Histone-lysine N-methyltransferase SETMAR

Overview
NameHistone-lysine N-methyltransferase SETMAR
Smed IDSMED30011305
Length (bp)2074
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Histone-lysine N-methyltransferase SETMAR (SMED30011305) t-SNE clustered cells

Violin plots show distribution of expression levels for Histone-lysine N-methyltransferase SETMAR (SMED30011305) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Histone-lysine N-methyltransferase SETMAR (SMED30011305) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Histone-lysine N-methyltransferase SETMAR (SMED30011305) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011305

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30011305SMESG000077093.1 dd_Smed_v4_19193_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30011305SMESG000077093.1 dd_Smed_v4_19193_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Human
Match: SETMAR (SET domain and mariner transposase fusion gene [Source:HGNC Symbol;Acc:HGNC:10762])

HSP 1 Score: 55.4546 bits (132), Expect = 2.784e-7
Identity = 49/164 (29.88%), Postives = 65/164 (39.63%), Query Frame = 1
Query: 1309 GKGTVKESAAAEWFKRFNDGDLSLDDKPRCERPTVLKENALVDALNEDKHAITRSLATSLGVCNKTVHNHLLHLNYTLKRPQIHMISLMHKLKNELRYVSSCL-------KILQMIVFGDTLLPGTRNGFILLITMD*NNGLNEEPEPVIRPDLFCKKVMLLAW 1779
            G GT  E     WFK+F  GD SL+D+ R  RP+ +  + L   +  D    TR +A  L V + TV  HL  +    K  +     L    KN    VSS L         L  IV  D       N       +D        P+P++ P    KKVM+  W
Sbjct:  238 GPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLDKWVPHELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHP----KKVMVTIW 397          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Human
Match: SETMAR (SET domain and mariner transposase fusion gene [Source:HGNC Symbol;Acc:HGNC:10762])

HSP 1 Score: 55.0694 bits (131), Expect = 3.771e-7
Identity = 49/164 (29.88%), Postives = 65/164 (39.63%), Query Frame = 1
Query: 1309 GKGTVKESAAAEWFKRFNDGDLSLDDKPRCERPTVLKENALVDALNEDKHAITRSLATSLGVCNKTVHNHLLHLNYTLKRPQIHMISLMHKLKNELRYVSSCL-------KILQMIVFGDTLLPGTRNGFILLITMD*NNGLNEEPEPVIRPDLFCKKVMLLAW 1779
            G GT  E     WFK+F  GD SL+D+ R  RP+ +  + L   +  D    TR +A  L V + TV  HL  +    K  +     L    KN    VSS L         L  IV  D       N       +D        P+P++ P    KKVM+  W
Sbjct:  377 GPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLDKWVPHELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHP----KKVMVTIW 536          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Human
Match: SETMAR (SET domain and mariner transposase fusion gene [Source:HGNC Symbol;Acc:HGNC:10762])

HSP 1 Score: 50.447 bits (119), Expect = 3.076e-6
Identity = 27/71 (38.03%), Postives = 36/71 (50.70%), Query Frame = 1
Query: 1309 GKGTVKESAAAEWFKRFNDGDLSLDDKPRCERPTVLKENALVDALNEDKHAITRSLATSLGVCNKTVHNHL 1521
            G GT  E     WFK+F  GD SL+D+ R  RP+ +  + L   +  D    TR +A  L V + TV  HL
Sbjct:  141 GPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHL 211          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. UniProt/SwissProt
Match: sp|Q53H47|SETMR_HUMAN (Histone-lysine N-methyltransferase SETMAR OS=Homo sapiens OX=9606 GN=SETMAR PE=1 SV=2)

