Syndecan binding protein (Syntenin)

Overview
NameSyndecan binding protein (Syntenin)
Smed IDSMED30011303
Length (bp)1321
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Syndecan binding protein (Syntenin) (SMED30011303) t-SNE clustered cells

Violin plots show distribution of expression levels for Syndecan binding protein (Syntenin) (SMED30011303) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Syndecan binding protein (Syntenin) (SMED30011303) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Syndecan binding protein (Syntenin) (SMED30011303) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011303

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30011303SMESG000080994.1 SMESG000075754.1 SMESG000072110.1 SMESG000070229.1 SMESG000069022.1 SMESG000066578.1 SMESG000060322.1 SMESG000043653.1 SMESG000034864.1 SMESG000032108.1 SMESG000024585.1 SMESG000017900.1 SMESG000008246.1 SMESG000007138.1 SMESG000006895.1 SMESG000006793.1 SMESG000005359.1 Contig5571GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30011303 dd_Smed_v4_387_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30011303 dd_Smed_v4_387_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30011303 dd_Smed_v4_387_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011303 dd_Smed_v4_387_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30011303 dd_Smed_v4_387_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30011303 dd_Smed_v4_387_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30011303 dd_Smed_v4_387_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30011303 dd_Smed_v4_387_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011303 Contig38049newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011303 Contig38049uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30011303 dd_Smed_v6_387_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011303 dd_Smed_v6_387_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30011303 dd_Smed_v6_387_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30011303 dd_Smed_v6_387_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011303 dd_Smed_v4_387_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Human
Match: SDCBP (syndecan binding protein [Source:HGNC Symbol;Acc:HGNC:10662])

HSP 1 Score: 311.612 bits (797), Expect = 1.055e-103
Identity = 151/295 (51.19%), Postives = 209/295 (70.85%), Query Frame = 3
Query:   81 LYPTLEDLKVDELKSAQHNFISTVVNE--------PIGQTGSQGGLLYPALDDYLGMNMRDAQ--NQITQYCGNSVVGSGWRQNA--QVVAPVTQHDVGIVRAEIKQGLRRVVLCKDSKGMIGLRVQAVNKGLFVSFVNENSPASMAGLRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNNITVVIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVIDKTPNIVTVTIMPMFVYEHMVKTLSNNLIKNHMDHSIPEV 929
            LYP+LEDLKVD++  AQ  F +   N         PI   G+    LYP L  Y+G+++ + +    +    G  + G   R ++   +VAPVT +DVGI RAEIKQG+R V+LCKD  G IGLR+++++ G+FV  V  NSPAS+ GLRFGDQ+L+IN +  AGW++DKAHK  K A    IT+ IRDRPFERTITM+KDS G++GF+FK+GKIT +VKDSSAARNGLL +H + E+NGQNVIGLKD +I  ++  +  +VT+TIMP F++EH++K ++ +++K+ MDH+IPEV
Sbjct:    3 LYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV 297          
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Human
Match: SDCBP (syndecan binding protein [Source:HGNC Symbol;Acc:HGNC:10662])

HSP 1 Score: 310.842 bits (795), Expect = 2.093e-103
Identity = 153/301 (50.83%), Postives = 208/301 (69.10%), Query Frame = 3
Query:   81 LYPTLEDLKVDELKSAQHNFISTVVNE--------PIGQTGSQGGLLYPALDDYLGMNMRDAQNQITQYCGNSVVGSGWRQNAQVVA----------PVTQHDVGIVRAEIKQGLRRVVLCKDSKGMIGLRVQAVNKGLFVSFVNENSPASMAGLRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNNITVVIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVIDKTPNIVTVTIMPMFVYEHMVKTLSNNLIKNHMDHSIPEV 929
            LYP+LEDLKVD++  AQ  F +   N         PI   G+    LYP L  Y+G+++ + + +      N  V SG     Q+VA          PVT +DVGI RAEIKQG+R V+LCKD  G IGLR+++++ G+FV  V  NSPAS+ GLRFGDQ+L+IN +  AGW++DKAHK  K A    IT+ IRDRPFERTITM+KDS G++GF+FK+GKIT +VKDSSAARNGLL +H + E+NGQNVIGLKD +I  ++  +  +VT+TIMP F++EH++K ++ +++K+ MDH+IPEV
Sbjct:    3 LYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIR-----ANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV 298          
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Human
Match: SDCBP (syndecan binding protein [Source:HGNC Symbol;Acc:HGNC:10662])

HSP 1 Score: 310.842 bits (795), Expect = 2.093e-103
Identity = 153/301 (50.83%), Postives = 208/301 (69.10%), Query Frame = 3
Query:   81 LYPTLEDLKVDELKSAQHNFISTVVNE--------PIGQTGSQGGLLYPALDDYLGMNMRDAQNQITQYCGNSVVGSGWRQNAQVVA----------PVTQHDVGIVRAEIKQGLRRVVLCKDSKGMIGLRVQAVNKGLFVSFVNENSPASMAGLRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNNITVVIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVIDKTPNIVTVTIMPMFVYEHMVKTLSNNLIKNHMDHSIPEV 929
            LYP+LEDLKVD++  AQ  F +   N         PI   G+    LYP L  Y+G+++ + + +      N  V SG     Q+VA          PVT +DVGI RAEIKQG+R V+LCKD  G IGLR+++++ G+FV  V  NSPAS+ GLRFGDQ+L+IN +  AGW++DKAHK  K A    IT+ IRDRPFERTITM+KDS G++GF+FK+GKIT +VKDSSAARNGLL +H + E+NGQNVIGLKD +I  ++  +  +VT+TIMP F++EH++K ++ +++K+ MDH+IPEV
Sbjct:    3 LYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIR-----ANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV 298          
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Human
Match: SDCBP (syndecan binding protein [Source:HGNC Symbol;Acc:HGNC:10662])

HSP 1 Score: 310.842 bits (795), Expect = 4.587e-103
Identity = 151/295 (51.19%), Postives = 209/295 (70.85%), Query Frame = 3
Query:   81 LYPTLEDLKVDELKSAQHNFISTVVNE--------PIGQTGSQGGLLYPALDDYLGMNMRDAQ--NQITQYCGNSVVGSGWRQNA--QVVAPVTQHDVGIVRAEIKQGLRRVVLCKDSKGMIGLRVQAVNKGLFVSFVNENSPASMAGLRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNNITVVIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVIDKTPNIVTVTIMPMFVYEHMVKTLSNNLIKNHMDHSIPEV 929
            LYP+LEDLKVD++  AQ  F +   N         PI   G+    LYP L  Y+G+++ + +    +    G  + G   R ++   +VAPVT +DVGI RAEIKQG+R V+LCKD  G IGLR+++++ G+FV  V  NSPAS+ GLRFGDQ+L+IN +  AGW++DKAHK  K A    IT+ IRDRPFERTITM+KDS G++GF+FK+GKIT +VKDSSAARNGLL +H + E+NGQNVIGLKD +I  ++  +  +VT+TIMP F++EH++K ++ +++K+ MDH+IPEV
Sbjct:   24 LYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV 318          
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Human
Match: SDCBP (syndecan binding protein [Source:HGNC Symbol;Acc:HGNC:10662])

HSP 1 Score: 310.842 bits (795), Expect = 4.587e-103
Identity = 151/295 (51.19%), Postives = 209/295 (70.85%), Query Frame = 3
Query:   81 LYPTLEDLKVDELKSAQHNFISTVVNE--------PIGQTGSQGGLLYPALDDYLGMNMRDAQ--NQITQYCGNSVVGSGWRQNA--QVVAPVTQHDVGIVRAEIKQGLRRVVLCKDSKGMIGLRVQAVNKGLFVSFVNENSPASMAGLRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNNITVVIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVIDKTPNIVTVTIMPMFVYEHMVKTLSNNLIKNHMDHSIPEV 929
            LYP+LEDLKVD++  AQ  F +   N         PI   G+    LYP L  Y+G+++ + +    +    G  + G   R ++   +VAPVT +DVGI RAEIKQG+R V+LCKD  G IGLR+++++ G+FV  V  NSPAS+ GLRFGDQ+L+IN +  AGW++DKAHK  K A    IT+ IRDRPFERTITM+KDS G++GF+FK+GKIT +VKDSSAARNGLL +H + E+NGQNVIGLKD +I  ++  +  +VT+TIMP F++EH++K ++ +++K+ MDH+IPEV
Sbjct:   24 LYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV 318          
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Celegans
Match: lin-10 (pep chromosome:WBcel235:I:8109746:8118517:-1 gene:WBGene00002999.1 transcript:C09H6.2c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-10)

HSP 1 Score: 49.2914 bits (116), Expect = 4.713e-6
Identity = 44/176 (25.00%), Postives = 80/176 (45.45%), Query Frame = 3
Query:  360 KQGLRRVVLCKDSKGMIGLRVQAVNKG-----LFVSFVNENSPASMAG-LRFGDQILEINSQVVAGWTTDKAH---KFFKAAGSNNITVVIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVIDKTPNIVTVTIMPMFVY 860
            K+  + VV+ K +   +G+ V     G     + ++ +N   PA+ +  L  GDQI+ IN   + G     A    K  K A +  +TVV    P         D+   +GF  ++G I  L++   A R G+ + H++IE+NG +V+ +    I  ++      + +  MP  ++
Sbjct:  745 KETQKEVVVPKKAGEPLGIVVVESGWGSMLPTVVLAHMNPVGPAAHSNKLNIGDQIININGISLVGLPLSAAQTQIKNMKTATAVRMTVV-STPPVVEVRIRRPDTKYQLGFSVQNGVICSLLRGGIAERGGIRVGHRIIEINGTSVVAVAHDRIVNMLATAVGEIHMKTMPTSMF 919          
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Celegans
Match: lin-10 (pep chromosome:WBcel235:I:8109746:8119314:-1 gene:WBGene00002999.1 transcript:C09H6.2b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-10)

HSP 1 Score: 49.2914 bits (116), Expect = 4.993e-6
Identity = 44/176 (25.00%), Postives = 80/176 (45.45%), Query Frame = 3
Query:  360 KQGLRRVVLCKDSKGMIGLRVQAVNKG-----LFVSFVNENSPASMAG-LRFGDQILEINSQVVAGWTTDKAH---KFFKAAGSNNITVVIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVIDKTPNIVTVTIMPMFVY 860
            K+  + VV+ K +   +G+ V     G     + ++ +N   PA+ +  L  GDQI+ IN   + G     A    K  K A +  +TVV    P         D+   +GF  ++G I  L++   A R G+ + H++IE+NG +V+ +    I  ++      + +  MP  ++
Sbjct:  768 KETQKEVVVPKKAGEPLGIVVVESGWGSMLPTVVLAHMNPVGPAAHSNKLNIGDQIININGISLVGLPLSAAQTQIKNMKTATAVRMTVV-STPPVVEVRIRRPDTKYQLGFSVQNGVICSLLRGGIAERGGIRVGHRIIEINGTSVVAVAHDRIVNMLATAVGEIHMKTMPTSMF 942          
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Celegans
Match: lin-10 (pep chromosome:WBcel235:I:8109746:8119314:-1 gene:WBGene00002999.1 transcript:C09H6.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-10)

