%), Postives = 140/203 (68.97%), Query Frame = 1
Query:  130 AEIIEAAGKHTSTLIFLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLR-ILGLSEVQFKIYPYMDHSSC 735
            A  + A  + T  +IFLHGLGDTG GWA  L        K ICPHA   PVTLN    MP+WFD++GL+PD+P+DEAGIK+A++ +  I+  E++NGIPAN+I +GGFSQGGA++L+ ALS    K A VI LS WLPLH +F    S   ++K + VLQCHG+ DP++P++ G +T++ L+ +L  S+VQFK YP + HS C
Sbjct:   14 AVTVPAGERETGAVIFLHGLGDTGHGWAEALSAIRLPHVKYICPHAPRIPVTLNMKMVMPAWFDLMGLSPDAPEDEAGIKKAAESIKTIIEHEVKNGIPANRIVLGGFSQGGALSLYTALSCQ-HKLAGVIGLSCWLPLHKTFPQAAS--GVNKEISVLQCHGEADPMIPVRFGNLTSEKLKSVLNPSKVQFKSYPGVMHSLC 213          
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Xenopus
Match: fuca1 (alpha-L-fucosidase 1 [Source:NCBI gene;Acc:100497659])

HSP 1 Score: 207.994 bits (528), Expect = 7.928e-66
Identity = 104/208 (50.00%), Postives = 145/208 (69.71%), Query Frame = 1
Query:  130 AEIIEAAGKHTSTLIFLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLR-ILGLSEVQFKIYPYMDHSSCDEEMQ 750
            A  + A  + T  +IFLHGLGDTG GWA  L        K ICPHA   PVTLN    MP+WFD++GL+PD+P+DEAGIK+A++ +  I+  E++NGIPAN+I +GGFSQGGA++L+ ALS    K A VI LS WLPLH +F    S   ++K + VLQCHG+ DP++P++ G +T++ L+ +L  S+VQFK YP + HS+ ++E+Q
Sbjct:   14 AVTVPAGERETGAVIFLHGLGDTGHGWAEALSAIRLPHVKYICPHAPRIPVTLNMKMVMPAWFDLMGLSPDAPEDEAGIKKAAESIKTIIEHEVKNGIPANRIVLGGFSQGGALSLYTALSCQ-HKLAGVIGLSCWLPLHKTFPQAAS--GVNKEISVLQCHGEADPMIPVRFGNLTSEKLKSVLNPSKVQFKSYPGVMHST-NQELQ 217          
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Xenopus
Match: fuca1 (alpha-L-fucosidase 1 [Source:NCBI gene;Acc:100497659])

HSP 1 Score: 208.379 bits (529), Expect = 8.431e-66
Identity = 105/217 (48.39%), Postives = 143/217 (65.90%), Query Frame = 1
Query:  130 AEIIEAAGKHTSTLIFLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLR-ILGLSEVQFKIYPYMDHSSCDEEMQDLSKFLKTV 777
            A  + A  + T  +IFLHGLGDTG GWA  L        K ICPHA   PVTLN    MP+WFD++GL+PD+P+DEAGIK+A++ +  I+  E++NGIPAN+I +GGFSQGGA++L+ ALS    K A VI LS WLPLH +F    S   ++K + VLQCHG+ DP++P++ G +T++ L+ +L  S+VQFK YP + HS+  E        L  V
Sbjct:   14 AVTVPAGERETGAVIFLHGLGDTGHGWAEALSAIRLPHVKYICPHAPRIPVTLNMKMVMPAWFDLMGLSPDAPEDEAGIKKAAESIKTIIEHEVKNGIPANRIVLGGFSQGGALSLYTALSCQ-HKLAGVIGLSCWLPLHKTFPQAAS--GVNKEISVLQCHGEADPMIPVRFGNLTSEKLKSVLNPSKVQFKSYPGVMHSTNQEVRTPFGLLLPRV 227          
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Mouse
Match: Lypla1 (lysophospholipase 1 [Source:MGI Symbol;Acc:MGI:1344588])

HSP 1 Score: 218.009 bits (554), Expect = 6.850e-70
Identity = 108/216 (50.00%), Postives = 148/216 (68.52%), Query Frame = 1
Query:  136 IIEAAGKHTSTLIFLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLR-ILGLSEVQFKIYPYMDHSSCDEEMQDLSKFLKTVL 780
            ++ AA K T+ +IFLHGLGDTG GWA           K ICPHA   PVTLN    MPSWFDI+GL+PDS +DE+GIKQA++ +  ++++E++NGIP+N+I +GGFSQGGA++L+ AL+    K A V ALS WLPL +SF   P I   ++++ VLQCHG  DPLVP+  G +T + L+ ++  + V FKIY  M HSSC +EM D+  F+  +L
Sbjct:   13 VVPAARKATAAVIFLHGLGDTGHGWAEAFAGIKSPHIKYICPHAPVMPVTLNMNMAMPSWFDIVGLSPDSQEDESGIKQAAETVKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQ-QKLAGVTALSCWLPLRASFSQGP-INSANRDISVLQCHGDCDPLVPLMFGSLTVERLKALINPANVTFKIYEGMMHSSCQQEMMDVKHFIDKLL 226          
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Mouse
Match: Lypla2 (lysophospholipase 2 [Source:MGI Symbol;Acc:MGI:1347000])

HSP 1 Score: 216.853 bits (551), Expect = 2.462e-69
Identity = 104/218 (47.71%), Postives = 150/218 (68.81%), Query Frame = 1
Query:  130 AEIIEAAGKHTSTLIFLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLR-ILGLSEVQFKIYPYMDHSSCDEEMQDLSKFLKTVL 780
            A  +  A + T+ +IFLHGLGDTG  WA  L        K ICPHA   PVTLN    MPSWFD++GL+PD+P+DEAGIK+A++ +  ++  E++NGIPAN+I +GGFSQGGA++L+ AL+ P    A ++ALS WLPLH +F    +     K++ +LQCHG++DP+VP++ G +T + LR ++  + VQFK YP + HSSC +EM  + +FL+ +L
Sbjct:   14 AATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCP-HPLAGIVALSCWLPLHRNFPQAAN--GSAKDLAILQCHGELDPMVPVRFGALTAEKLRTVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLL 228          
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Mouse
Match: Lypla2 (lysophospholipase 2 [Source:MGI Symbol;Acc:MGI:1347000])

HSP 1 Score: 216.853 bits (551), Expect = 2.462e-69
Identity = 104/218 (47.71%), Postives = 150/218 (68.81%), Query Frame = 1
Query:  130 AEIIEAAGKHTSTLIFLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLR-ILGLSEVQFKIYPYMDHSSCDEEMQDLSKFLKTVL 780
            A  +  A + T+ +IFLHGLGDTG  WA  L        K ICPHA   PVTLN    MPSWFD++GL+PD+P+DEAGIK+A++ +  ++  E++NGIPAN+I +GGFSQGGA++L+ AL+ P    A ++ALS WLPLH +F    +     K++ +LQCHG++DP+VP++ G +T + LR ++  + VQFK YP + HSSC +EM  + +FL+ +L
Sbjct:   14 AATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCP-HPLAGIVALSCWLPLHRNFPQAAN--GSAKDLAILQCHGELDPMVPVRFGALTAEKLRTVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLL 228          
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Mouse
Match: Lypla1 (lysophospholipase 1 [Source:MGI Symbol;Acc:MGI:1344588])