HSP 1 Score: 55.0694 bits (131), Expect = 1.811e-6
Identity = 49/164 (29.88%), Postives = 65/164 (39.63%), Query Frame = 1
Query: 1309 GKGTVKESAAAEWFKRFNDGDLSLDDKPRCERPTVLKENALVDALNEDKHAITRSLATSLGVCNKTVHNHLLHLNYTLKRPQIHMISLMHKLKNELRYVSSCL-------KILQMIVFGDTLLPGTRNGFILLITMD*NNGLNEEPEPVIRPDLFCKKVMLLAW 1779
            G GT  E     WFK+F  GD SL+D+ R  RP+ +  + L   +  D    TR +A  L V + TV  HL  +    K  +     L    KN    VSS L         L  IV  D       N       +D        P+P++ P    KKVM+  W
Sbjct:  377 GPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLDKWVPHELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHP----KKVMVTIW 536          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. TrEMBL
Match: A0A023F551 (Putative transposase (Fragment) OS=Triatoma infestans OX=30076 PE=2 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 2.032e-19
Identity = 45/113 (39.82%), Postives = 67/113 (59.29%), Query Frame = 3
Query: 1557 PYDLTDAQT*KRVEIC*QLLKNPTDDRFWRHIVTWDEKWIYFVNNNGLK*WVK*GT*TSDPPR---PFL*ESDAVSLVNYHGVLHYEFIPDGHAVNPELYFDIRLNIFYRIHR 1886
            P++LT  Q+ KRVEIC  LL  PTD RF++ IVT DEKW+Y+ N +    W+  G  T+ P      F  +S      NY GV+H+EF+PDG  +N +LY +    ++ ++ +
Sbjct:  117 PHELTPQQSTKRVEICKNLLMYPTDLRFYKKIVTCDEKWVYWRNPDTSGQWLSQGQ-TAFPVAVRGQFEKKSMLCVFWNYEGVIHHEFVPDGTTINSDLYCEQLDRVYAKLSQ 228          

HSP 2 Score: 49.6766 bits (117), Expect = 2.032e-19
Identity = 25/73 (34.25%), Postives = 40/73 (54.79%), Query Frame = 1
Query: 1303 VEGKGTVKESAAAEWFKRFNDGDLSLDDKPRCERPTVLKENALVDALNEDKHAITRSLATSLGVCNKTVHNHL 1521
            +EG+G + E  A  WF++F  GD +L+ K    RP++  ++AL + ++ +    TR LA   G    TV  HL
Sbjct:   31 IEGEGLLDERTARRWFQKFLSGDTTLERKKGSGRPSLDIDDALQETVDSNPAISTRDLARECGASKDTVCRHL 103          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. TrEMBL
Match: A0A023F643 (Putative transposase (Fragment) OS=Triatoma infestans OX=30076 PE=2 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 2.300e-19
Identity = 45/113 (39.82%), Postives = 67/113 (59.29%), Query Frame = 3
Query: 1557 PYDLTDAQT*KRVEIC*QLLKNPTDDRFWRHIVTWDEKWIYFVNNNGLK*WVK*GT*TSDPPR---PFL*ESDAVSLVNYHGVLHYEFIPDGHAVNPELYFDIRLNIFYRIHR 1886
            P++LT  Q+ KRVEIC  LL  PTD RF++ IVT DEKW+Y+ N +    W+  G  T+ P      F  +S      NY GV+H+EF+PDG  +N +LY +    ++ ++ +
Sbjct:  112 PHELTPQQSTKRVEICKNLLMYPTDLRFYKKIVTCDEKWVYWRNPDTSGQWLSQGQ-TAFPVAVRGQFEKKSMLCVFWNYEGVIHHEFVPDGTTINSDLYCEQLDRVYAKLSQ 223          

HSP 2 Score: 49.6766 bits (117), Expect = 2.300e-19
Identity = 25/73 (34.25%), Postives = 40/73 (54.79%), Query Frame = 1
Query: 1303 VEGKGTVKESAAAEWFKRFNDGDLSLDDKPRCERPTVLKENALVDALNEDKHAITRSLATSLGVCNKTVHNHL 1521
            +EG+G + E  A  WF++F  GD +L+ K    RP++  ++AL + ++ +    TR LA   G    TV  HL
Sbjct:   26 IEGEGLLDERTARRWFQKFLSGDTTLERKKGSGRPSLDIDDALQETVDSNPAISTRDLARECGASKDTVCRHL 98          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. TrEMBL
Match: A0A224XFJ7 (Putative transposase (Fragment) OS=Panstrongylus lignarius OX=156445 PE=4 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 2.643e-19
Identity = 38/97 (39.18%), Postives = 53/97 (54.64%), Query Frame = 3
Query: 1557 PYDLTDAQT*KRVEIC*QLLKNPTDDRFWRHIVTWDEKWIYFVNNNGLK*WVK*GT*TSDPPRPFL*ESDAVSLVNYHGVLHYEFIPDGHAVNPELY 1847
            P +LT AQ  +RV+IC QLL +P + RF + IVT DE W      +  K W+K G     P   F  +       N+ GV+++E +PD  A+N ELY
Sbjct:  113 PNNLTAAQAQRRVDICQQLLTSPNNTRFLKGIVTCDENWCXXXXXDTHKQWLKPG---QLPNDRFAHKVMLCVWWNFEGVVYFELVPDSRAINAELY 206          