HSP 1 Score: 49.2914 bits (116), Expect = 5.247e-6
Identity = 44/176 (25.00%), Postives = 80/176 (45.45%), Query Frame = 3
Query:  360 KQGLRRVVLCKDSKGMIGLRVQAVNKG-----LFVSFVNENSPASMAG-LRFGDQILEINSQVVAGWTTDKAH---KFFKAAGSNNITVVIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVIDKTPNIVTVTIMPMFVY 860
            K+  + VV+ K +   +G+ V     G     + ++ +N   PA+ +  L  GDQI+ IN   + G     A    K  K A +  +TVV    P         D+   +GF  ++G I  L++   A R G+ + H++IE+NG +V+ +    I  ++      + +  MP  ++
Sbjct:  796 KETQKEVVVPKKAGEPLGIVVVESGWGSMLPTVVLAHMNPVGPAAHSNKLNIGDQIININGISLVGLPLSAAQTQIKNMKTATAVRMTVV-STPPVVEVRIRRPDTKYQLGFSVQNGVICSLLRGGIAERGGIRVGHRIIEINGTSVVAVAHDRIVNMLATAVGEIHMKTMPTSMF 970          
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Fly
Match: X11Lbeta (gene:FBgn0052677 transcript:FBtr0343041)

HSP 1 Score: 49.2914 bits (116), Expect = 7.887e-6
Identity = 38/177 (21.47%), Postives = 79/177 (44.63%), Query Frame = 3
Query:  360 KQGLRRVVLCKDSKGMIGLRVQAVNKG--------LFVSFVNENSPASMAGLRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNNIT--VVIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVIDKTPNIVTVTIMPMFVY 860
            K+ L++ V+   +KG I L V  V  G        +  + ++  + A    L  GDQ++ IN   + G        + K   +  +    V+   P         ++   +GF  ++G I  L++   A R G+ + H++IE+N Q+V+ +  ++I  ++  +   + +  MP  ++
Sbjct: 1879 KKELQKEVVVPKAKGEI-LGVVIVESGWGSMLPTVVIANLMSSGAAARCGQLNIGDQLIAINGLSLVGLPLSTCQTYIKNTKNQTVVKFTVVPCAPVVEVKIKRPETKYQLGFSVQNGVICSLLRGGIAERGGVRVGHRIIEINNQSVVAVPHEKIVNLLATSVGEILMKTMPTSMF 2054          
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Fly
Match: X11Lbeta (gene:FBgn0052677 transcript:FBtr0343042)

HSP 1 Score: 49.2914 bits (116), Expect = 7.909e-6
Identity = 38/177 (21.47%), Postives = 79/177 (44.63%), Query Frame = 3
Query:  360 KQGLRRVVLCKDSKGMIGLRVQAVNKG--------LFVSFVNENSPASMAGLRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNNIT--VVIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVIDKTPNIVTVTIMPMFVY 860
            K+ L++ V+   +KG I L V  V  G        +  + ++  + A    L  GDQ++ IN   + G        + K   +  +    V+   P         ++   +GF  ++G I  L++   A R G+ + H++IE+N Q+V+ +  ++I  ++  +   + +  MP  ++
Sbjct: 1942 KKELQKEVVVPKAKGEI-LGVVIVESGWGSMLPTVVIANLMSSGAAARCGQLNIGDQLIAINGLSLVGLPLSTCQTYIKNTKNQTVVKFTVVPCAPVVEVKIKRPETKYQLGFSVQNGVICSLLRGGIAERGGVRVGHRIIEINNQSVVAVPHEKIVNLLATSVGEILMKTMPTSMF 2117          
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Fly
Match: X11Lbeta (gene:FBgn0052677 transcript:FBtr0071493)

HSP 1 Score: 49.2914 bits (116), Expect = 8.261e-6
Identity = 38/177 (21.47%), Postives = 79/177 (44.63%), Query Frame = 3
Query:  360 KQGLRRVVLCKDSKGMIGLRVQAVNKG--------LFVSFVNENSPASMAGLRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNNIT--VVIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVIDKTPNIVTVTIMPMFVY 860
            K+ L++ V+   +KG I L V  V  G        +  + ++  + A    L  GDQ++ IN   + G        + K   +  +    V+   P         ++   +GF  ++G I  L++   A R G+ + H++IE+N Q+V+ +  ++I  ++  +   + +  MP  ++
Sbjct: 1952 KKELQKEVVVPKAKGEI-LGVVIVESGWGSMLPTVVIANLMSSGAAARCGQLNIGDQLIAINGLSLVGLPLSTCQTYIKNTKNQTVVKFTVVPCAPVVEVKIKRPETKYQLGFSVQNGVICSLLRGGIAERGGVRVGHRIIEINNQSVVAVPHEKIVNLLATSVGEILMKTMPTSMF 2127          
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Zebrafish
Match: sdcbp2 (syndecan binding protein (syntenin) 2 [Source:ZFIN;Acc:ZDB-GENE-030131-3727])

HSP 1 Score: 291.582 bits (745), Expect = 4.843e-96
Identity = 153/304 (50.33%), Postives = 208/304 (68.42%), Query Frame = 3
Query:   81 LYPTLEDLKVDELKSAQHNFISTVVNEPI-------GQTGSQG---GLLYPALD---DYLGMNMRDAQNQ--------ITQYCGNSVVGSGWRQNAQVVAPVTQHDVGIVRAEIKQGLRRVVLCKDSKGMIGLRVQAVNKGLFVSFVNENSPASMAGLRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNNITVVIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVIDKTPNIVTVTIMPMFVYEHMVKTLSNNLIKNHMDHSIPEV 929
            LYP+LEDLKVD++  AQ  F +   + P         Q  +QG     LYP L+   DY+G+++   + Q         TQ    S VG        +V PVT  D+GI RAEI+ GLR V+LCKD +G +GLR++ ++ G+FV  V  NSPA++AGLRFGDQ+L+IN Q VAGW +DKAHK  KAA    I +++RDRPF+RTITM+KDS+G++GF+FK G+IT LVKD SAARNGLL +H + E+NGQNVIGLKD +I+ ++  +P  +T+TIMP F++EHM+K +S  L+K+ MDHS+PEV
Sbjct:    3 LYPSLEDLKVDKVIRAQSQFANATSSTPAITQGAYQPQPATQGMPSSTLYPNLEELGDYMGLSLNSDEVQRNLALVPVATQVAVPSSVGG-------MVRPVTGADMGIRRAEIRPGLREVILCKDQEGKVGLRLRDIDNGVFVQLVQANSPAALAGLRFGDQVLQINGQNVAGWNSDKAHKALKAAAEQRIELIVRDRPFQRTITMHKDSSGHVGFIFKSGRITSLVKDGSAARNGLLTEHYICEINGQNVIGLKDTQIKDILTTSPTAMTITIMPKFIFEHMIKKMSGGLLKSSMDHSVPEV 299          
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Zebrafish
Match: sdcbp2 (syndecan binding protein (syntenin) 2 [Source:ZFIN;Acc:ZDB-GENE-030131-3727])

HSP 1 Score: 291.582 bits (745), Expect = 4.843e-96
Identity = 153/304 (50.33%), Postives = 208/304 (68.42%), Query Frame = 3
Query:   81 LYPTLEDLKVDELKSAQHNFISTVVNEPI-------GQTGSQG---GLLYPALD---DYLGMNMRDAQNQ--------ITQYCGNSVVGSGWRQNAQVVAPVTQHDVGIVRAEIKQGLRRVVLCKDSKGMIGLRVQAVNKGLFVSFVNENSPASMAGLRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNNITVVIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVIDKTPNIVTVTIMPMFVYEHMVKTLSNNLIKNHMDHSIPEV 929
            LYP+LEDLKVD++  AQ  F +   + P         Q  +QG     LYP L+   DY+G+++   + Q         TQ    S VG        +V PVT  D+GI RAEI+ GLR V+LCKD +G +GLR++ ++ G+FV  V  NSPA++AGLRFGDQ+L+IN Q VAGW +DKAHK  KAA    I +++RDRPF+RTITM+KDS+G++GF+FK G+IT LVKD SAARNGLL +H + E+NGQNVIGLKD +I+ ++  +P  +T+TIMP F++EHM+K +S  L+K+ MDHS+PEV
Sbjct:    3 LYPSLEDLKVDKVIRAQSQFANATSSTPAITQGAYQPQPATQGMPSSTLYPNLEELGDYMGLSLNSDEVQRNLALVPVATQVAVPSSVGG-------MVRPVTGADMGIRRAEIRPGLREVILCKDQEGKVGLRLRDIDNGVFVQLVQANSPAALAGLRFGDQVLQINGQNVAGWNSDKAHKALKAAAEQRIELIVRDRPFQRTITMHKDSSGHVGFIFKSGRITSLVKDGSAARNGLLTEHYICEINGQNVIGLKDTQIKDILTTSPTAMTITIMPKFIFEHMIKKMSGGLLKSSMDHSVPEV 299          
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Zebrafish
Match: sdcbp2 (syndecan binding protein (syntenin) 2 [Source:ZFIN;Acc:ZDB-GENE-030131-3727])

HSP 1 Score: 291.582 bits (745), Expect = 4.843e-96
Identity = 153/304 (50.33%), Postives = 208/304 (68.42%), Query Frame = 3
Query:   81 LYPTLEDLKVDELKSAQHNFISTVVNEPI-------GQTGSQG---GLLYPALD---DYLGMNMRDAQNQ--------ITQYCGNSVVGSGWRQNAQVVAPVTQHDVGIVRAEIKQGLRRVVLCKDSKGMIGLRVQAVNKGLFVSFVNENSPASMAGLRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNNITVVIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVIDKTPNIVTVTIMPMFVYEHMVKTLSNNLIKNHMDHSIPEV 929
            LYP+LEDLKVD++  AQ  F +   + P         Q  +QG     LYP L+   DY+G+++   + Q         TQ    S VG        +V PVT  D+GI RAEI+ GLR V+LCKD +G +GLR++ ++ G+FV  V  NSPA++AGLRFGDQ+L+IN Q VAGW +DKAHK  KAA    I +++RDRPF+RTITM+KDS+G++GF+FK G+IT LVKD SAARNGLL +H + E+NGQNVIGLKD +I+ ++  +P  +T+TIMP F++EHM+K +S  L+K+ MDHS+PEV
Sbjct:    3 LYPSLEDLKVDKVIRAQSQFANATSSTPAITQGAYQPQPATQGMPSSTLYPNLEELGDYMGLSLNSDEVQRNLALVPVATQVAVPSSVGG-------MVRPVTGADMGIRRAEIRPGLREVILCKDQEGKVGLRLRDIDNGVFVQLVQANSPAALAGLRFGDQVLQINGQNVAGWNSDKAHKALKAAAEQRIELIVRDRPFQRTITMHKDSSGHVGFIFKSGRITSLVKDGSAARNGLLTEHYICEINGQNVIGLKDTQIKDILTTSPTAMTITIMPKFIFEHMIKKMSGGLLKSSMDHSVPEV 299          
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Zebrafish
Match: sdcbp2 (syndecan binding protein (syntenin) 2 [Source:ZFIN;Acc:ZDB-GENE-030131-3727])

HSP 1 Score: 291.582 bits (745), Expect = 4.843e-96
Identity = 153/304 (50.33%), Postives = 208/304 (68.42%), Query Frame = 3
Query:   81 LYPTLEDLKVDELKSAQHNFISTVVNEPI-------GQTGSQG---GLLYPALD---DYLGMNMRDAQNQ--------ITQYCGNSVVGSGWRQNAQVVAPVTQHDVGIVRAEIKQGLRRVVLCKDSKGMIGLRVQAVNKGLFVSFVNENSPASMAGLRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNNITVVIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVIDKTPNIVTVTIMPMFVYEHMVKTLSNNLIKNHMDHSIPEV 929
            LYP+LEDLKVD++  AQ  F +   + P         Q  +QG     LYP L+   DY+G+++   + Q         TQ    S VG        +V PVT  D+GI RAEI+ GLR V+LCKD +G +GLR++ ++ G+FV  V  NSPA++AGLRFGDQ+L+IN Q VAGW +DKAHK  KAA    I +++RDRPF+RTITM+KDS+G++GF+FK G+IT LVKD SAARNGLL +H + E+NGQNVIGLKD +I+ ++  +P  +T+TIMP F++EHM+K +S  L+K+ MDHS+PEV
Sbjct:    3 LYPSLEDLKVDKVIRAQSQFANATSSTPAITQGAYQPQPATQGMPSSTLYPNLEELGDYMGLSLNSDEVQRNLALVPVATQVAVPSSVGG-------MVRPVTGADMGIRRAEIRPGLREVILCKDQEGKVGLRLRDIDNGVFVQLVQANSPAALAGLRFGDQVLQINGQNVAGWNSDKAHKALKAAAEQRIELIVRDRPFQRTITMHKDSSGHVGFIFKSGRITSLVKDGSAARNGLLTEHYICEINGQNVIGLKDTQIKDILTTSPTAMTITIMPKFIFEHMIKKMSGGLLKSSMDHSVPEV 299          
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Zebrafish
Match: sdcbp (syndecan binding protein (syntenin) [Source:ZFIN;Acc:ZDB-GENE-081104-57])