HSP 1 Score: 211.075 bits (536), Expect = 3.324e-67
Identity = 106/214 (49.53%), Postives = 145/214 (67.76%), Query Frame = 1
Query:  136 IIEAAGKHTSTLIFLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLR-ILGLSEVQFKIYPYMDHSSCDEEMQDLSKFLKT 774
            ++ AA K T+ +IFLHGLGDTG GWA           K ICPHA   PVTLN    MPSWFDI+GL+PDS +DE+GIKQA++ +  ++++E++NGIP+N+I +GGFSQGGA++L+ AL+    K A V ALS WLPL +SF   P I   ++++ VLQCHG  DPLVP+  G +T + L+ ++  + V FKIY  M HSSC +    L+ F+ T
Sbjct:   13 VVPAARKATAAVIFLHGLGDTGHGWAEAFAGIKSPHIKYICPHAPVMPVTLNMNMAMPSWFDIVGLSPDSQEDESGIKQAAETVKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQ-QKLAGVTALSCWLPLRASFSQGP-INSANRDISVLQCHGDCDPLVPLMFGSLTVERLKALINPANVTFKIYEGMMHSSCQQIGSVLASFVST 224          
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Mouse
Match: Lypla1 (lysophospholipase 1 [Source:MGI Symbol;Acc:MGI:1344588])

HSP 1 Score: 206.838 bits (525), Expect = 1.104e-65
Identity = 103/203 (50.74%), Postives = 140/203 (68.97%), Query Frame = 1
Query:  136 IIEAAGKHTSTLIFLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLR-ILGLSEVQFKIYPYMDHSSCDE 741
            ++ AA K T+ +IFLHGLGDTG GWA           K ICPHA   PVTLN    MPSWFDI+GL+PDS +DE+GIKQA++ +  ++++E++NGIP+N+I +GGFSQGGA++L+ AL+    K A V ALS WLPL +SF   P I   ++++ VLQCHG  DPLVP+  G +T + L+ ++  + V FKIY  M HSSC +
Sbjct:   13 VVPAARKATAAVIFLHGLGDTGHGWAEAFAGIKSPHIKYICPHAPVMPVTLNMNMAMPSWFDIVGLSPDSQEDESGIKQAAETVKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQ-QKLAGVTALSCWLPLRASFSQGP-INSANRDISVLQCHGDCDPLVPLMFGSLTVERLKALINPANVTFKIYEGMMHSSCQQ 213          
BLAST of Acyl-protein thioesterase 1 vs. UniProt/SwissProt
Match: sp|O75608|LYPA1_HUMAN (Acyl-protein thioesterase 1 OS=Homo sapiens OX=9606 GN=LYPLA1 PE=1 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 6.948e-70
Identity = 110/216 (50.93%), Postives = 148/216 (68.52%), Query Frame = 1
Query:  136 IIEAAGKHTSTLIFLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLRIL-GLSEVQFKIYPYMDHSSCDEEMQDLSKFLKTVL 780
            I+ AA K T+ +IFLHGLGDTG GWA           K ICPHA  RPVTLN    MPSWFDIIGL+PDS +DE+GIKQA++ +  ++++E++NGIP+N+I +GGFSQGGA++L+ AL+    K A V ALS WLPL +SF   P I   ++++ +LQCHG  DPLVP+  G +T + L+ L   + V FK Y  M HSSC +EM D+ +F+  +L
Sbjct:   13 IVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQ-QKLAGVTALSCWLPLRASFPQGP-IGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLL 226          
BLAST of Acyl-protein thioesterase 1 vs. UniProt/SwissProt
Match: sp|Q5RBR7|LYPA1_PONAB (Acyl-protein thioesterase 1 OS=Pongo abelii OX=9601 GN=LYPLA1 PE=2 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 9.415e-70
Identity = 110/216 (50.93%), Postives = 148/216 (68.52%), Query Frame = 1
Query:  136 IIEAAGKHTSTLIFLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLRIL-GLSEVQFKIYPYMDHSSCDEEMQDLSKFLKTVL 780
            I+ AA K T+ +IFLHGLGDTG GWA           K ICPHA  RPVTLN    MPSWFDIIGL+PDS +DE+GIKQA++ +  ++++E++NGIP+N+I +GGFSQGGA++L+ AL+    K A V ALS WLPL +SF   P I   ++++ +LQCHG  DPLVP+  G +T + L+ L   + V FK Y  M HSSC +EM D+ +F+  +L
Sbjct:   13 IVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRPVTLNMNMAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQ-QKLAGVTALSCWLPLRASFPQGP-IGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLL 226          
BLAST of Acyl-protein thioesterase 1 vs. UniProt/SwissProt
Match: sp|P70470|LYPA1_RAT (Acyl-protein thioesterase 1 OS=Rattus norvegicus OX=10116 GN=Lypla1 PE=1 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 1.728e-69
Identity = 108/216 (50.00%), Postives = 148/216 (68.52%), Query Frame = 1
Query:  136 IIEAAGKHTSTLIFLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLR-ILGLSEVQFKIYPYMDHSSCDEEMQDLSKFLKTVL 780
            ++ AA K T+ +IFLHGLGDTG GWA           K ICPHA   PVTLN    MPSWFDIIGL+PDS +DE+GIKQA++ +  ++++E++NGIP+N+I +GGFSQGGA++L+ AL+    K A V ALS WLPL +SF   P I   ++++ VLQCHG  DPLVP+  G +T + L+ ++  + V FK+Y  M HSSC +EM D+  F+  +L
Sbjct:   13 VVPAARKATAAVIFLHGLGDTGHGWAEAFAGIKSSHIKYICPHAPVMPVTLNMSMMMPSWFDIIGLSPDSQEDESGIKQAAETVKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQ-QKLAGVTALSCWLPLRASFSQGP-INSANRDISVLQCHGDCDPLVPLMFGSLTVERLKGLVNPANVTFKVYEGMMHSSCQQEMMDVKYFIDKLL 226          
BLAST of Acyl-protein thioesterase 1 vs. UniProt/SwissProt
Match: sp|Q3MHR0|LYPA1_BOVIN (Acyl-protein thioesterase 1 OS=Bos taurus OX=9913 GN=LYPLA1 PE=2 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 1.766e-69
Identity = 108/216 (50.00%), Postives = 148/216 (68.52%), Query Frame = 1
Query:  136 IIEAAGKHTSTLIFLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLRIL-GLSEVQFKIYPYMDHSSCDEEMQDLSKFLKTVL 780
            I+ AA K T+ +IFLHGLGDTG GWA           K ICPHA   PVTLN    MPSWFDIIGL+PDS +DE GIKQA++ +  ++++E++NGIP+N+I +GGFSQGGA++L+ AL+    K A V ALS WLPL +SF   P I  +++++ +LQCHG +DPLVP+  G +T + L+ L   + V F+ Y  M HSSC +EM D+ +F+  +L
Sbjct:   13 IVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSAHIKYICPHAPVMPVTLNMNMAMPSWFDIIGLSPDSLEDETGIKQAAENVKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQ-QKLAGVTALSCWLPLRASFPQGP-IGGVNRDISILQCHGDLDPLVPLMFGSLTAEKLKTLVNPANVTFRTYAGMMHSSCQQEMMDIKQFIDKLL 226          
BLAST of Acyl-protein thioesterase 1 vs. UniProt/SwissProt
Match: sp|O77821|LYPA1_RABIT (Acyl-protein thioesterase 1 OS=Oryctolagus cuniculus OX=9986 GN=LYPLA1 PE=1 SV=1)