HSP 2 Score: 56.225 bits (134), Expect = 2.643e-19
Identity = 29/81 (35.80%), Postives = 40/81 (49.38%), Query Frame = 1
Query: 1303 VEGKGTVKESAAAEWFKRFNDGDLSLDDKPRCERPTVLKENALVDALNEDKHAITRSLATSLGVCNKTVHNHLLHLNYTLK 1545
            VE +  V E  A  WF  FN GD +  ++PR  RP+     A   A+NE+    TR L+T LG   +T+  HL  L    +
Sbjct:   27 VEAEEVVNERTAQRWFGSFNSGDTTXXNEPRTGRPSERDIEATERAVNENPSTSTRQLSTILGPSRETIRRHLKSLGRNFR 107          

HSP 3 Score: 24.2534 bits (51), Expect = 2.643e-19
Identity = 8/13 (61.54%), Postives = 10/13 (76.92%), Query Frame = 2
Query: 1250 IRAFLRHYWKKDY 1288
            IR  LRHYWK+ +
Sbjct:    3 IRVLLRHYWKQKF 15          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. TrEMBL
Match: A0A4Y2CY75 (Histone-lysine N-methyltransferase SETMAR OS=Araneus ventricosus OX=182803 GN=SETMAR_20 PE=4 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 5.251e-17
Identity = 35/100 (35.00%), Postives = 55/100 (55.00%), Query Frame = 3
Query: 1560 YDLTDAQT*KRVEIC*QLLKNPTDDRFWRHIVTWDEKWIYFVNNNGLK*WVK*GT*TSDPPRPFL*ESDAVSLV--NYHGVLHYEFIPDGHAVNPELYFD 1853
            ++LT  Q  +R+EIC  LL+N  + RF++ IVT DEKWI+  N +  K W+  G       +    E   +  V  N+  V+++E IP G + N E+Y +
Sbjct:  113 HELTPQQANQRLEICKTLLENTQELRFFKLIVTCDEKWIHIRNPDNRKQWLDVGQSAEHVAKQRRFERKFMIGVWLNFQQVIYFEIIPKGRSFNSEIYCE 212          

HSP 2 Score: 57.7658 bits (138), Expect = 5.251e-17
Identity = 30/81 (37.04%), Postives = 43/81 (53.09%), Query Frame = 1
Query: 1303 VEGKGTVKESAAAEWFKRFNDGDLSLDDKPRCERPTVLKENALVDALNEDKHAITRSLATSLGVCNKTVHNHLLHLNYTLK 1545
            V+G G + +  A  W+KRF +GDLSL+ KPR  RP+V+    +   +       TR L+  LG+   T+   LL L  T K
Sbjct:   26 VQGDGKISDRTAQNWYKRFKEGDLSLEIKPRSGRPSVVNLQDVKQKVEMIPTTSTRKLSEELGLSEDTICLALLKLQKTYK 106          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. TrEMBL
Match: Q23702 (Transposase (Fragment) OS=Ctenolepisma lineata OX=27553 GN=mariner transposase PE=4 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 1.632e-16
Identity = 48/96 (50.00%), Postives = 59/96 (61.46%), Query Frame = 3
Query: 1569 TDAQT*KRVEIC*QLLKNPTDDRFWRHIVTWDEKWIYFVNNNGLK*WVK*GT*TSDPPRPFL*ESDAVSLV---NYHGVLHYEFIPDGHAVNPELY 1847
            T+ Q  KRVEIC QLL NP DDR W+HIVT D KW+Y V +N  K WVK G  T  P  P     D   +    N+ G++H+E +P+G AVN ELY
Sbjct:    1 TEEQASKRVEICRQLLSNPLDDRLWKHIVTSDYKWVYLVQHNRDKRWVKKGQETP-PSVPKQDRFDKKVMCLWWNFEGIVHFELVPNGRAVNAELY 95          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Planmine SMEST
Match: SMESG000077093.1 (SMESG000077093.1)