HSP 1 Score: 290.812 bits (743), Expect = 1.219e-95
Identity = 143/309 (46.28%), Postives = 206/309 (66.67%), Query Frame = 3
Query:   81 LYPTLEDLKVDEL-------------------KSAQHNFISTVVNEPIGQTGSQGGLLYPALDDYLGMNMR-DAQNQITQYCGN------SVVGSGWRQNAQVVAPVTQHDVGIVRAEIKQGLRRVVLCKDSKGMIGLRVQAVNKGLFVSFVNENSPASMAGLRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNNITVVIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVIDKTPNIVTVTIMPMFVYEHMVKTLSNNLIKNHMDHSIPEV 929
            LYP+LED+KVD+                     S+  N  ST  +    QTG+    LYP L++++G+N+  DA    +    +      SV  SG    A   AP+T  D+G+ RAEI+QG+R VVLCKD  G IGLR++A++ G+FV  V  N+ A++AGLRFGDQILEIN +  AGW +D AHK  K +    IT+ +RDRP ERT+T++KD NG +GF+F+ G+IT +VKDSS+ARNGLL DH++ E+NGQN+IGLKD +I  +++ +  +VT+T+MP+ ++EHM+K +S++++K+ MDHSIPEV
Sbjct:    3 LYPSLEDMKVDKFIQAHNTPTASPSKALPLPEPSSDQNEPSTYYDSKAEQTGTSS-RLYPELNEFMGLNLSSDALQTFSSSIADQTAGALSVCTSGMSWAA---APITGSDLGVKRAEIRQGVREVVLCKDMDGKIGLRLKAIDNGVFVQLVQANTAAALAGLRFGDQILEINGKSCAGWNSDYAHKVLKNSNPERITLAVRDRPLERTVTLHKDMNGQLGFIFRKGRITSIVKDSSSARNGLLTDHQICEINGQNIIGLKDTQIMDILNSSGGVVTITVMPVVIFEHMMKRMSSSIVKSLMDHSIPEV 307          
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Xenopus
Match: sdcbp (syndecan binding protein [Source:NCBI gene;Acc:448508])

HSP 1 Score: 319.316 bits (817), Expect = 7.281e-107
Identity = 155/297 (52.19%), Postives = 219/297 (73.74%), Query Frame = 3
Query:   81 LYPTLEDLKVDELKSAQHNFISTVVNEPIGQTGSQ-----GGL---LYPALDDYLGMNMRDAQNQITQYCGNSVVGSGWRQNA------QVVAPVTQHDVGIVRAEIKQGLRRVVLCKDSKGMIGLRVQAVNKGLFVSFVNENSPASMAGLRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNNITVVIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVIDKTPNIVTVTIMPMFVYEHMVKTLSNNLIKNHMDHSIPEV 929
            LYP+LEDLKVD++  AQ  F +  VN  I    S      GG+   LYP L+ Y+G+++  ++++I +    S+V SG  Q A       +VAPV+ +DVGI RAEIKQG+R  +LCKD  G IGLR+++++ G+FV  V  NSPAS+AGL+FGDQIL+IN +  AGW++DK+HK  K      I++++RDRPFERTITM+KDS G++GF+FK+GKIT +VKDSSAARNGLL DH L E+NGQNVIGLKD ++ +++  + N+VT+T+MP +++EHMVK ++++++KN MDHS+PEV
Sbjct:    3 LYPSLEDLKVDKVIQAQTTFSANPVNPAILPAASASAPQYGGMYPKLYPELEQYMGLSL--SEDEIHKNM--SLVPSGGNQVAIPTALNNMVAPVSGNDVGIRRAEIKQGIREAILCKDQDGKIGLRLKSIDNGIFVQLVQTNSPASLAGLKFGDQILQINGENCAGWSSDKSHKILKQVSGERISMIVRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTDHNLCEINGQNVIGLKDSQVAELLATSANVVTLTVMPSYIFEHMVKRMASSVLKNLMDHSVPEV 295          
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Xenopus
Match: sdcbp (syndecan binding protein [Source:NCBI gene;Acc:448508])

HSP 1 Score: 303.138 bits (775), Expect = 1.550e-100
Identity = 152/300 (50.67%), Postives = 216/300 (72.00%), Query Frame = 3
Query:   75 SRLYPTLEDLKVD-ELKSAQHNFISTVVNEPIGQTGSQ-----GGL---LYPALDDYLGMNMRDAQNQITQYCGNSVVGSGWRQNA------QVVAPVTQHDVGIVRAEIKQGLRRVVLCKDSKGMIGLRVQAVNKGLFVSFVNENSPASMAGLRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNNITVVIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVIDKTPNIVTVTIMPMFVYEHMVKTLSNNLIKNHMDHSIPEV 929
            S +Y +L DL    E K+AQ  F +  VN  I    S      GG+   LYP L+ Y+G+++  ++++I +    S+V SG  Q A       +VAPV+ +DVGI RAEIKQG+R  +LCKD  G IGLR+++++ G+FV  V  NSPAS+AGL+FGDQIL+IN +  AGW++DK+HK  K      I++++RDRPFERTITM+KDS G++GF+FK+GKIT +VKDSSAARNGLL DH L E+NGQNVIGLKD ++ +++  + N+VT+T+MP +++EHMVK ++++++KN MDHS+PEV
Sbjct:    1 SFIYLSLIDLLYSLEQKAAQTTFSANPVNPAILPAASASAPQYGGMYPKLYPELEQYMGLSL--SEDEIHKNM--SLVPSGGNQVAIPTALNNMVAPVSGNDVGIRRAEIKQGIREAILCKDQDGKIGLRLKSIDNGIFVQLVQTNSPASLAGLKFGDQILQINGENCAGWSSDKSHKILKQVSGERISMIVRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTDHNLCEINGQNVIGLKDSQVAELLATSANVVTLTVMPSYIFEHMVKRMASSVLKNLMDHSVPEV 296          
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Xenopus
Match: APBA3 (amyloid beta (A4) precursor protein-binding, family A, member 3 [Source:NCBI gene;Acc:100495034])

HSP 1 Score: 60.077 bits (144), Expect = 2.577e-9
Identity = 46/172 (26.74%), Postives = 75/172 (43.60%), Query Frame = 3
Query:  372 RRVVLCKDSKGMIGLRVQAVNKG-----LFVSFVNENSPASMAG-LRFGDQILEINSQVVAGWTTDKAHKFFK--AAGSNNITVVIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLK-DKEIQKVIDKTPNIVTVTIMPMFVY 860
            R V + K    M+G+ V     G     + ++ +    PA  +G L  GD +  +N   + G          +     S  I  ++R  P    I      +  +GF  +DG I  LV+   A R G+ + H++IE+NGQ+V+    +K IQ ++D T   V +  MP   Y
Sbjct:  189 REVYIQKQRGEMLGIAVVESGWGSLLPTVVIANLMHGGPAERSGDLSIGDHVTSVNGTSLVGLPFSTCQGLIRDLKGQSEVILSIVRCPPVITAIIQRPSVSHQLGFCVEDGVICSLVRGGIAERGGIRVGHRIIEINGQSVVATAHEKIIQTLMDATGE-VHIKTMPASTY 359          
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Xenopus
Match: APBA3 (amyloid beta (A4) precursor protein-binding, family A, member 3 [Source:NCBI gene;Acc:100495034])

HSP 1 Score: 60.077 bits (144), Expect = 3.608e-9
Identity = 46/173 (26.59%), Postives = 75/173 (43.35%), Query Frame = 3
Query:  369 LRRVVLCKDSKGMIGLRVQAVNKG-----LFVSFVNENSPASMAG-LRFGDQILEINSQVVAGWTTDKAHKFFK--AAGSNNITVVIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLK-DKEIQKVIDKTPNIVTVTIMPMFVY 860
             R V + K    M+G+ V     G     + ++ +    PA  +G L  GD +  +N   + G          +     S  I  ++R  P    I      +  +GF  +DG I  LV+   A R G+ + H++IE+NGQ+V+    +K IQ ++D T   V +  MP   Y
Sbjct:  307 CREVYIQKQRGEMLGIAVVESGWGSLLPTVVIANLMHGGPAERSGDLSIGDHVTSVNGTSLVGLPFSTCQGLIRDLKGQSEVILSIVRCPPVITAIIQRPSVSHQLGFCVEDGVICSLVRGGIAERGGIRVGHRIIEINGQSVVATAHEKIIQTLMDAT-GEVHIKTMPASTY 478          
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Xenopus
Match: APBA3 (amyloid beta (A4) precursor protein-binding, family A, member 3 [Source:NCBI gene;Acc:100495034])

HSP 1 Score: 59.6918 bits (143), Expect = 3.748e-9
Identity = 46/173 (26.59%), Postives = 75/173 (43.35%), Query Frame = 3
Query:  369 LRRVVLCKDSKGMIGLRVQAVNKG-----LFVSFVNENSPASMAG-LRFGDQILEINSQVVAGWTTDKAHKFFK--AAGSNNITVVIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLK-DKEIQKVIDKTPNIVTVTIMPMFVY 860
             R V + K    M+G+ V     G     + ++ +    PA  +G L  GD +  +N   + G          +     S  I  ++R  P    I      +  +GF  +DG I  LV+   A R G+ + H++IE+NGQ+V+    +K IQ ++D T   V +  MP   Y
Sbjct:  211 CREVYIQKQRGEMLGIAVVESGWGSLLPTVVIANLMHGGPAERSGDLSIGDHVTSVNGTSLVGLPFSTCQGLIRDLKGQSEVILSIVRCPPVITAIIQRPSVSHQLGFCVEDGVICSLVRGGIAERGGIRVGHRIIEINGQSVVATAHEKIIQTLMDATGE-VHIKTMPASTY 382          
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Mouse
Match: Sdcbp (syndecan binding protein [Source:MGI Symbol;Acc:MGI:1337026])