HSP 1 Score: 218.009 bits (554), Expect = 4.792e-69
Identity = 108/216 (50.00%), Postives = 148/216 (68.52%), Query Frame = 1
Query:  136 IIEAAGKHTSTLIFLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLR-ILGLSEVQFKIYPYMDHSSCDEEMQDLSKFLKTVL 780
            ++ AA K T+ +IFLHGLGDTG GWA           K ICPHA   PVTLN    MPSWFDI+GL+PDS +DE+GIKQA++ +  ++++E++NGIP+N+I +GGFSQGGA++L+ AL+    K A V ALS WLPL +SF   P I   ++++ VLQCHG  DPLVP+  G +T + L+ ++  + V FKIY  M HSSC +EM D+  F+  +L
Sbjct:   13 VVPAARKATAAVIFLHGLGDTGHGWAEAFAGIKSPHIKYICPHAPVMPVTLNMNMAMPSWFDIVGLSPDSQEDESGIKQAAETVKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQ-QKLAGVTALSCWLPLRASFSQGP-INSANRDISVLQCHGDCDPLVPLMFGSLTVERLKALINPANVTFKIYEGMMHSSCQQEMMDVKHFIDKLL 226          
BLAST of Acyl-protein thioesterase 1 vs. TrEMBL
Match: C9W186 (Acyl-protein thioesterase 2 isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_010013 PE=2 SV=1)

HSP 1 Score: 257.299 bits (656), Expect = 5.665e-82
Identity = 118/220 (53.64%), Postives = 158/220 (71.82%), Query Frame = 1
Query:  109 MASSKFSAEIIEAAGKHTSTLIFLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLRILGLSEVQFKIYPYMDHSSCDEEMQDLSKFL 768
            MA+    A ++ +  KHT+TLIFLHGLGDTG GW+  L+ YVP   KVICPHAN+ PVTLNGG  MP+W+DI  L+ ++ QDEAGIK AS EL   V+ EI+ GIP   I IGGFSQGG+VAL+NAL+  + +Y  V+A S WLPLH+ F + P++L I K+VP+ QCHG  D ++P  MG++T++ L+   LS+ + K YP + HSSC++EM+DL  FL
Sbjct:    1 MANKLLPAAVVASRSKHTATLIFLHGLGDTGHGWSDTLRQYVPDYFKVICPHANSIPVTLNGGMCMPAWYDIFALSENAKQDEAGIKGASVELGKFVDAEIKAGIPVENIVIGGFSQGGSVALYNALTSTL-RYGGVVAFSCWLPLHTKFMSSPTLLTIPKDVPIFQCHGLDDCMIPFAMGKLTHELLKNFQLSKCELKCYPDLSHSSCEQEMEDLRTFL 219          
BLAST of Acyl-protein thioesterase 1 vs. TrEMBL
Match: A0A183L057 (Abhydrolase_2 domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS20705 PE=4 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 8.205e-81
Identity = 116/221 (52.49%), Postives = 158/221 (71.49%), Query Frame = 1
Query:  106 NMASSKFSAEIIEAAGKHTSTLIFLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLRILGLSEVQFKIYPYMDHSSCDEEMQDLSKFL 768
            +MA+    A +I +  KH++TLIFLHGLGDTG GW+  LK YVP   K+ICPHAN+ PVTLNGG  MP+W+DI  L+ ++ QDEAGIK+AS EL   V  EI++G+P   I IGGFSQGG+VAL+NAL+  + +Y  V+A S WLPLH+ F + P++L + K+VPV QCHG  D  +P  MG++T++ L+ + LS+ +   YP + HSSC++EM DL  FL
Sbjct:   12 DMANKLLPAAVIASRSKHSATLIFLHGLGDTGHGWSDTLKEYVPDYFKIICPHANSIPVTLNGGMCMPAWYDIYALSENAKQDEAGIKEASLELGKFVEAEIKSGVPIENIVIGGFSQGGSVALYNALTSTL-RYGGVVAFSCWLPLHTKFMSSPTLLTMPKDVPVFQCHGLEDYTIPFAMGKLTHELLKTVQLSKCELNCYPQLSHSSCEKEMGDLRTFL 231          
BLAST of Acyl-protein thioesterase 1 vs. TrEMBL
Match: O18501 (Lysophospholipase homolog OS=Schistosoma mansoni OX=6183 GN=SmLPLH PE=2 SV=1)

HSP 1 Score: 251.906 bits (642), Expect = 1.058e-79
Identity = 115/221 (52.04%), Postives = 157/221 (71.04%), Query Frame = 1
Query:  106 NMASSKFSAEIIEAAGKHTSTLIFLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLRILGLSEVQFKIYPYMDHSSCDEEMQDLSKFL 768
            +MA+    A ++ +  KH++TLIFLHGLGDTG GW+  LK YVP   K+ICPHAN+ PVTLNGG  MP+W+DI  L+ ++ QDEAGIK+AS EL   V+ EI+ G+P   I IGGFSQGG+VAL+NAL+  + +Y  V+A S WLPLH+ F + P++L + K+VPV QCHG  D  +P  MG++T++ L+   LS+ +   YP + HSSC++EM DL  FL
Sbjct:   12 DMANKLLPAAVVASRSKHSATLIFLHGLGDTGHGWSDALKEYVPDYFKIICPHANSIPVTLNGGMCMPAWYDIYALSENAKQDEAGIKEASLELGKFVDAEIKAGVPIGNIVIGGFSQGGSVALYNALTSTL-QYGGVVAFSCWLPLHTKFMSSPTLLTMPKDVPVFQCHGLEDYTIPFAMGKLTHELLKTFQLSKCELNCYPQLSHSSCEKEMGDLRTFL 231          
BLAST of Acyl-protein thioesterase 1 vs. TrEMBL
Match: G4VPG3 (Putative acyl-protein thioesterase 1,2 (Lysophospholipase I,II) OS=Schistosoma mansoni OX=6183 GN=Smp_025160.2 PE=4 SV=1)