HSP 1 Score: 143.28 bits (360), Expect = 1.793e-35
Identity = 95/116 (81.90%), Postives = 101/116 (87.07%), Query Frame = 1
Query:  208 QTKIIPTEEGEIYXXXXXXXXXXXXXXXXXXXXXFEIPVETHKSDSGEHQCLQLHRIPQRRGSFLYRPSKKVVDVTDQSPGYLSEIGFFKIL*IYRKIQIVYSLFK-KFSFLIFYN 552
            QTKIIPTEEGEIYVTTKTTRRKKVRVTKNITRRVFEIPVETHKSDSGEHQCLQLHRIPQRRGSFLYRPSKKVVDVTDQSPGYLSEIG    + I    QI+ SL K + +F++  N
Sbjct:   39 QTKIIPTEEGEIYVTTKTTRRKKVRVTKNITRRVFEIPVETHKSDSGEHQCLQLHRIPQRRGSFLYRPSKKVVDVTDQSPGYLSEIGNADDVIITPFAQILASLRKVRANFMLITN 154          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Planmine SMEST
Match: SMESG000070487.1 (SMESG000070487.1)

HSP 1 Score: 60.8474 bits (146), Expect = 2.746e-9
Identity = 37/73 (50.68%), Postives = 42/73 (57.53%), Query Frame = 3
Query: 1653 VTWDEKWIYFVNNNGLK*WVK*GT*TSDPPRPFL*ESDAVSLV------NYHGVLHYEFIPDGHAVNPELYFD 1853
            VT D+KWI FVNNN LK WVK G    + P P + +      V      NY GVLHY FIP  HAVN ELY +
Sbjct:  633 VTCDDKWISFVNNNRLKQWVKHG----EEPEPVIHQDRFGKKVMLSAWWNYQGVLHYGFIPGDHAVNVELYCE 701          
The following BLAST results are available for this feature:
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
SETMAR2.784e-729.88SET domain and mariner transposase fusion gene [So... [more]
SETMAR3.771e-729.88SET domain and mariner transposase fusion gene [So... [more]
SETMAR3.076e-638.03SET domain and mariner transposase fusion gene [So... [more]
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q53H47|SETMR_HUMAN1.811e-629.88Histone-lysine N-methyltransferase SETMAR OS=Homo ... [more]
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A023F5512.032e-1939.82Putative transposase (Fragment) OS=Triatoma infest... [more]
A0A023F6432.300e-1939.82Putative transposase (Fragment) OS=Triatoma infest... [more]
A0A224XFJ72.643e-1939.18Putative transposase (Fragment) OS=Panstrongylus l... [more]
A0A4Y2CY755.251e-1735.00Histone-lysine N-methyltransferase SETMAR OS=Arane... [more]
Q237021.632e-1650.00Transposase (Fragment) OS=Ctenolepisma lineata OX=... [more]
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000077093.11.793e-3581.90SMESG000077093.1[more]
SMESG000070487.12.746e-950.68SMESG000070487.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011305 ID=SMED30011305|Name=Histone-lysine N-methyltransferase SETMAR|organism=Schmidtea mediterranea sexual|type=transcript|length=2074bp
ATTTGATTGGCTGAAATTCTAGTATAATGAAATTATCATTCGTTTTATTA
ATTTTTTTTTGGAATTTCAATCAAATTTTGATTTCGAGAATAAATGTCAA
TTTTCAGCGAGAAATTCCATTTCAATGAAGAAAATAACTCAAATAAAAAC
CAAGAAGAATTTGAAACCGAAACGACAGAAATGCCACCGGAAGTTGAAGT
GATAACTCAAACGAAAATTATTCCCACTGAAGAAGGGGAAATTTACGTAA
CAACAAAAACAACTCGTCGAAAAAAAGTGAGAGTAACGAAAAACATAACA
AGAAGAGTTTTCGAAATTCCAGTGGAAACTCATAAATCGGATTCCGGTGA
GCATCAATGTTTACAACTGCATCGCATTCCACAGAGGCGAGGATCTTTTC
TTTACAGACCTTCAAAAAAAGTTGTAGATGTTACAGATCAATCTCCAGGA
TATTTATCGGAAATCGGGTTTTTTAAAATTTTATAAATTTATAGAAAAAT
TCAAATTGTTTATTCATTATTTAAAAAGTTCTCTTTCCTTATTTTTTACA
ATAATAATAAAAATAGTTCTGGACTTGTGATTGTAGACATTCACTTATTA
TCCATAATTATTTGTTTCTTGGACACCTCATTTATACTTTTAAGACAGAG
GCAGGTACACTTTTTTGTCTTCGATCTTCAATTGAAATTTTAACATTACT
GCTGTCTATCTTTAGGTTTCGAAGTCTTTTTTTGTTTTGAAAGATTTTAT
AGAAGGACTATGATGTTTTTATATTATTTCAGCTGGCATTTATCTTGAAT
GTGATCCAATATTTGCTTGATTCATCAAAATCATAATCCTCTTCTCTTGC
AAATTTTTCTTCGTTCCAAGTACTATTCGAGTAGTAGCTCATAACGCGAA
AAGTTATGAGTTAGTTAGACGAGGGTGGGGTAAAAAATCTGTCAAATTCA
CTCAACATCATTTATGGACAGCCCCTAACTTGGTAGTACTTACTGAACCA
CTAATGGTATAATTTATTTATATGGATATATTAGGTCGTGTAAAAAGTTC
CCGGGTAGCAGCAGCAAGTGAATTTACAAAGCACTTTGCATACATGGAAG
TTATAAGTTAATAAACTCTTTTTACACGACCTAGTATATTACCATTGCTT
GAATTCATTTAATTTTGTACTGGTGTTTAAATTTCAATTTTACTATTTAA
ATTTCACTTCTGTCGGAAATCGTTGAAATGTCAGATGAAAAAAATCGTTA
TTCGAGCTTTTTTACGCCATTACTGGAAAAAGGATTATCCACAAGAGCAG
CAGTTGAAGGTAAGGGTACGGTTAAGGAATCAGCAGCTGCGGAATGGTTC
AAACGTTTTAATGATGGGGATCTTAGCCTGGATGATAAACCACGATGTGA
GCGACCAACAGTATTGAAGGAAAATGCTCTAGTTGATGCATTGAATGAAG
ATAAACATGCAATCACGCGTTCTTTAGCCACGAGTCTTGGGGTCTGCAAC
AAAACTGTCCACAATCATCTGCTGCACCTTAATTACACCCTGAAACGGCC
TCAGATCCATATGATCTCACTGATGCACAAACTTAAAAACGAGTTGAGAT
ATGTTAGCAGTTGCTTAAAAATCCTACAGATGATCGTTTTTGGAGACACA
TTGTTACCTGGGACGAGAAATGGATTTATTTTGTTAATAACAATGGATTA
AAATAATGGGTTAAATGAGGAACCTGAACCAGTGATCCGCCCAGACCTTT
TTTGTAAGAAAGTGATGCTGTTAGCCTGGTGAACTACCATGGTGTTCTGC
ATTACGAGTTTATTCCTGACGGTCATGCTGTCAACCCGGAGCTTTACTTT
GATATTCGATTAAATATTTTTTATCGCATACATCGTTAAATGGCTCTATT
TATTTGTCTTTTATCAATATGGAAATTGTGTTTAATTAGATTAAAACTTG
TAATAAGGTATTGAATAATAGCTAGTAAATTATTTTATCATGTATGTCCA
CTTAGTTTAATATAGACCCTGTTAAATATTTTAGTTTAAATTTCGGATTC
TCGATATAGTTTTCATGAATTTTA
back to top