HSP 1 Score: 307.375 bits (786), Expect = 2.722e-102
Identity = 147/296 (49.66%), Postives = 206/296 (69.59%), Query Frame = 3
Query:   81 LYPTLEDLKVDELKSAQHNFISTVVNEPIGQTGSQGGL---------LYPALDDYLGMNMRDAQ--NQITQYCGNSVVGSGWRQNA--QVVAPVTQHDVGIVRAEIKQGLRRVVLCKDSKGMIGLRVQAVNKGLFVSFVNENSPASMAGLRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNNITVVIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVIDKTPNIVTVTIMPMFVYEHMVKTLSNNLIKNHMDHSIPEV 929
            LYP+LEDLKVD++  AQ  + +   ++      +   L         LYP L  Y+G+++ +A+    +    G    G   R ++   +VAPVT +D GI RAEIKQG+R V+LCKD  G IGLR+++++ G+FV  V  NSPAS+ GLRFGDQ+L+IN +  AGW++DKAHK  K A    IT+ IRDRPFERT+TM+KDS+G++GF+FK GKIT +VKDSSAARNGLL DH + E+NGQNVIGLKD +I  ++     +VT+TIMP F++EH++K ++ +++K+ MDH+IPEV
Sbjct:    3 LYPSLEDLKVDKVIQAQTAYSANPASQAFVLVDASAALPPDGNLYPKLYPELSQYMGLSLNEAEICESMPMVSGAPAQGLVARPSSVNYMVAPVTGNDAGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTVTMHKDSSGHVGFIFKSGKITSIVKDSSAARNGLLTDHHICEINGQNVIGLKDAQIADILSTAGTVVTITIMPTFIFEHIIKRMAPSIMKSLMDHTIPEV 298          
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Mouse
Match: Sdcbp (syndecan binding protein [Source:MGI Symbol;Acc:MGI:1337026])

HSP 1 Score: 307.375 bits (786), Expect = 3.856e-102
Identity = 148/302 (49.01%), Postives = 206/302 (68.21%), Query Frame = 3
Query:   81 LYPTLEDLKVDELKSAQHNFISTVVNEPIGQTGSQGGL---------LYPALDDYLGMNMRDAQNQITQYCGNSVVGSGWRQNAQVVA----------PVTQHDVGIVRAEIKQGLRRVVLCKDSKGMIGLRVQAVNKGLFVSFVNENSPASMAGLRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNNITVVIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVIDKTPNIVTVTIMPMFVYEHMVKTLSNNLIKNHMDHSIPEV 929
            LYP+LEDLKVD++  AQ  + +   ++      +   L         LYP L  Y+G+++ +A+      C +  + SG     Q+VA          PVT +D GI RAEIKQG+R V+LCKD  G IGLR+++++ G+FV  V  NSPAS+ GLRFGDQ+L+IN +  AGW++DKAHK  K A    IT+ IRDRPFERT+TM+KDS+G++GF+FK GKIT +VKDSSAARNGLL DH + E+NGQNVIGLKD +I  ++     +VT+TIMP F++EH++K ++ +++K+ MDH+IPEV
Sbjct:    3 LYPSLEDLKVDKVIQAQTAYSANPASQAFVLVDASAALPPDGNLYPKLYPELSQYMGLSLNEAE-----ICESMPMVSGAPAQGQLVARPSSVNYMVAPVTGNDAGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTVTMHKDSSGHVGFIFKSGKITSIVKDSSAARNGLLTDHHICEINGQNVIGLKDAQIADILSTAGTVVTITIMPTFIFEHIIKRMAPSIMKSLMDHTIPEV 299          
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Mouse
Match: Sdcbp2 (syndecan binding protein (syntenin) 2 [Source:MGI Symbol;Acc:MGI:2385156])

HSP 1 Score: 285.419 bits (729), Expect = 9.979e-94
Identity = 149/293 (50.85%), Postives = 201/293 (68.60%), Query Frame = 3
Query:   72 MSRLYPTLEDLKVDELKSAQHNFISTVVNEPIGQTGSQG-GLLYP---ALDDYLGMNM--RDAQNQITQY--CGNSVVGSGWRQNAQVVAPVTQHDVGIVRAEIKQGLRRVVLCKDSKGMIGLRVQAVNKGLFVSFVNENSPASMAGLRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNNITVVIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVIDKTPNIVTVTIMPMFVYEHMVKTLSNNLIKNHMDHSIPE 926
            MS LYP+LEDLKV ++  AQ     T+   P     +     LYP    L+ Y+G+++  ++ Q  +TQ     N VV S      QVVAPV+ +++GI+RAEIK G+R + LCKD +G  GLR+QAV+KGLFV  V  N+PAS+ GLRFGDQIL+I+    AGW T KAHK  K A +  I +VIRDRPF+RT+TM+KDS+G +GF  K GKI  +VK SSAARNGLL +H + EVNGQNVIGLKDK++ +++    +++T+TI+P  +YEHM+K LS  L+ + MDHSIP+
Sbjct:    1 MSVLYPSLEDLKVGQVIQAQGRASPTMPTLPAPMASAPPLSELYPNLAELESYMGLSLSSQEVQKNLTQIPDSDNMVVTSPG--PGQVVAPVSGNNLGILRAEIKPGVREIHLCKDERGKTGLRLQAVDKGLFVQLVQANTPASLVGLRFGDQILQIDGCDCAGWNTHKAHKVLKKASAEKIVMVIRDRPFQRTVTMHKDSSGQVGFSIKKGKIVSVVKGSSAARNGLLTNHYVCEVNGQNVIGLKDKKVTEILTTAGDVITLTIIPTVIYEHMIKRLSPLLLHHTMDHSIPD 291          
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Mouse
Match: Sdcbp (syndecan binding protein [Source:MGI Symbol;Acc:MGI:1337026])

HSP 1 Score: 251.521 bits (641), Expect = 3.847e-81
Identity = 126/252 (50.00%), Postives = 168/252 (66.67%), Query Frame = 3
Query:   81 LYPTLEDLKVDELKSAQHNFISTVVNEPIGQTGSQGGL---------LYPALDDYLGMNMRDAQNQITQYCGNSVVGSGWRQNAQVVA----------PVTQHDVGIVRAEIKQGLRRVVLCKDSKGMIGLRVQAVNKGLFVSFVNENSPASMAGLRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNNITVVIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIG 779
            LYP+LEDLKVD++  AQ  + +   ++      +   L         LYP L  Y+G+++ +A+      C +  + SG     Q+VA          PVT +D GI RAEIKQG+R V+LCKD  G IGLR+++++ G+FV  V  NSPAS+ GLRFGDQ+L+IN +  AGW++DKAHK  K A    IT+ IRDRPFERT+TM+KDS+G++GF+FK GKIT +VKDSSAARNGLL DH + E+NGQNVIG
Sbjct:    3 LYPSLEDLKVDKVIQAQTAYSANPASQAFVLVDASAALPPDGNLYPKLYPELSQYMGLSLNEAE-----ICESMPMVSGAPAQGQLVARPSSVNYMVAPVTGNDAGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTVTMHKDSSGHVGFIFKSGKITSIVKDSSAARNGLLTDHHICEINGQNVIG 249          
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Mouse
Match: Sdcbp (syndecan binding protein [Source:MGI Symbol;Acc:MGI:1337026])

HSP 1 Score: 188.734 bits (478), Expect = 2.264e-57
Identity = 95/207 (45.89%), Postives = 134/207 (64.73%), Query Frame = 3
Query:   81 LYPTLEDLKVDELKSAQHNFISTVVNEPIGQTGSQGGL---------LYPALDDYLGMNMRDAQ--NQITQYCGNSVVGSGWRQNA--QVVAPVTQHDVGIVRAEIKQGLRRVVLCKDSKGMIGLRVQAVNKGLFVSFVNENSPASMAGLRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNNITVVIRDRPFERTITMNKDSNGYI 662
            LYP+LEDLKVD++  AQ  + +   ++      +   L         LYP L  Y+G+++ +A+    +    G    G   R ++   +VAPVT +D GI RAEIKQG+R V+LCKD  G IGLR+++++ G+FV  V  NSPAS+ GLRFGDQ+L+IN +  AGW++DKAHK  K A    IT+ IRDRPFERT+TM+KDS+G++
Sbjct:    3 LYPSLEDLKVDKVIQAQTAYSANPASQAFVLVDASAALPPDGNLYPKLYPELSQYMGLSLNEAEICESMPMVSGAPAQGLVARPSSVNYMVAPVTGNDAGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTVTMHKDSSGHV 209          
BLAST of Syndecan binding protein (Syntenin) vs. UniProt/SwissProt
Match: sp|O00560|SDCB1_HUMAN (Syntenin-1 OS=Homo sapiens OX=9606 GN=SDCBP PE=1 SV=1)

HSP 1 Score: 310.842 bits (795), Expect = 1.005e-102
Identity = 153/301 (50.83%), Postives = 208/301 (69.10%), Query Frame = 3
Query:   81 LYPTLEDLKVDELKSAQHNFISTVVNE--------PIGQTGSQGGLLYPALDDYLGMNMRDAQNQITQYCGNSVVGSGWRQNAQVVA----------PVTQHDVGIVRAEIKQGLRRVVLCKDSKGMIGLRVQAVNKGLFVSFVNENSPASMAGLRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNNITVVIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVIDKTPNIVTVTIMPMFVYEHMVKTLSNNLIKNHMDHSIPEV 929
            LYP+LEDLKVD++  AQ  F +   N         PI   G+    LYP L  Y+G+++ + + +      N  V SG     Q+VA          PVT +DVGI RAEIKQG+R V+LCKD  G IGLR+++++ G+FV  V  NSPAS+ GLRFGDQ+L+IN +  AGW++DKAHK  K A    IT+ IRDRPFERTITM+KDS G++GF+FK+GKIT +VKDSSAARNGLL +H + E+NGQNVIGLKD +I  ++  +  +VT+TIMP F++EH++K ++ +++K+ MDH+IPEV
Sbjct:    3 LYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIR-----ANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV 298          
BLAST of Syndecan binding protein (Syntenin) vs. UniProt/SwissProt
Match: sp|Q9JI92|SDCB1_RAT (Syntenin-1 OS=Rattus norvegicus OX=10116 GN=Sdcbp PE=1 SV=1)

HSP 1 Score: 309.686 bits (792), Expect = 2.981e-102
Identity = 153/303 (50.50%), Postives = 207/303 (68.32%), Query Frame = 3
Query:   81 LYPTLEDLKVDELKSAQHN----------FISTVVNEPIGQTGSQGGLLYPALDDYLGMNMRDAQNQITQYCGNSVVGSGWRQNAQVVA----------PVTQHDVGIVRAEIKQGLRRVVLCKDSKGMIGLRVQAVNKGLFVSFVNENSPASMAGLRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNNITVVIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVIDKTPNIVTVTIMPMFVYEHMVKTLSNNLIKNHMDHSIPEV 929
            LYP+LEDLKVD++  AQ            F++ V +      G+    LYP L  Y+G+++ +A+      C N  V SG     Q+VA          PVT +D GI RAEIKQG+R V+LCKD  G IGLR+++V+ G+FV  V  NSPAS+ GLRFGDQ+L+IN +  AGW++DKAHK  K A    IT+ IRDRPFERT+TM+KDS+G++GF+FK GKIT +VKDSSAARNGLL DH + E+NGQNVIGLKD +I  ++     +VT+TIMP F++EH++K ++ +++K+ MDH+IPEV
Sbjct:    3 LYPSLEDLKVDKVIQAQTASSANPASQAFFLNVVDSAAFPPGGNLYPKLYPELSQYMGLSLSEAE-----ICENMPVVSGAPTQGQLVARPSSVNYMVAPVTGNDAGIRRAEIKQGIREVILCKDQDGKIGLRLKSVDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTVTMHKDSSGHVGFIFKSGKITSIVKDSSAARNGLLTDHHICEINGQNVIGLKDAQIADILSTAGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV 300          
BLAST of Syndecan binding protein (Syntenin) vs. UniProt/SwissProt
Match: sp|O08992|SDCB1_MOUSE (Syntenin-1 OS=Mus musculus OX=10090 GN=Sdcbp PE=1 SV=1)