HSP 1 Score: 251.906 bits (642), Expect = 1.130e-79
Identity = 115/221 (52.04%), Postives = 157/221 (71.04%), Query Frame = 1
Query:  106 NMASSKFSAEIIEAAGKHTSTLIFLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLRILGLSEVQFKIYPYMDHSSCDEEMQDLSKFL 768
            +MA+    A ++ +  KH++TLIFLHGLGDTG GW+  LK YVP   K+ICPHAN+ PVTLNGG  MP+W+DI  L+ ++ QDEAGIK+AS EL   V+ EI+ G+P   I IGGFSQGG+VAL+NAL+  + +Y  V+A S WLPLH+ F + P++L + K+VPV QCHG  D  +P  MG++T++ L+   LS+ +   YP + HSSC++EM DL  FL
Sbjct:   12 DMANKLLPAAVVASRSKHSATLIFLHGLGDTGHGWSDALKEYVPDYFKIICPHANSIPVTLNGGMCMPAWYDIYALSENAKQDEAGIKEASLELGKFVDAEIKAGVPIGNIVIGGFSQGGSVALYNALTSTL-QYGGVVAFSCWLPLHTKFMSSPTLLTMPKDVPVFQCHGLEDYTIPFAMGKLTHELLKTFQLSKCELNCYPQLSHSSCEKEMGDLRTFL 231          
BLAST of Acyl-protein thioesterase 1 vs. TrEMBL
Match: A0A3Q0KDH3 (Abhydrolase_2 domain-containing protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 251.136 bits (640), Expect = 1.324e-79
Identity = 115/220 (52.27%), Postives = 156/220 (70.91%), Query Frame = 1
Query:  109 MASSKFSAEIIEAAGKHTSTLIFLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLRILGLSEVQFKIYPYMDHSSCDEEMQDLSKFL 768
            MA+    A ++ +  KH++TLIFLHGLGDTG GW+  LK YVP   K+ICPHAN+ PVTLNGG  MP+W+DI  L+ ++ QDEAGIK+AS EL   V+ EI+ G+P   I IGGFSQGG+VAL+NAL+  + +Y  V+A S WLPLH+ F + P++L + K+VPV QCHG  D  +P  MG++T++ L+   LS+ +   YP + HSSC++EM DL  FL
Sbjct:    1 MANKLLPAAVVASRSKHSATLIFLHGLGDTGHGWSDALKEYVPDYFKIICPHANSIPVTLNGGMCMPAWYDIYALSENAKQDEAGIKEASLELGKFVDAEIKAGVPIGNIVIGGFSQGGSVALYNALTSTL-QYGGVVAFSCWLPLHTKFMSSPTLLTMPKDVPVFQCHGLEDYTIPFAMGKLTHELLKTFQLSKCELNCYPQLSHSSCEKEMGDLRTFL 219          
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Cavefish
Match: lypla1 (lysophospholipase 1 [Source:NCBI gene;Acc:103021974])

HSP 1 Score: 218.779 bits (556), Expect = 2.438e-70
Identity = 108/216 (50.00%), Postives = 150/216 (69.44%), Query Frame = 1
Query:  136 IIEAAGKHTSTLIFLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLR-ILGLSEVQFKIYPYMDHSSCDEEMQDLSKFLKTVL 780
            I+ AA K T+ +IFLHGLGDTG GWA  +        K ICPHA   PV+LN    MPSWFDIIGL PD+ +DE GIK+A++ +  ++++E++NGIP+++I +GGFSQGGA++L+ AL+    K A V+ALS WLPL +S     S+L  +K VPVLQCHG+ DPLVP+  G +T + L+ +L  + + FK YP M HS+C EEM D+ +F++  L
Sbjct:   13 IVPAARKATAAVIFLHGLGDTGHGWAEAMAGIRTPHVKYICPHAPIMPVSLNMNMAMPSWFDIIGLNPDAEEDETGIKKAAESIKALIDQEVKNGIPSHRIVLGGFSQGGALSLYTALTTQ-QKLAGVVALSCWLPLRNSLSK--SVLGSNKEVPVLQCHGEADPLVPLIFGCLTVEKLKTMLNPNNITFKTYPRMPHSACPEEMMDIKQFIEKQL 225          
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Cavefish
Match: lypla2 (lysophospholipase 2 [Source:NCBI gene;Acc:103045729])

HSP 1 Score: 214.927 bits (546), Expect = 8.533e-69
Identity = 104/231 (45.02%), Postives = 155/231 (67.10%), Query Frame = 1
Query:   97 ISANMASSKFSAEIIEAAG--KHTSTLIFLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLR-ILGLSEVQFKIYPYMDHSSCDEEMQDLSKFLKTVL 780
            +  N  S+   AE +  +G  K T+ +IFLHGLGD+G GWA  +        K ICPHA   PVTLN    MPSWFD++GL+P+SP+DEAGIK+A++ +  +++ E +NGIP N++ +GGFSQGGA++L+ AL+    + A V+ALS WLPLH +F    S    +K++P+LQCHG+MDP++P+Q G +T + L+ I+   ++ F+ YP + HSSC +EM  +  F++  L
Sbjct:    1 MCGNNMSAPLLAEAVTVSGTEKETAAVIFLHGLGDSGHGWADTMTSIRLPYVKYICPHAPRIPVTLNMKMTMPSWFDLMGLSPESPEDEAGIKRAAENIKALIDHETKNGIPPNRVLLGGFSQGGALSLYTALTSQ-QQLAGVVALSCWLPLHKTFPQAAS-GSANKDIPILQCHGEMDPMIPVQFGAMTAEKLKTIVNPQKITFRTYPGLMHSSCPQEMSAVKDFIEKQL 229          
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Cavefish
Match: lypla1 (lysophospholipase 1 [Source:NCBI gene;Acc:103021974])

HSP 1 Score: 206.453 bits (524), Expect = 4.364e-65
Identity = 103/203 (50.74%), Postives = 141/203 (69.46%), Query Frame = 1
Query:  136 IIEAAGKHTSTLIFLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLR-ILGLSEVQFKIYPYMDHSSCDE 741
            I+ AA K T+ +IFLHGLGDTG GWA  +        K ICPHA   PV+LN    MPSWFDIIGL PD+ +DE GIK+A++ +  ++++E++NGIP+++I +GGFSQGGA++L+ AL+    K A V+ALS WLPL +S     S+L  +K VPVLQCHG+ DPLVP+  G +T + L+ +L  + + FK YP M HS+C E
Sbjct:   13 IVPAARKATAAVIFLHGLGDTGHGWAEAMAGIRTPHVKYICPHAPIMPVSLNMNMAMPSWFDIIGLNPDAEEDETGIKKAAESIKALIDQEVKNGIPSHRIVLGGFSQGGALSLYTALTTQ-QKLAGVVALSCWLPLRNSLSK--SVLGSNKEVPVLQCHGEADPLVPLIFGCLTVEKLKTMLNPNNITFKTYPRMPHSACPE 212          
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Cavefish
Match: lypla1 (lysophospholipase 1 [Source:NCBI gene;Acc:103021974])