protein sequence of SMED30011305-orf-1

>SMED30011305-orf-1 ID=SMED30011305-orf-1|Name=SMED30011305-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=158bp
MSDEKNRYSSFFTPLLEKGLSTRAAVEGKGTVKESAAAEWFKRFNDGDLS
LDDKPRCERPTVLKENALVDALNEDKHAITRSLATSLGVCNKTVHNHLLH
LNYTLKRPQIHMISLMHKLKNELRYVSSCLKILQMIVFGDTLLPGTRNGF
ILLITMD*
back to top

protein sequence of SMED30011305-orf-2

>SMED30011305-orf-2 ID=SMED30011305-orf-2|Name=SMED30011305-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=131bp
MSIFSEKFHFNEENNSNKNQEEFETETTEMPPEVEVITQTKIIPTEEGEI
YVTTKTTRRKKVRVTKNITRRVFEIPVETHKSDSGEHQCLQLHRIPQRRG
SFLYRPSKKVVDVTDQSPGYLSEIGFFKIL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0008168methyltransferase activity
GO:0016740transferase activity
GO:0003677DNA binding
GO:0004518nuclease activity
GO:0004519endonuclease activity
GO:0016787hydrolase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0032259methylation
GO:0006310DNA recombination
GO:0015074DNA integration
GO:0090305nucleic acid phosphodiester bond hydrolysis
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..31
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 11..25