HSP 1 Score: 307.375 bits (786), Expect = 2.697e-101
Identity = 148/302 (49.01%), Postives = 206/302 (68.21%), Query Frame = 3
Query:   81 LYPTLEDLKVDELKSAQHNFISTVVNEPIGQTGSQGGL---------LYPALDDYLGMNMRDAQNQITQYCGNSVVGSGWRQNAQVVA----------PVTQHDVGIVRAEIKQGLRRVVLCKDSKGMIGLRVQAVNKGLFVSFVNENSPASMAGLRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNNITVVIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVIDKTPNIVTVTIMPMFVYEHMVKTLSNNLIKNHMDHSIPEV 929
            LYP+LEDLKVD++  AQ  + +   ++      +   L         LYP L  Y+G+++ +A+      C +  + SG     Q+VA          PVT +D GI RAEIKQG+R V+LCKD  G IGLR+++++ G+FV  V  NSPAS+ GLRFGDQ+L+IN +  AGW++DKAHK  K A    IT+ IRDRPFERT+TM+KDS+G++GF+FK GKIT +VKDSSAARNGLL DH + E+NGQNVIGLKD +I  ++     +VT+TIMP F++EH++K ++ +++K+ MDH+IPEV
Sbjct:    3 LYPSLEDLKVDKVIQAQTAYSANPASQAFVLVDASAALPPDGNLYPKLYPELSQYMGLSLNEAE-----ICESMPMVSGAPAQGQLVARPSSVNYMVAPVTGNDAGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTVTMHKDSSGHVGFIFKSGKITSIVKDSSAARNGLLTDHHICEINGQNVIGLKDAQIADILSTAGTVVTITIMPTFIFEHIIKRMAPSIMKSLMDHTIPEV 299          
BLAST of Syndecan binding protein (Syntenin) vs. UniProt/SwissProt
Match: sp|Q9H190|SDCB2_HUMAN (Syntenin-2 OS=Homo sapiens OX=9606 GN=SDCBP2 PE=1 SV=2)

HSP 1 Score: 285.804 bits (730), Expect = 4.625e-93
Identity = 146/294 (49.66%), Postives = 203/294 (69.05%), Query Frame = 3
Query:   72 MSRLYPTLEDLKVDELKSAQHNFISTVVNEPIGQTG-SQGGLLYP---ALDDYLGMNM-----RDAQNQITQYCGNSVVGSGWRQNAQVVAPVTQHDVGIVRAEIKQGLRRVVLCKDSKGMIGLRVQAVNKGLFVSFVNENSPASMAGLRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNNITVVIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVIDKTPNIVTVTIMPMFVYEHMVKTLSNNLIKNHMDHSIPE 926
            MS LYP+LEDLKVD+   AQ      +   P+  T  S   +LYP    L++Y+G+++     +++  QI +    +V G G     Q+VAPVT + +G+ RAEIK G+R + LCKD +G  GLR++ V++GLFV  V  N+PAS+ GLRFGDQ+L+I+ +  AGW++ KAH+  K A  + I VV+RDRPF+RT+TM+KDS G++GFV K GKI  LVK SSAARNGLL +H + EV+GQNVIGLKDK+I +++    N+VT+TI+P  +YEHMVK L   L+ + MDHSIP+
Sbjct:    1 MSSLYPSLEDLKVDQAIQAQVRASPKMPALPVQATAISPPPVLYPNLAELENYMGLSLSSQEVQESLLQIPEGDSTAVSGPG---PGQMVAPVTGYSLGVRRAEIKPGVREIHLCKDERGKTGLRLRKVDQGLFVQLVQANTPASLVGLRFGDQLLQIDGRDCAGWSSHKAHQVVKKASGDKIVVVVRDRPFQRTVTMHKDSMGHVGFVIKKGKIVSLVKGSSAARNGLLTNHYVCEVDGQNVIGLKDKKIMEILATAGNVVTLTIIPSVIYEHMVKKLPPVLLHHTMDHSIPD 291          
BLAST of Syndecan binding protein (Syntenin) vs. UniProt/SwissProt
Match: sp|Q99JZ0|SDCB2_MOUSE (Syntenin-2 OS=Mus musculus OX=10090 GN=Sdcbp2 PE=2 SV=1)

HSP 1 Score: 285.419 bits (729), Expect = 6.981e-93
Identity = 149/293 (50.85%), Postives = 201/293 (68.60%), Query Frame = 3
Query:   72 MSRLYPTLEDLKVDELKSAQHNFISTVVNEPIGQTGSQG-GLLYP---ALDDYLGMNM--RDAQNQITQY--CGNSVVGSGWRQNAQVVAPVTQHDVGIVRAEIKQGLRRVVLCKDSKGMIGLRVQAVNKGLFVSFVNENSPASMAGLRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNNITVVIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVIDKTPNIVTVTIMPMFVYEHMVKTLSNNLIKNHMDHSIPE 926
            MS LYP+LEDLKV ++  AQ     T+   P     +     LYP    L+ Y+G+++  ++ Q  +TQ     N VV S      QVVAPV+ +++GI+RAEIK G+R + LCKD +G  GLR+QAV+KGLFV  V  N+PAS+ GLRFGDQIL+I+    AGW T KAHK  K A +  I +VIRDRPF+RT+TM+KDS+G +GF  K GKI  +VK SSAARNGLL +H + EVNGQNVIGLKDK++ +++    +++T+TI+P  +YEHM+K LS  L+ + MDHSIP+
Sbjct:    1 MSVLYPSLEDLKVGQVIQAQGRASPTMPTLPAPMASAPPLSELYPNLAELESYMGLSLSSQEVQKNLTQIPDSDNMVVTSPG--PGQVVAPVSGNNLGILRAEIKPGVREIHLCKDERGKTGLRLQAVDKGLFVQLVQANTPASLVGLRFGDQILQIDGCDCAGWNTHKAHKVLKKASAEKIVMVIRDRPFQRTVTMHKDSSGQVGFSIKKGKIVSVVKGSSAARNGLLTNHYVCEVNGQNVIGLKDKKVTEILTTAGDVITLTIIPTVIYEHMIKRLSPLLLHHTMDHSIPD 291          
BLAST of Syndecan binding protein (Syntenin) vs. TrEMBL
Match: R7V3S3 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_176202 PE=4 SV=1)

HSP 1 Score: 324.709 bits (831), Expect = 1.448e-105
Identity = 160/302 (52.98%), Postives = 223/302 (73.84%), Query Frame = 3
Query:   81 LYPTLEDLKVDELKSAQ-------HNFISTVVNEPIGQTGSQG--------GLLYPALDDYLGMNMRD-AQNQITQYCGNSVV---GSGWRQNAQVVAPVTQHDVGIVRAEIKQGLRRVVLCKDSKGMIGLRVQAVNKGLFVSFVNENSPASMAGLRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNNITVVIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVIDKTPNIVTVTIMPMFVYEHMVKTLSNNLIKNHMDHSIPEV 929
            LYP+LED+KVD++  AQ        + +S++      + G+            LYP+L++Y+G+++ + + NQ+     N V     S    +A VVAP+T + VG+ RAEIKQG+R + LCKD+KG+IG+RV+++NKGLFV+FV+++SPA+MAGLRFGDQIL+I+   VAGW TDKAHK FK A +NNI + +RDRPFERTITM KDS G +GFVFKD KIT +VKDSSAARNG+LIDH L+EVNGQNV+GLK+KEI+ +++     VT+T++P F+YEH+VK++ ++LI+  MDHSIPE+
Sbjct:    3 LYPSLEDMKVDQMAQAQANVAAAARSTVSSIAYPEHTEGGASAPPVNMAAVSALYPSLNEYMGLDLNEGSNNQVAVPQPNQVAQPQSSSAYPSAGVVAPITGNCVGVRRAEIKQGIRELTLCKDTKGVIGMRVKSINKGLFVAFVHKDSPAAMAGLRFGDQILQIDGDTVAGWDTDKAHKVFKNAPANNIKLAVRDRPFERTITMQKDSAGCVGFVFKDNKITSIVKDSSAARNGVLIDHHLVEVNGQNVVGLKEKEIRAIVEACGRTVTITVIPSFLYEHIVKSMGDSLIRKKMDHSIPEI 304          
BLAST of Syndecan binding protein (Syntenin) vs. TrEMBL
Match: A0A3S0ZKF4 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_011284 PE=4 SV=1)

HSP 1 Score: 323.168 bits (827), Expect = 4.474e-105
Identity = 157/300 (52.33%), Postives = 206/300 (68.67%), Query Frame = 3
Query:   81 LYPTLEDLKVDELKSAQHNFISTVVNE--------------PIGQTGSQGGLLYPALDDYLGMNMRDAQNQITQYCGNSVVGSGWRQNAQ---VVAPVTQHDVGIVRAEIKQGLRRVVLCKDSKGMIGLRVQAVNKGLFVSFVNENSPASMAGLRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNNITVVIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVIDKTPNIVTVTIMPMFVYEHMVKTLSNNLIKNHMDHSIPEV 929
            LYPTLED++VD+L++AQ N    + NE              P+  + +  G LYP+L +Y+G+ +     Q  Q   +  +  G RQ       VAP+T +++G+ RAEIKQG+R VVLCK+ +G +GLR++ VN GLFV+FV    PA+MAGLRFGDQIL+IN Q VAGW   KAHKF + A    I + +RDRPFERT+TM KDSNGYIGFVFK+G+I  LVKDSSAARNGLL DH+LIE+ GQN +GLKDKEI  +ID     VTVT+MP  +Y+H+VK +  +L+K  MDHSIP++
Sbjct:    3 LYPTLEDMRVDQLQTAQANHERAITNENPPLQYPHGPGAQPPMYTSNAGAGGLYPSLPEYMGLQITPQMMQSMQVVPSQGMQVGIRQTQSGQNQVAPITGNNIGLARAEIKQGIREVVLCKNQEGKVGLRIRHVNNGLFVAFVQAGLPAAMAGLRFGDQILQINGQTVAGWDNSKAHKFLEKADGGRIEMAVRDRPFERTVTMQKDSNGYIGFVFKEGRIKSLVKDSSAARNGLLTDHQLIEIGGQNCVGLKDKEIGDIIDSCGRTVTVTVMPCVIYDHIVKCMGTSLVKKLMDHSIPDL 302          
BLAST of Syndecan binding protein (Syntenin) vs. TrEMBL
Match: A0A1L8FT58 (Uncharacterized protein OS=Xenopus laevis OX=8355 GN=XELAEV_18033740mg PE=4 SV=1)

HSP 1 Score: 322.013 bits (824), Expect = 1.036e-104
Identity = 154/295 (52.20%), Postives = 214/295 (72.54%), Query Frame = 3
Query:   81 LYPTLEDLKVDELKSAQHNFISTVVNEPI-----GQTGSQGGL---LYPALDDYLGMNMRDAQ----NQITQYCGNSVVGSGWRQNAQVVAPVTQHDVGIVRAEIKQGLRRVVLCKDSKGMIGLRVQAVNKGLFVSFVNENSPASMAGLRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNNITVVIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVIDKTPNIVTVTIMPMFVYEHMVKTLSNNLIKNHMDHSIPEV 929
            LYP+LEDLKVD++  AQ NF +  VN  I       T   GG+   LYP L+ Y+G+++ + +      +    GN V       N  +VAPV+  DVGI RAEIKQG+R V+LCKD  G IGLR+++++ G+FV  V  NSPAS+AGL+FGDQIL+IN +  AGW++DK+HK  K      I++V+RDRPFERTITM+KDS G++GF+FK+GKIT +VKDSSAARNGLL DH L E+NGQNVIGLKD ++ +++  + N+VT+T+MP F+++HMVK ++++++K+ MDHS+PEV
Sbjct:    3 LYPSLEDLKVDKVIQAQTNFSANPVNPAILPSASASTAQYGGMYPKLYPELEQYMGLSLSEDEIHRNMSVVPSAGNQVAVPTALNN--MVAPVSGSDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQVNSPASLAGLKFGDQILQINGENCAGWSSDKSHKMLKQVSGERISMVVRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTDHNLCEINGQNVIGLKDSQVAEILATSANVVTLTVMPSFIFDHMVKRMASSVLKSLMDHSVPEV 295          
BLAST of Syndecan binding protein (Syntenin) vs. TrEMBL
Match: A0A2C9JKC3 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106057671 PE=4 SV=1)