HSP 1 Score: 176.022 bits (445), Expect = 4.276e-54
Identity = 91/216 (42.13%), Postives = 127/216 (58.80%), Query Frame = 1
Query:  136 IIEAAGKHTSTLIFLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLR-ILGLSEVQFKIYPYMDHSSCDEEMQDLSKFLKTVL 780
            I+ AA K T+ +IFLHGLGDTG GWA  +        K ICPHA   PV+LN    MPSWFDIIGL PD+ +DE GIK+A++ +  ++++E++NGIP+++I +GGFSQ                                     S+L  +K VPVLQCHG+ DPLVP+  G +T + L+ +L  + + FK YP M HS+C EEM D+ +F++  L
Sbjct:   13 IVPAARKATAAVIFLHGLGDTGHGWAEAMAGIRTPHVKYICPHAPIMPVSLNMNMAMPSWFDIIGLNPDAEEDETGIKKAAESIKALIDQEVKNGIPSHRIVLGGFSQ-------------------------------------SVLGSNKEVPVLQCHGEADPLVPLIFGCLTVEKLKTMLNPNNITFKTYPRMPHSACPEEMMDIKQFIEKQL 191          
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Cavefish
Match: lyplal1 (lysophospholipase like 1 [Source:NCBI gene;Acc:103026429])

HSP 1 Score: 112.079 bits (279), Expect = 5.955e-29
Identity = 74/228 (32.46%), Postives = 113/228 (49.56%), Query Frame = 1
Query:  112 ASSKFSAEIIEAAGKHTSTLIFLHGLGDTGSG---WAMNL--KHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKN----VPVLQCHGQMDPLVPIQMGQITNQFLRILGLSEVQFKIYPYMDHSSCDEEMQDLSKFL 768
            A  K     +   GKH++++IFLHG GDTG G   W  ++  +    +  +VI P A +RP T   GA    WFD   ++ D P+    I++    L  +V  EI  G+P +++ IGGFS GGA+AL  A        A V ALS++L   S         K  +     + +LQCHG  D LV    G+ T+  L+  G++   F  +P ++H  C  E++ L  ++
Sbjct:    3 AVQKLRRCAVSQTGKHSASVIFLHGSGDTGQGLRAWVRDVMTQDMAFEHIRVIYPTAPSRPYTPMHGALSHVWFDRHKISRDCPEHLESIEEMCSNLGAVVQDEIRAGVPKHRMVIGGFSMGGAMALHLACRYH-QDIAGVFALSSFLNKDSVVYQAVEDAKQQQQQHPLLDLLQCHGTADELVSHSWGEETSSLLKKAGMT-TSFHSFPGLNHQLCRAELELLRSWI 228          
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Sea Lamprey
Match: lypla1 (lysophospholipase 1 [Source:ZFIN;Acc:ZDB-GENE-050417-87])

HSP 1 Score: 182.185 bits (461), Expect = 3.212e-57
Identity = 91/179 (50.84%), Postives = 124/179 (69.27%), Query Frame = 1
Query:  247 KVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLR-ILGLSEVQFKIYPYMDHSSCDEEMQDLSKFLKTVL 780
            K ICPHA   PVTLN    MPSWFDII L+ D+ +DE GIKQA++ +  ++++E+E+GIP+N+I +GGFSQGGA++L+ AL+    K A V+ALS WLPLH SF    +    ++    LQCHG+ DPLVP   G +T+Q LR ++G S V FK YP + HSSC EEM+D+ +F+   L
Sbjct:   10 KYICPHAPPMPVTLNMKMTMPSWFDIIDLSLDAREDEQGIKQAAEHVKKMIDQEVESGIPSNRIILGGFSQGGALSLYTALTSQ-QKLAGVVALSCWLPLHKSFPAA-AANSANRETSFLQCHGEQDPLVPAAFGSLTSQQLRGMMGSSNVDFKTYPGVPHSSCPEEMKDIKQFIDKHL 186          
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009128.1 (pep scaffold:Pmarinus_7.0:GL477723:131942:151443:-1 gene:ENSPMAG00000008247.1 transcript:ENSPMAT00000009128.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 151.754 bits (382), Expect = 7.501e-45
Identity = 86/234 (36.75%), Postives = 129/234 (55.13%), Query Frame = 1
Query:  136 IIEAAGKHTSTLIFLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKN-----VPVLQCHGQMD-------------PLVPIQMGQI---TNQFLRILGLSEVQFKIYPYMDHSSCDEEMQDLSKFLKT 774
            ++ A  + T++++  +  G T  GWA  L  +     K +CPHA   PVTLN    MPSWFDIIGL+PD+ +DE GIK+A++ +  ++ +EI+ GIP+++I + GFSQGGA++L+ AL+    K   V+ALS WLPL  SF     + +   +     VPVLQCHG+ D             P +P+   Q    T + +R+L  S+               +EM D+ KFL+T
Sbjct:   13 VVPATRRATASILMNYSRGATIHGWAEVLSEFKSPHIKYVCPHAPLMPVTLNLRQMMPSWFDIIGLSPDASEDEDGIKRAAETVRGLIEQEIKAGIPSHRIVLAGFSQGGALSLYTALTS-RHKLGGVVALSCWLPLRDSFTQVAPVWRPQSDGTHAGVPVLQCHGEADVLCVALSRECSFTPSLPLTFAQSLAHTQRSIRLLHCSQK-------------SDEMIDVKKFLET 232          
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Sea Lamprey
Match: lyplal1 (lysophospholipase like 1 [Source:ZFIN;Acc:ZDB-GENE-050306-32])

HSP 1 Score: 97.4413 bits (241), Expect = 1.607e-24
Identity = 70/195 (35.90%), Postives = 99/195 (50.77%), Query Frame = 1
Query:  190 GDTGSG---WAMNL--KHYVPKSCKVICPHA---NTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISK-YACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLRILGLSEVQFKIYPYMDHSSCDEEM 747
            GDTG G   W  +L  K       +V  P A     RP T N G     W+D   ++ D P+ EA I  A + L+ ++ K +++GI  N+I IGGFS GGA+A+   L+    +  A V ALS++L   SS        + +    +LQCHG+ D LVP   GQ T Q LR LG+ +VQ   +P + H     E+
Sbjct:    1 GDTGQGLQAWVKSLLQKDLASPHIRVSYPTAPFHGPRPYTANNGEKRHVWYDRYKISWDVPEHEASIDAACRSLDEVIEKVVQSGISKNRIVIGGFSMGGAMAML--LTYRFHRDVAGVFALSSFLNKGSSVYTALREAQGESFPELLQCHGRRDDLVPYAWGQGTAQELRALGV-KVQQHDFPRLTHDMSAVEL 192          
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Yeast
Match: YLR118C (Acyl-protein thioesterase responsible for depalmitoylation of Gpa1p; green fluorescent protein (GFP)-fusion protein localizes to both the cytoplasm and nucleus and is induced in response to the DNA-damaging agent MMS [Source:SGD;Acc:S000004108])