HSP 1 Score: 321.627 bits (823), Expect = 2.439e-104
Identity = 157/304 (51.64%), Postives = 207/304 (68.09%), Query Frame = 3
Query:   72 MSRLYPTLEDLKVDELKSAQHNFISTVVNEPIGQ-----------------TGSQGGLLYPALDDYLGMNMRDAQNQITQYCGNSVVGSGWRQNAQV-VAPVTQHDVGIVRAEIKQGLRRVVLCKDSKGMIGLRVQAVNKGLFVSFVNENSPASMAGLRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNNITVVIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVIDKTPNIVTVTIMPMFVYEHMVKTLSNNLIKNHMDHSIPEV 929
            MSRLYPTLED++VD+L++AQ N     +  P  Q                     G LLYP+L +Y+G+       Q+    G  V G    Q+ Q  +AP+T +++ + R+EIK G+R VVLCKD +G +GLR++ VN GLFV+ V   SPA++AGLRFGDQIL+IN + VAGW  DKAH F K      I + +RDRPFERTITM KDSNGY+GFVFKDG+I  LVK+SSAARNG+L DH+LIEV GQNV+GLKDKEI ++ID     +T+T+MP FVY+H+VK + N+++K  MDHSIP++
Sbjct:    1 MSRLYPTLEDMRVDQLQTAQINHERQAIGAPQAQYPNVPPQGQYPPAPLQYPQQTGQLLYPSLTEYMGLEFTPEMMQVVASQGLQV-GVRQTQSGQTQIAPITGNNLALARSEIKSGIREVVLCKDGEGKLGLRIRHVNNGLFVALVQAGSPAALAGLRFGDQILQINGKTVAGWDNDKAHNFLKKVDGARIDMAVRDRPFERTITMQKDSNGYVGFVFKDGRIKSLVKESSAARNGVLTDHQLIEVGGQNVVGLKDKEISEIIDSCGRTLTITVMPCFVYDHIVKCMGNSIVKKLMDHSIPDL 303          
BLAST of Syndecan binding protein (Syntenin) vs. TrEMBL
Match: Q6DFR3 (Syndecan binding protein (Syntenin) OS=Xenopus tropicalis OX=8364 GN=sdcbp PE=2 SV=1)

HSP 1 Score: 319.316 bits (817), Expect = 1.143e-103
Identity = 155/297 (52.19%), Postives = 219/297 (73.74%), Query Frame = 3
Query:   81 LYPTLEDLKVDELKSAQHNFISTVVNEPIGQTGSQ-----GGL---LYPALDDYLGMNMRDAQNQITQYCGNSVVGSGWRQNA------QVVAPVTQHDVGIVRAEIKQGLRRVVLCKDSKGMIGLRVQAVNKGLFVSFVNENSPASMAGLRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNNITVVIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVIDKTPNIVTVTIMPMFVYEHMVKTLSNNLIKNHMDHSIPEV 929
            LYP+LEDLKVD++  AQ  F +  VN  I    S      GG+   LYP L+ Y+G+++  ++++I +    S+V SG  Q A       +VAPV+ +DVGI RAEIKQG+R  +LCKD  G IGLR+++++ G+FV  V  NSPAS+AGL+FGDQIL+IN +  AGW++DK+HK  K      I++++RDRPFERTITM+KDS G++GF+FK+GKIT +VKDSSAARNGLL DH L E+NGQNVIGLKD ++ +++  + N+VT+T+MP +++EHMVK ++++++KN MDHS+PEV
Sbjct:    3 LYPSLEDLKVDKVIQAQTTFSANPVNPAILPAASASAPQYGGMYPKLYPELEQYMGLSL--SEDEIHKNM--SLVPSGGNQVAIPTALNNMVAPVSGNDVGIRRAEIKQGIREAILCKDQDGKIGLRLKSIDNGIFVQLVQTNSPASLAGLKFGDQILQINGENCAGWSSDKSHKILKQVSGERISMIVRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTDHNLCEINGQNVIGLKDSQVAELLATSANVVTLTVMPSYIFEHMVKRMASSVLKNLMDHSVPEV 295          
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Cavefish
Match: sdcbp2 (syntenin-1-like [Source:NCBI gene;Acc:103039708])

HSP 1 Score: 290.426 bits (742), Expect = 1.212e-95
Identity = 153/306 (50.00%), Postives = 204/306 (66.67%), Query Frame = 3
Query:   81 LYPTLEDLKVDELKSAQHNFISTVVNEPIGQTGS--------QGGLLYPALD---DYLGMNMRD------------AQNQITQYCGNSVVGSGWRQNAQVVAPVTQHDVGIVRAEIKQGLRRVVLCKDSKGMIGLRVQAVNKGLFVSFVNENSPASMAGLRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNNITVVIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVIDKTPNIVTVTIMPMFVYEHMVKTLSNNLIKNHMDHSIPEV 929
            LYP+LEDLKVD++  AQ  F  +    P    G+            LYP L+   DY+G+ +              A NQ+    G   VG        +V PVT  DVGI RAEI+QGLR V+LCKD    +GLR++ V+ G+F+  V  NSPA++AGLRFGDQ+L+IN Q  AGW+TDKAHK  KAA    I +V+RDRPF+RTITM+KDS+G++GF++K G+IT LVKD SAARNGLL DH + E+NGQNVIGLKD +I+ +++ +P  +T+TIMP  +YEHM+K +S+ L+K+ MDHS+PEV
Sbjct:    3 LYPSLEDLKVDKVMRAQSQFAQSTSTPPAITEGAYQPAALTMPSSSLYPNLEELGDYMGLRLNSDEVQRNLALVPAADNQVAMPSG---VGG-------MVRPVTGADVGIRRAEIRQGLREVILCKDQDRKVGLRLRDVDNGVFIQLVQANSPAALAGLRFGDQVLQINGQNCAGWSTDKAHKALKAAAEQRIELVVRDRPFQRTITMHKDSSGHVGFIYKSGRITSLVKDGSAARNGLLTDHYICEINGQNVIGLKDSQIKDILNTSPTAMTITIMPKIIYEHMIKRMSSGLLKSAMDHSVPEV 298          
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Cavefish
Match: sdcbp (syndecan binding protein (syntenin) [Source:ZFIN;Acc:ZDB-GENE-081104-57])

HSP 1 Score: 244.588 bits (623), Expect = 3.822e-78
Identity = 135/272 (49.63%), Postives = 186/272 (68.38%), Query Frame = 3
Query:   81 LYPTLEDLKVDELKSAQHNFISTVVNEPIGQTGSQGGLLYPALDDYLGMNMR-DAQNQIT-----QYCGN-SVVGSGWRQNAQVVAPVTQHDVGIVRAEIKQGLRRVVLCKDSKGMIGLRVQAVNKGLFVSFVNENSPASMAGLRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNNITVVIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVIDKTPNIVTVTIMPMFVYEHMVK 875
            LYP+LED+KVD+       FI       +  + S  G LYP L +++G+N+  DA   ++     Q  G  SV  SG    A   AP+T  D+G+ RAEI+QG+R VVLCKD  G IGLR++A++ G+FV  V  N+ A++ GLRFGDQIL+IN +  AGW++D AHK  K A    IT+ +RDRP ERT+T++KD NG +GF+FK GKIT +VKDSSAARNGLL D ++ E+NGQNVIGLKD ++  +++ +  +VTVT+MPM ++EHM+K
Sbjct:    3 LYPSLEDMKVDK-------FIQ------VCPSLSTSGKLYPELSEFMGLNLSVDALQVLSTTVPEQTSGALSVHSSGMNWAA---APITGGDLGVKRAEIRQGVREVVLCKDMDGKIGLRLKAIDNGVFVQLVQANTAAALGGLRFGDQILQINGESCAGWSSDCAHKALKNANPERITLAVRDRPLERTVTLHKDMNGQLGFIFKKGKITSIVKDSSAARNGLLTDQQICEINGQNVIGLKDSQVLDILNSSDRVVTVTVMPMVIFEHMMK 258          
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Cavefish
Match: si:ch73-40i7.5 (amyloid beta A4 precursor protein-binding family A member 3-like [Source:NCBI gene;Acc:103039832])

HSP 1 Score: 58.9214 bits (141), Expect = 6.436e-9
Identity = 44/187 (23.53%), Postives = 83/187 (44.39%), Query Frame = 3
Query:  327 QHDVGIVRAEIKQGLRRVVLCKDSKGMIGLRVQAVNKG-----LFVSFVNENSPASMAG-LRFGDQILEINSQVVAGWTTDKAHKF---FKAAGSNNITVVIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVIDKTPNIVTVTIMPMFVY 860
            Q++  +V     + +R + + K    ++G+ V     G     + V+ +    PA  +G L  GD+I+ +N   + G      H      K+     I++V    P    I    D    +GF  +DG I  L++   A R G+ + H++IE+NGQ+V+    ++I +++      + +  MP   Y
Sbjct:  514 QYNGDLVHFSRSENIREICIKKQIGEILGIAVVESGWGSILPTVVVANLLHGGPAERSGELSIGDRIMSVNGTSLVGLPITTCHNIIRDLKSQAQVKISIV-HCPPVTMAIIKRPDPKYQLGFSVEDGIICSLMRGGIAERGGIRVGHRIIEINGQSVVATPHEKIIQILSNAVGEIHLKTMPTSTY 699          
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Cavefish
Match: apba1b (amyloid beta A4 precursor protein-binding family A member 1-like [Source:NCBI gene;Acc:103042206])

HSP 1 Score: 55.0694 bits (131), Expect = 1.180e-7
Identity = 34/133 (25.56%), Postives = 62/133 (46.62%), Query Frame = 3
Query:  471 PASMAG-LRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNNITV--VIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVIDKTPNIVTVTIMPMFVY 860
            PA+ +G L  GDQI+ +N   + G          K   S +     ++R  P    +    D    +GF  ++G I  L++   A R G+ + H++IE+NGQ+V+    ++I  ++      + +  MP  +Y
Sbjct:  900 PAAKSGRLNIGDQIMTVNGTSLVGLPLSTCQSIIKGLKSQSRIKMNIVRCPPVTMVLIRRPDLRYQLGFSVQNGIICSLMRGGIAERGGVRVGHRIIEINGQSVVATPHEKIVHILSNAVGEIHMKTMPAAMY 1032          
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Cavefish
Match: apba1b (amyloid beta A4 precursor protein-binding family A member 1-like [Source:NCBI gene;Acc:103042206])

HSP 1 Score: 55.0694 bits (131), Expect = 1.203e-7
Identity = 34/133 (25.56%), Postives = 62/133 (46.62%), Query Frame = 3
Query:  471 PASMAG-LRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNNITV--VIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVIDKTPNIVTVTIMPMFVY 860
            PA+ +G L  GDQI+ +N   + G          K   S +     ++R  P    +    D    +GF  ++G I  L++   A R G+ + H++IE+NGQ+V+    ++I  ++      + +  MP  +Y
Sbjct:  911 PAAKSGRLNIGDQIMTVNGTSLVGLPLSTCQSIIKGLKSQSRIKMNIVRCPPVTMVLIRRPDLRYQLGFSVQNGIICSLMRGGIAERGGVRVGHRIIEINGQSVVATPHEKIVHILSNAVGEIHMKTMPAAMY 1043          
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Sea Lamprey
Match: SDCBP (syndecan binding protein [Source:HGNC Symbol;Acc:HGNC:10662])