HSP 1 Score: 138.272 bits (347), Expect = 5.575e-40
Identity = 88/219 (40.18%), Postives = 121/219 (55.25%), Query Frame = 1
Query:  166 TLIFLHGLGDTGSGW---AMNLKHYVPKSCK---VICPHANTRPVTLNGGAFMPSWFDIIGLTPD-SPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKN-----VPVLQCHGQMDPLVPIQMGQITNQFLR-ILGLSEVQFKIYPYMDHSSCDEEMQDLSKFLKTVLS 783
            T+IFLHGLGDTGSGW   A  L+   P + +    + P+A    VT NGGA MP+WFDI+   P  S  D  G   +   +   V +EI+ GI   +I IGGFSQG A+AL  +++ P  K   ++AL       S F + P ILK  KN      P+   HG MDP+VPI +G    QF +    +   +FK+Y  M HS+  +E++DL+ F+K  LS
Sbjct:   16 TIIFLHGLGDTGSGWGFLAQYLQQRDPAAFQHTNFVFPNAPELHVTANGGALMPAWFDILEWDPSFSKVDSDGFMNSLNSIEKTVKQEIDKGIKPEQIIIGGFSQGAALALATSVTLPW-KIGGIVAL-------SGFCSIPGILKQHKNGINVKTPIFHGHGDMDPVVPIGLGIKAKQFYQDSCEIQNYEFKVYKGMAHSTVPDELEDLASFIKKSLS 226          
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Nematostella
Match: EDO35191 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM87])

HSP 1 Score: 203.756 bits (517), Expect = 4.709e-65
Identity = 109/219 (49.77%), Postives = 140/219 (63.93%), Query Frame = 1
Query:  139 IEAAGKHTSTLIFLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKND--PSILKIDKNVPVLQCHGQMDPLVPIQ-MGQITNQFLRILGLSEVQFKIYPYMDHSSCDEEMQDLSKFLKTVLSE 786
            +  A +    +IFLHGLGDTG GW    +  +PK  K I P+A T  VTLN G  MPSWFDI GL PD+P+D+  IK ++  L ++V KE E+GIP N+I IGGFSQGGAVAL+N  S     YA VI LSTW+PLH +F ++  PSI   +K++P+L  HG  DPLV  + MG+ T   L+ +  S   FK Y  M HSSC EEM D+ +F+  VL E
Sbjct:    3 MTGARRDRCQVIFLHGLGDTGHGWMAGFEEILPKHVKYIGPNAKTMRVTLNMGMQMPSWFDIYGLQPDAPEDQVNIKASADYLTSLVKKEEESGIPTNRIVIGGFSQGGAVALYNTWSTQ-HNYAGVIGLSTWMPLHKAFLSEVKPSI--TNKDIPILLGHGNADPLVDYEKMGRQTFGLLKTV-YSATDFKTYSRMGHSSCPEEMNDVKEFIMRVLPE 217          
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Nematostella
Match: EDO42520 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S126])

HSP 1 Score: 59.6918 bits (143), Expect = 1.856e-10
Identity = 53/240 (22.08%), Postives = 101/240 (42.08%), Query Frame = 1
Query:  109 MASSKFSAEIIEAAGKHTSTLIFLHGLGDTGSGWAMNLKHYVPKS-----CKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWL-PLHSSFKNDPSILKIDKNV--------PVLQCHGQMDPLVPIQMGQITNQFLRILGLSEVQFKIYPYMDHSSCDEEMQDLSKFLKTVLSE 786
            MA  K    +     K  + ++F HG   + S     LK  + ++      +V+ P A      ++     P WF+    +P  P+    I+++   +  ++N  + +GI  ++I +GG   G  +A+  A    +   A V  LST L PL   +K     + + K V        P+L CHG  D  V ++    T ++   L + E + ++Y   +H     ++  L +++   L +
Sbjct:    1 MALPKLKTVVNRERFKRNAAVLFFHGEEGSASNLKERLKEMLLRNFDFDHIRVVFPQAPEIISKVDRDERRPVWFNRKDYSPAFPEQIDSIERSCSLVRQLINDLVTSGIRKDRIVLGGCDMGAQIAMHVAYRY-LPDVAGVFGLSTHLGPLSHVYK-----VLLHKRVTQSDFEWPPLLLCHGHDDKRVNLKWAAHTAEYFMDLNV-ETELQVYYGQNHELSVHQVNHLKEWIIKTLPD 233          
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Medaka
Match: lypla2 (lysophospholipase 2 [Source:NCBI gene;Acc:101170197])

HSP 1 Score: 218.779 bits (556), Expect = 3.009e-70
Identity = 111/231 (48.05%), Postives = 154/231 (66.67%), Query Frame = 1
Query:   97 ISANMASSKFSAEIIEAAGKH--TSTLIFLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLR-ILGLSEVQFKIYPYMDHSSCDEEMQDLSKFLKTVL 780
            +  N  S    AE +  +GK   T+ +IFLHGLGDTG GWA  L    P   K+ICPHA   PVTLN  + +P+WFD++GL+PDSP+DE+GIK+A++ +  I+  E  NGIP+N+I +GGFSQGGA++L+ AL+      A V+ALS WLPLH SF   PS    +KN+P+LQCHG +D +VP Q G +T + L+ I+    V FK +P + HSSC EEM  + +F++ +L
Sbjct:    1 MCGNNMSVPLLAEAMTMSGKEKETAAVIFLHGLGDTGHGWAETLAKIQPSHVKIICPHAPIIPVTLNMRSMLPAWFDLMGLSPDSPEDESGIKRAAENIKAIIEHEARNGIPSNRIILGGFSQGGALSLYTALTCQ-HPLAGVVALSCWLPLHKSF---PSASGCNKNLPILQCHGDIDAMVPRQFGAMTAEKLKSIVNPQMVTFKSFPGLPHSSCPEEMAAVKEFIEKLL 227          
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Medaka
Match: lypla1 (lysophospholipase 1 [Source:NCBI gene;Acc:101160201])

HSP 1 Score: 201.83 bits (512), Expect = 1.227e-63
Identity = 103/216 (47.69%), Postives = 144/216 (66.67%), Query Frame = 1
Query:  136 IIEAAGKHTSTLIFLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLR-ILGLSEVQFKIYPYMDHSSCDEEMQDLSKFLKTVL 780
            I+ AA K T+ ++FLHGLGDTG GWA           K I PHA T PV+LN    MPSWFDI GL+PD+ +DEAGIK+AS+ L  ++ +E+ NGIP+++I +GGFSQGGA++L+ AL+    K A VIALS+WLPL  SF    +    +K++ VLQCHG  DPLVP+  G  T + ++ ++  + + FK Y  + HS+C EEM D+ +F++  L
Sbjct:   13 IVPAARKATAAVVFLHGLGDTGHGWAEAFAGIRLPHVKYIFPHAPTMPVSLNMRMSMPSWFDIYGLSPDADEDEAGIKRASENLKTLIEQEVRNGIPSHRIILGGFSQGGALSLYTALTTQ-QKLAGVIALSSWLPLRKSFPQA-AANSANKDMHVLQCHGDADPLVPLMFGTQTAEKMKSLINPANMAFKTYRGLPHSTCPEEMVDVKRFIEKHL 226          
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Medaka
Match: lypla1 (lysophospholipase 1 [Source:NCBI gene;Acc:101160201])