HSP 1 Score: 286.189 bits (731), Expect = 2.381e-95
Identity = 128/250 (51.20%), Postives = 183/250 (73.20%), Query Frame = 3
Query:  195 LYPALDDYLGMNMRDAQNQITQYCGNSVVGSGW-----RQNAQVVAPVTQHDVGIVRAEIKQGLRRVVLCKDSKGMIGLRVQAVNKGLFVSFVNENSPASMAGLRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNNITVVIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVIDKTPNIVTVTIMPMFVYEHMVKTLSNNLIKNHMDHSIPEV 929
            LYP L +Y+G+++ D + ++      +   SG        ++  + PVT  DVG+ RAE+KQG+R V+LCKD  G +GLR++AV+KG+FV  V   SPAS+AGLRFGDQ+L+IN +  A W TDKAHK  K A    I + +RDRPFERTITM+KDS GY+GFVFK+G+I  + KDSSAARNGLL +H + E+NGQNV+GLKD ++ +++  + + +T+TIMP F+Y+H++K ++++++KN MDHSIPEV
Sbjct:    9 LYPELREYMGLSLSDEEIRLNMPMVAASASSGALVARPSGSSMALGPVTGSDVGVRRAEVKQGVREVILCKDQDGKLGLRLKAVDKGIFVQLVQGGSPASLAGLRFGDQVLQINGENCAAWDTDKAHKVLKKAAPERIVMAVRDRPFERTITMHKDSLGYVGFVFKNGRIVSITKDSSAARNGLLTEHNVCELNGQNVVGLKDSQVSEILTASGSTITLTIMPSFIYDHIIKRMASSVLKNQMDHSIPEV 258          
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Sea Lamprey
Match: apba1b (amyloid beta (A4) precursor protein-binding, family A, member 1b [Source:ZFIN;Acc:ZDB-GENE-070925-3])

HSP 1 Score: 54.299 bits (129), Expect = 3.472e-8
Identity = 37/135 (27.41%), Postives = 62/135 (45.93%), Query Frame = 3
Query:  471 PASMAG-LRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNNITVV----IRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVIDKTPNIVTVTIMPMFVY 860
            PA+ +G L  GDQI+ IN   + G          K  G  N T+V    +   P    +    D    +GF  ++G I  L++   A R G+ + H++IE+NGQ+V+    ++I   +      + +  MP  +Y
Sbjct:  606 PATRSGKLNIGDQIMSINGTSLVGLPLSTCQTIIK--GLKNQTMVKVNIVSCPPVTSVLIKRPDLKYQLGFSVQNGIICSLMRGGIAERGGVRVGHRIIEINGQSVVATPHEKIVHALSNAVGEIHMKTMPAAMY 738          
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Nematostella
Match: EDO42095 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2D9])

HSP 1 Score: 275.404 bits (703), Expect = 7.560e-91
Identity = 130/248 (52.42%), Postives = 189/248 (76.21%), Query Frame = 3
Query:  195 LYPALDDYLGMNMRD--AQNQITQYCGNSVVGSGWRQNAQVVAPVT-QHDVGIVRAEIKQGLRRVVLCKDSKGMIGLRVQAVNKGLFVSFVNENSPASMAGLRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNNITVVIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVIDKTPNIVTVTIMPMFVYEHMVKTLSNNLIKNHMDHSIPEV 929
            LYP+L DY+G+ + +   +  +  Y   +  G+G    + +VAPVT  +++ + RAEIK G+R V+LCKD++G +GLRV+AVNKG+FV+FV+++SPA++ GLRFGDQIL+I+ + +AG+ TDKA K  K A    +   +RDRPFERTI + KDS G++GFVFK+GKIT + K++SAARNGLLI+H LIEVNGQNV+GLKD EI+ +++K+   VT+TI+P F+ EH++K ++ +L+K  MDHSIP+V
Sbjct:   16 LYPSLSDYMGIEVTEETVRQHVPNYVTLATPGTG---TSGIVAPVTGSNNLNLRRAEIKGGVREVILCKDNEGKLGLRVRAVNKGIFVAFVHKDSPAALGGLRFGDQILQIDGENMAGFDTDKAMKRLKNASPQRVVFAVRDRPFERTIVLQKDSTGHVGFVFKNGKITQIAKETSAARNGLLIEHHLIEVNGQNVVGLKDSEIKTILEKSDRSVTLTIIPSFICEHIMKCMAGSLVKKAMDHSIPDV 260          
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Nematostella
Match: EDO37650 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF60])

HSP 1 Score: 61.2326 bits (147), Expect = 3.209e-10
Identity = 36/146 (24.66%), Postives = 74/146 (50.68%), Query Frame = 3
Query:  444 FVSFVNENSPASMAG-LRFGDQILEINSQVVAGWTTDKAHKFFK-AAGSNNITVVIRDRPFERTITMNKDSNGY-IGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVIDKTPNIVTVTIMPMFVYEHMV 872
             ++ + ++ PA+ +G +  GDQIL +N+  + G    +     K +     +T+     P    + +N+    Y +GF  ++G I  L++ S A R G+ + H++IE+NG++V+    + I  ++  T   + +  MP  +Y  +V
Sbjct:  260 IIAHLAKDGPAAKSGRVNVGDQILSVNNTSLVGLPLPECQNVIKNSRPGTKVTLKTVSCPPTVQVVVNRPDTKYQLGFSVQNGMICSLMRGSIAERGGVRVGHRIIEINGESVVATSHQHIVDLLATTIGEIRMKTMPASMYRLLV 405          
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Nematostella
Match: EDO45624 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSE9])

HSP 1 Score: 49.6766 bits (117), Expect = 9.510e-7
Identity = 46/175 (26.29%), Postives = 79/175 (45.14%), Query Frame = 3
Query:  378 VVLCKDSKGMIGLRVQAVNKGLFVSFVNENSPASMAG----LRFGDQILEINSQVVAGWT----------TDKAHKFFKAAGSNNITVVIRDRPFE---RTITMNKDSNGYIGFVFKDGK----------ITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVIDKTP 821
            V L KDSKG +G+ V     G     V    P  +A     +R GD++L +N +   G T            +  + F          +++  P E   + IT+ K  +G +GF    G+          I ++ KDS+++R+GL I  +++EVNG+++ G+ + E  + I   P
Sbjct:   93 VELKKDSKGSLGIHVSG-GVGTNCIDVRHVVPLGVAAKDGRIRKGDRVLSVNGRSTKGLTHQEVLNLLQNLPRRVRLFSGGNGKAFKEILQKTPPEPSVKEITLEKGPSG-LGFSVGGGRDSLYGDTPIYIKYVFKDSASSRSGLEIGDEVLEVNGRHMRGMTNVEALEAIRALP 265          
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Nematostella
Match: EDO36274 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ40])

HSP 1 Score: 44.669 bits (104), Expect = 2.512e-6
Identity = 27/76 (35.53%), Postives = 44/76 (57.89%), Query Frame = 3
Query:  393 DSKGMIGLRVQAVN-KGLFVSFVNENSPASMAGLRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNNITVVIRDRP 617
            + K  +G+ +   N  G++V  V E S A  AGLR+GDQ+LE N   +   T ++A K  K +G N++T++ +  P
Sbjct:    8 EKKDTLGISITPGNCGGIYVCNVKEGSVAQKAGLRYGDQLLEYNGVNLRCATYEQAAKILKESG-NSVTILAQFNP 82          
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Nematostella
Match: EDO33432 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SS78])

HSP 1 Score: 48.521 bits (114), Expect = 4.563e-6
Identity = 50/225 (22.22%), Postives = 97/225 (43.11%), Query Frame = 3
Query:  366 GLRRV--VLCKDSKGMIGLRV---------QAVNKGLFVSFVNENSPASMAG-LRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNNITVVIRD----------------------------------------RPFERTITMNKDSNGYIGF---------VFKDGK----ITHLVKDSSAARNGLL-IDHKLIEVNGQNVIGLKDKEIQKVIDKTPNIVTVTI 842
            GLR +   + +D+KG+ G+ +         +  ++G+F+S ++EN PA   G L  GD+IL++N   ++  T  +A    K+ G +    V+R+                                        RP + TIT+ +  +  +GF          +KDG     I+ + KD +A R+G L +  K++ +N +++   K  +   ++   P+ VT+ +
Sbjct:  563 GLRNIEYTIHRDTKGL-GINIAGGKGSTPYKENDEGIFISRISENGPAGRDGILHVGDKILKVNGVDISNATHHQAVDVLKSTGKDITLYVVREKQEIEKRTVPKTAKDESVKEEPKKTGVRFAPEPEMEDIETRPEKETITLKRGGDKGLGFSIAGGKGSTPYKDGDPGIFISKIAKDGTAERDGRLKVGDKVLSINSRDMKNAKHDDAVNMLTSGPSFVTLIV 786          
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Medaka
Match: sdcbp2 (syntenin-1 [Source:NCBI gene;Acc:101156166])

HSP 1 Score: 288.5 bits (737), Expect = 1.066e-94
Identity = 149/300 (49.67%), Postives = 205/300 (68.33%), Query Frame = 3
Query:   81 LYPTLEDLKVDELKSAQHNFISTVVNEP-IGQTGSQGGL---------LYP---ALDDYLGMNMRDAQNQ----ITQYCGNSVVGSGWRQNAQVVAPVTQHDVGIVRAEIKQGLRRVVLCKDSKGMIGLRVQAVNKGLFVSFVNENSPASMAGLRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNNITVVIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVIDKTPNIVTVTIMPMFVYEHMVKTLSNNLIKNHMDHSIPEV 929
            LYP+LEDLKVD++  AQ  F  T    P I +  SQ  L         LYP    L DY+G+ +   + Q    +     N V          +V PVT  D+GI+RAEI+ G+R V+LCKD    +GLR++A++ G+F+  V  NSPA++AGLRFGDQ+L+IN Q  AGW+ DKAHK  KAA    I +V+RDRPF+RT+TM+KDS+G++GF++K GKIT LVKD SAARNGLL +H + E+NGQN+IGLKD +I+ +++ +P  +T+TIMP F+YEHM+K +S+ L+++ MDHSIPEV
Sbjct:   18 LYPSLEDLKVDKVIKAQVQFAQTAAPMPAITEGSSQPELAAVAMPASGLYPNLGELGDYMGLALNSDEVQKNLALLPVGDNQVAVPASSGVGGMVRPVTGSDIGILRAEIRPGIREVILCKDQDRKVGLRLRAIDNGVFIQLVQANSPAALAGLRFGDQVLQINGQNCAGWSVDKAHKALKAAAETRIEMVVRDRPFQRTVTMHKDSSGHVGFIYKSGKITSLVKDGSAARNGLLTEHYICEINGQNIIGLKDSQIKDILNSSPTAMTITIMPKFIYEHMIKRMSSGLLRSSMDHSIPEV 317          
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Medaka
Match: si:ch73-40i7.5 (amyloid-beta A4 precursor protein-binding family A member 3 [Source:NCBI gene;Acc:101162033])

HSP 1 Score: 59.3066 bits (142), Expect = 4.691e-9
Identity = 44/174 (25.29%), Postives = 74/174 (42.53%), Query Frame = 3
Query:  363 QGLRRVVLCKDSKGMIGLRVQAVNKG-----LFVSFVNENSPASMAG-LRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNNIT--VVIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVIDKTPNIVTVTIMPMFVY 860
            Q LR VV+ K    ++GL V     G     + V+ +    PA   G L  GD+I+ +N   + G          +   S       ++   P    I    D    +GF  +DG I  L++   A R G+ + H++IE+NGQ+V+    ++I + +      + +  MP   Y
Sbjct:  519 QNLRDVVITKAPGEILGLAVVESGWGSILPTVVVANLLHGGPAERCGELSIGDRIMSVNGTSLVGLPITTCQNIIRDLKSQKYVKLSIVHCPPVTMAIIRRPDPKFQLGFSVEDGIICSLMRGGIAERGGIRVGHRIIEINGQSVVATPHEKIIQTLTNAVGEIHLKTMPASTY 692          
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Medaka
Match: ENSORLT00000021659.2 (amyloid-beta A4 precursor protein-binding family A member 1-like [Source:NCBI gene;Acc:101168719])