HSP 1 Score: 189.889 bits (481), Expect = 7.020e-59
Identity = 98/203 (48.28%), Postives = 135/203 (66.50%), Query Frame = 1
Query:  136 IIEAAGKHTSTLIFLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLR-ILGLSEVQFKIYPYMDHSSCDE 741
            I+ AA K T+ ++FLHGLGDTG GWA           K I PHA T PV+LN    MPSWFDI GL+PD+ +DEAGIK+AS+ L  ++ +E+ NGIP+++I +GGFSQGGA++L+ AL+    K A VIALS+WLPL  SF    +    +K++ VLQCHG  DPLVP+  G  T + ++ ++  + + FK Y  + HS+C E
Sbjct:   13 IVPAARKATAAVVFLHGLGDTGHGWAEAFAGIRLPHVKYIFPHAPTMPVSLNMRMSMPSWFDIYGLSPDADEDEAGIKRASENLKTLIEQEVRNGIPSHRIILGGFSQGGALSLYTALTTQ-QKLAGVIALSSWLPLRKSFPQA-AANSANKDMHVLQCHGDADPLVPLMFGTQTAEKMKSLINPANMAFKTYRGLPHSTCPE 213          
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Medaka
Match: lypla1 (lysophospholipase 1 [Source:NCBI gene;Acc:101160201])

HSP 1 Score: 135.576 bits (340), Expect = 1.899e-38
Identity = 80/218 (36.70%), Postives = 118/218 (54.13%), Query Frame = 1
Query:  136 IIEAAGKHTSTLI--FLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLR-ILGLSEVQFKIYPYMDHSSCDEEMQDLSKFLKTVL 780
            I+ AA K T+ +I   LHG  +  +G  + L H      K I PHA T PV+LN    MPSWFDI GL+PD+ +DEAGIK+AS+ L  ++ +E+ NGIP+++I +GGFSQ  A +                                     +K++ VLQCHG  DPLVP+  G  T + ++ ++  + + FK Y  + HS+C EEM D+ +F++  L
Sbjct:   13 IVPAARKATAAVIVFLLHGWAEAFAG--IRLPH-----VKYIFPHAPTMPVSLNMRMSMPSWFDIYGLSPDADEDEAGIKRASENLKTLIEQEVRNGIPSHRIILGGFSQAAANS------------------------------------ANKDMHVLQCHGDADPLVPLMFGTQTAEKMKSLINPANMAFKTYRGLPHSTCPEEMVDVKRFIEKHL 187          
BLAST of Acyl-protein thioesterase 1 vs. Planmine SMEST
Match: SMESG000058272.1 (SMESG000058272.1)

HSP 1 Score: 510.375 bits (1313), Expect = 0.000e+0
Identity = 246/246 (100.00%), Postives = 246/246 (100.00%), Query Frame = 1
Query:   49 MGNTYCLSLKRKSTDSISANMASSKFSAEIIEAAGKHTSTLIFLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLRILGLSEVQFKIYPYMDHSSCDEEMQDLSKFLKTVLSE 786
            MGNTYCLSLKRKSTDSISANMASSKFSAEIIEAAGKHTSTLIFLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLRILGLSEVQFKIYPYMDHSSCDEEMQDLSKFLKTVLSE
Sbjct:    1 MGNTYCLSLKRKSTDSISANMASSKFSAEIIEAAGKHTSTLIFLHGLGDTGSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSPQDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGPISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQMGQITNQFLRILGLSEVQFKIYPYMDHSSCDEEMQDLSKFLKTVLSE 246          
The following BLAST results are available for this feature:
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LYPLA11.447e-7050.93lysophospholipase 1 [Source:HGNC Symbol;Acc:HGNC:6... [more]
LYPLA21.996e-6947.71lysophospholipase 2 [Source:HGNC Symbol;Acc:HGNC:6... [more]
LYPLA15.072e-5946.30lysophospholipase 1 [Source:HGNC Symbol;Acc:HGNC:6... [more]
LYPLA11.708e-5446.80lysophospholipase 1 [Source:HGNC Symbol;Acc:HGNC:6... [more]
LYPLA18.822e-5443.06lysophospholipase 1 [Source:HGNC Symbol;Acc:HGNC:6... [more]
back to top
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ath-14.396e-5641.36Acyl protein THioesterase family [Source:UniProtK... [more]
ath-14.396e-5641.36Acyl protein THioesterase family [Source:UniProtK... [more]
ath-12.944e-5541.36Acyl protein THioesterase family [Source:UniProtK... [more]
back to top
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG188152.550e-6247.87gene:FBgn0042138 transcript:FBtr0076105[more]
CG188152.550e-6247.87gene:FBgn0042138 transcript:FBtr0076103[more]
CG188152.550e-6247.87gene:FBgn0042138 transcript:FBtr0076104[more]
CG188154.126e-6247.87gene:FBgn0042138 transcript:FBtr0331544[more]
CG188156.617e-6247.87gene:FBgn0042138 transcript:FBtr0331545[more]
back to top
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lypla23.282e-6845.45lysophospholipase 2 [Source:ZFIN;Acc:ZDB-GENE-0404... [more]
lypla23.282e-6845.45lysophospholipase 2 [Source:ZFIN;Acc:ZDB-GENE-0404... [more]
lypla13.744e-6849.54lysophospholipase 1 [Source:ZFIN;Acc:ZDB-GENE-0504... [more]
lypla23.188e-6546.33lysophospholipase 2 [Source:ZFIN;Acc:ZDB-GENE-0404... [more]
lypla13.606e-5241.20lysophospholipase 1 [Source:ZFIN;Acc:ZDB-GENE-0504... [more]
back to top
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fuca11.738e-7050.00alpha-L-fucosidase 1 [Source:NCBI gene;Acc:1004976... [more]
lypla13.048e-6949.54lysophospholipase 1 [Source:NCBI gene;Acc:448212][more]
fuca14.011e-6650.74alpha-L-fucosidase 1 [Source:NCBI gene;Acc:1004976... [more]
fuca17.928e-6650.00alpha-L-fucosidase 1 [Source:NCBI gene;Acc:1004976... [more]
fuca18.431e-6648.39alpha-L-fucosidase 1 [Source:NCBI gene;Acc:1004976... [more]
back to top
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lypla16.850e-7050.00lysophospholipase 1 [Source:MGI Symbol;Acc:MGI:134... [more]
Lypla22.462e-6947.71lysophospholipase 2 [Source:MGI Symbol;Acc:MGI:134... [more]
Lypla22.462e-6947.71lysophospholipase 2 [Source:MGI Symbol;Acc:MGI:134... [more]
Lypla13.324e-6749.53lysophospholipase 1 [Source:MGI Symbol;Acc:MGI:134... [more]
Lypla11.104e-6550.74lysophospholipase 1 [Source:MGI Symbol;Acc:MGI:134... [more]
back to top
BLAST of Acyl-protein thioesterase 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O75608|LYPA1_HUMAN6.948e-7050.93Acyl-protein thioesterase 1 OS=Homo sapiens OX=960... [more]
sp|Q5RBR7|LYPA1_PONAB9.415e-7050.93Acyl-protein thioesterase 1 OS=Pongo abelii OX=960... [more]
sp|P70470|LYPA1_RAT1.728e-6950.00Acyl-protein thioesterase 1 OS=Rattus norvegicus O... [more]
sp|Q3MHR0|LYPA1_BOVIN1.766e-6950.00Acyl-protein thioesterase 1 OS=Bos taurus OX=9913 ... [more]
sp|O77821|LYPA1_RABIT4.792e-6950.00Acyl-protein thioesterase 1 OS=Oryctolagus cunicul... [more]
back to top
BLAST of Acyl-protein thioesterase 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C9W1865.665e-8253.64Acyl-protein thioesterase 2 isoform 1 OS=Schistoso... [more]
A0A183L0578.205e-8152.49Abhydrolase_2 domain-containing protein OS=Schisto... [more]
O185011.058e-7952.04Lysophospholipase homolog OS=Schistosoma mansoni O... [more]
G4VPG31.130e-7952.04Putative acyl-protein thioesterase 1,2 (Lysophosph... [more]
A0A3Q0KDH31.324e-7952.27Abhydrolase_2 domain-containing protein OS=Schisto... [more]
back to top
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lypla12.438e-7050.00lysophospholipase 1 [Source:NCBI gene;Acc:10302197... [more]
lypla28.533e-6945.02lysophospholipase 2 [Source:NCBI gene;Acc:10304572... [more]
lypla14.364e-6550.74lysophospholipase 1 [Source:NCBI gene;Acc:10302197... [more]
lypla14.276e-5442.13lysophospholipase 1 [Source:NCBI gene;Acc:10302197... [more]
lyplal15.955e-2932.46lysophospholipase like 1 [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
lypla13.212e-5750.84lysophospholipase 1 [Source:ZFIN;Acc:ZDB-GENE-0504... [more]
ENSPMAT00000009128.17.501e-4536.75pep scaffold:Pmarinus_7.0:GL477723:131942:151443:-... [more]
lyplal11.607e-2435.90lysophospholipase like 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
YLR118C5.575e-4040.18Acyl-protein thioesterase responsible for depalmit... [more]
back to top
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO351914.709e-6549.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO425201.856e-1022.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Acyl-protein thioesterase 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
lypla23.009e-7048.05lysophospholipase 2 [Source:NCBI gene;Acc:10117019... [more]
lypla11.227e-6347.69lysophospholipase 1 [Source:NCBI gene;Acc:10116020... [more]
lypla17.020e-5948.28lysophospholipase 1 [Source:NCBI gene;Acc:10116020... [more]
lypla11.899e-3836.70lysophospholipase 1 [Source:NCBI gene;Acc:10116020... [more]
back to top
BLAST of Acyl-protein thioesterase 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000058272.10.000e+0100.00SMESG000058272.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011313 ID=SMED30011313|Name=Acyl-protein thioesterase 1|organism=Schmidtea mediterranea sexual|type=transcript|length=963bp
TATTAATAGTTTTTTTATTCTATTTTATTTGACCTTGAGCGTTTGTTTAT
GGGCAATACATATTGTCTATCACTAAAACGTAAATCAACTGATTCAATTT
CAGCAAATATGGCTTCCTCAAAATTTTCAGCAGAAATTATTGAAGCAGCA
GGAAAACATACTTCTACACTCATTTTTCTTCATGGTTTGGGCGATACAGG
ATCTGGCTGGGCGATGAATTTGAAACACTATGTACCTAAAAGTTGCAAAG
TTATTTGTCCACACGCAAATACTAGACCAGTTACTCTTAATGGTGGAGCA
TTTATGCCGTCCTGGTTTGATATTATCGGTTTGACTCCAGATAGTCCTCA
AGATGAAGCTGGTATCAAACAGGCTTCTAAAGAATTGAATAATATAGTTA
ATAAAGAAATCGAAAACGGTATCCCTGCGAACAAAATTGCAATAGGTGGA
TTTTCTCAAGGTGGAGCAGTAGCGTTATTCAATGCTCTCAGTGGACCTAT
ATCTAAATATGCTTGTGTTATAGCTCTAAGTACTTGGCTACCCCTTCATT
CCTCATTTAAAAACGACCCAAGCATTTTAAAGATTGACAAAAATGTGCCT
GTTTTGCAATGCCATGGTCAAATGGACCCTCTGGTACCTATTCAGATGGG
TCAGATCACTAATCAGTTTCTCAGAATTTTAGGACTTAGTGAAGTTCAGT
TCAAGATCTATCCTTATATGGACCATTCATCATGTGATGAGGAAATGCAA
GATCTATCCAAATTTTTGAAGACTGTTTTATCTGAGTGATCTTATTATCC
CTTATCAATGATCGAATATTTATTTAGTGTTGCATAATTTTCAAATTTGA
AACTAGTTAATACCGCCTGTTGTTTGGATGGGTCGCATTGAGTGTGATTC
CCAAATACCCGCTGTAATGTGGTAGTATTTGCATAAAAGTTTTGTTTATT
TTGTCAAAAAAAA
back to top

protein sequence of SMED30011313-orf-1

>SMED30011313-orf-1 ID=SMED30011313-orf-1|Name=SMED30011313-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=247bp
MGNTYCLSLKRKSTDSISANMASSKFSAEIIEAAGKHTSTLIFLHGLGDT
GSGWAMNLKHYVPKSCKVICPHANTRPVTLNGGAFMPSWFDIIGLTPDSP
QDEAGIKQASKELNNIVNKEIENGIPANKIAIGGFSQGGAVALFNALSGP
ISKYACVIALSTWLPLHSSFKNDPSILKIDKNVPVLQCHGQMDPLVPIQM
GQITNQFLRILGLSEVQFKIYPYMDHSSCDEEMQDLSKFLKTVLSE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR029058AB_hydrolase
IPR003140PLipase/COase/thioEstase
Vocabulary: molecular function
TermDefinition
GO:0016787hydrolase activity
GO:0004622lysophospholipase activity
GO:0008474palmitoyl-(protein) hydrolase activity
GO:0016298lipase activity
Vocabulary: biological process
TermDefinition
GO:0002084protein depalmitoylation
GO:0006629lipid metabolic process
GO:0006631fatty acid metabolic process
GO:0042997negative regulation of Golgi to plasma membrane protein transport
GO:0050999regulation of nitric-oxide synthase activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005739mitochondrion
GO:0005829cytosol
GO:0070062extracellular exosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003140Phospholipase/carboxylesterase/thioesterasePFAMPF02230Abhydrolase_2coord: 28..243
e-value: 8.3E-73
score: 244.8
IPR029058Alpha/Beta hydrolase foldGENE3DG3DSA:3.40.50.1820coord: 18..246
e-value: 2.9E-67
score: 228.6
IPR029058Alpha/Beta hydrolase foldSUPERFAMILYSSF53474alpha/beta-Hydrolasescoord: 34..244
NoneNo IPR availablePANTHERPTHR10655:SF65ACYL PROTEIN THIOESTERASE FAMILYcoord: 25..245
NoneNo IPR availablePANTHERPTHR10655LYSOPHOSPHOLIPASE-RELATEDcoord: 25..245