HSP 1 Score: 54.299 bits (129), Expect = 2.769e-8
Identity = 36/135 (26.67%), Postives = 59/135 (43.70%), Query Frame = 3
Query:  471 PASMAG-LRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNNITV---VIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVIDKTPNIVTVTIMPMFVYE 863
            PA  +G L  GDQI+ +N   + G          K    N   V   V+R  P    +         +GF  ++G I  LV+   A R G+ + H +IE+NGQ+V+    ++I  ++      + +  MP  +Y 
Sbjct:   41 PAERSGRLNTGDQIMSVNGTSLVGLPLSSCQNIIKDL-KNQTRVQMNVVRCPPVTTVLIRRPALRLQLGFSVQNGIICSLVRGGIAERGGVRVGHHIIEINGQSVVATPHEKIVHILSNAVGKIHMKTMPAAMYR 174          
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Medaka
Match: apba1b (amyloid-beta A4 precursor protein-binding family A member 1 [Source:NCBI gene;Acc:101166648])

HSP 1 Score: 53.9138 bits (128), Expect = 2.532e-7
Identity = 34/133 (25.56%), Postives = 61/133 (45.86%), Query Frame = 3
Query:  471 PASMAG-LRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNNITV--VIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVIDKTPNIVTVTIMPMFVY 860
            PA  +G L  GDQI+ IN   + G          K   S +     ++R  P    +    D    +GF  ++G I  L++   A R G+ + H++IE+N Q+V+    ++I +++      + +  MP  +Y
Sbjct:  933 PAEKSGRLNIGDQIMTINGTSLVGLPLSTCQSIIKGLKSQSRIKMNIVRCPPVTMVLIRRPDLRYQLGFSVQNGIICSLMRGGIAERGGVRVGHRIIEINSQSVVATPHEKIVQILSNAMGEIHMKTMPAAMY 1065          
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Medaka
Match: apba2a (amyloid-beta A4 precursor protein-binding family A member 2 [Source:NCBI gene;Acc:101160976])

HSP 1 Score: 53.1434 bits (126), Expect = 3.932e-7
Identity = 34/143 (23.78%), Postives = 64/143 (44.76%), Query Frame = 3
Query:  441 LFVSFVNENSPASMAGLRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNNITV---VIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVIDKTPNIVTVTIMPMFVY 860
            +  S +N    A    L  GDQI+ IN   + G          K    N + V   ++   P    +    D    +GF  ++G I  L++   A R G+ + H++IE+NGQ+V+ +  ++I + +  +   + +  MP  ++
Sbjct:  667 ILASMLNSGPAARSGKLSVGDQIMSINDTSLVGLPLATCQGIIKGL-KNQVKVKLSIVSCPPVTTVLIKRPDLKFQLGFSVQNGIICSLMRGGIAERGGVRVGHRIIEINGQSVVAMAHEKIVQTLSVSVGEINMKTMPAVMF 808          
BLAST of Syndecan binding protein (Syntenin) vs. Planmine SMEST
Match: SMESG000044911.1 (SMESG000044911.1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.909e-13
Identity = 45/159 (28.30%), Postives = 86/159 (54.09%), Query Frame = 3
Query:  444 FVSFVNENSPASMAGLRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNN--ITVVIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVID-----KTPNIVTVTIMPMFVYEHMVKTLSNNLIK 899
            FV FV ++SPA  A ++FGDQILE++     G   +      +  G+ +  I V+    PF+         +  +GF   DG I ++ + S A++  L I++++IE++G+ + G+ + E+++ +       +  I+ +T+MP F+YE +V +L    I+
Sbjct:  244 FVLFVVKHSPAYGANIQFGDQILEVD-----GLILNNRLALSRLTGNKSLVIHVLYTKCPFKLYYNFEIPKSDSMGFQIVDGNIVYVEEGSPASKAKLPINYQIIELDGECIFGMTNTELKRELRNRVSVHSKRIIFMTVMPRFIYEGLVGSLDPTYIR 397          
BLAST of Syndecan binding protein (Syntenin) vs. Planmine SMEST
Match: SMESG000044911.1 (SMESG000044911.1)

HSP 1 Score: 72.0182 bits (175), Expect = 2.053e-13
Identity = 45/159 (28.30%), Postives = 86/159 (54.09%), Query Frame = 3
Query:  444 FVSFVNENSPASMAGLRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNN--ITVVIRDRPFERTITMNKDSNGYIGFVFKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVID-----KTPNIVTVTIMPMFVYEHMVKTLSNNLIK 899
            FV FV ++SPA  A ++FGDQILE++     G   +      +  G+ +  I V+    PF+         +  +GF   DG I ++ + S A++  L I++++IE++G+ + G+ + E+++ +       +  I+ +T+MP F+YE +V +L    I+
Sbjct:  234 FVLFVVKHSPAYGANIQFGDQILEVD-----GLILNNRLALSRLTGNKSLVIHVLYTKCPFKLYYNFEIPKSDSMGFQIVDGNIVYVEEGSPASKAKLPINYQIIELDGECIFGMTNTELKRELRNRVSVHSKRIIFMTVMPRFIYEGLVGSLDPTYIR 387          
BLAST of Syndecan binding protein (Syntenin) vs. Planmine SMEST
Match: SMESG000028750.1 (SMESG000028750.1)

HSP 1 Score: 61.6178 bits (148), Expect = 4.148e-10
Identity = 26/81 (32.10%), Postives = 56/81 (69.14%), Query Frame = 3
Query:  375 RVVLCKDSKGMIGLRVQAVNKGLFVSFVNENSPASMAGLRFGDQILEINSQVVAGWTTDKAHKFFK--AAGSNNITVVIRD 611
            R V+ +   G +G+R+Q   +GLF++ V  +SPAS AGL+ GD++L+IN+++V+ W+ +K  ++ +  +   +++ +++R+
Sbjct:  292 RDVIIRKVDGRLGIRLQKKPEGLFLAIVITDSPASRAGLKEGDELLKINNEIVSDWSQEKVTQYLRDISTDDSDLLLIVRE 372          
BLAST of Syndecan binding protein (Syntenin) vs. Planmine SMEST
Match: SMESG000028232.1 (SMESG000028232.1)

HSP 1 Score: 56.225 bits (134), Expect = 2.016e-8
Identity = 23/77 (29.87%), Postives = 48/77 (62.34%), Query Frame = 3
Query:  375 RVVLCKDSKGMIGLRVQAVNKGLFVSFVNENSPASMAGLRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNNITVVI 605
            R+V+ K   G  G+R+Q  ++G++ + V  NS A +AG++ GD+IL+IN ++V+ W+ ++  +  +   ++   +V 
Sbjct:  223 RLVILKKVNGKFGIRIQRRSEGIYFAAVLPNSSACLAGIKEGDEILKINDEIVSHWSQEEVTRLLREVNTDESELVF 299          

HSP 2 Score: 49.6766 bits (117), Expect = 2.657e-6
Identity = 20/61 (32.79%), Postives = 39/61 (63.93%), Query Frame = 3
Query:  363 QGLRRVVLCKDSKGMIGLRVQAVNKGLFVSFVNENSPASMAGLRFGDQILEINSQVVAGWT 545
            Q  R V+L KDS    G+++  + +  ++S +  +SPA+ AGL+ GD+I+ +N+Q +  ++
Sbjct:  134 QETRDVILTKDSFEKFGIKINRIGESFYISMIVCDSPAAKAGLKVGDEIIRVNNQTIDRYS 194          
BLAST of Syndecan binding protein (Syntenin) vs. Planmine SMEST
Match: SMESG000028232.1 (SMESG000028232.1)

HSP 1 Score: 55.8398 bits (133), Expect = 2.110e-8
Identity = 23/76 (30.26%), Postives = 48/76 (63.16%), Query Frame = 3
Query:  375 RVVLCKDSKGMIGLRVQAVNKGLFVSFVNENSPASMAGLRFGDQILEINSQVVAGWTTDKAHKFFKAAGSNNITVV 602
            R+V+ K   G  G+R+Q  ++G++ + V  NS A +AG++ GD+IL+IN ++V+ W+ ++  +  +   ++   +V
Sbjct:  217 RLVILKKVNGKFGIRIQRRSEGIYFAAVLPNSSACLAGIKEGDEILKINDEIVSHWSQEEVTRLLREVNTDESELV 292          

HSP 2 Score: 49.2914 bits (116), Expect = 2.951e-6
Identity = 20/61 (32.79%), Postives = 39/61 (63.93%), Query Frame = 3
Query:  363 QGLRRVVLCKDSKGMIGLRVQAVNKGLFVSFVNENSPASMAGLRFGDQILEINSQVVAGWT 545
            Q  R V+L KDS    G+++  + +  ++S +  +SPA+ AGL+ GD+I+ +N+Q +  ++
Sbjct:  128 QETRDVILTKDSFEKFGIKINRIGESFYISMIVCDSPAAKAGLKVGDEIIRVNNQTIDRYS 188          
The following BLAST results are available for this feature:
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SDCBP1.055e-10351.19syndecan binding protein [Source:HGNC Symbol;Acc:H... [more]
SDCBP2.093e-10350.83syndecan binding protein [Source:HGNC Symbol;Acc:H... [more]
SDCBP2.093e-10350.83syndecan binding protein [Source:HGNC Symbol;Acc:H... [more]
SDCBP4.587e-10351.19syndecan binding protein [Source:HGNC Symbol;Acc:H... [more]
SDCBP4.587e-10351.19syndecan binding protein [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
lin-104.713e-625.00pep chromosome:WBcel235:I:8109746:8118517:-1 gene:... [more]
lin-104.993e-625.00pep chromosome:WBcel235:I:8109746:8119314:-1 gene:... [more]
lin-105.247e-625.00pep chromosome:WBcel235:I:8109746:8119314:-1 gene:... [more]
back to top
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
X11Lbeta7.887e-621.47gene:FBgn0052677 transcript:FBtr0343041[more]
X11Lbeta7.909e-621.47gene:FBgn0052677 transcript:FBtr0343042[more]
X11Lbeta8.261e-621.47gene:FBgn0052677 transcript:FBtr0071493[more]
back to top
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sdcbp24.843e-9650.33syndecan binding protein (syntenin) 2 [Source:ZFIN... [more]
sdcbp24.843e-9650.33syndecan binding protein (syntenin) 2 [Source:ZFIN... [more]
sdcbp24.843e-9650.33syndecan binding protein (syntenin) 2 [Source:ZFIN... [more]
sdcbp24.843e-9650.33syndecan binding protein (syntenin) 2 [Source:ZFIN... [more]
sdcbp1.219e-9546.28syndecan binding protein (syntenin) [Source:ZFIN;A... [more]
back to top
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sdcbp7.281e-10752.19syndecan binding protein [Source:NCBI gene;Acc:448... [more]
sdcbp1.550e-10050.67syndecan binding protein [Source:NCBI gene;Acc:448... [more]
APBA32.577e-926.74amyloid beta (A4) precursor protein-binding, famil... [more]
APBA33.608e-926.59amyloid beta (A4) precursor protein-binding, famil... [more]
APBA33.748e-926.59amyloid beta (A4) precursor protein-binding, famil... [more]
back to top
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sdcbp2.722e-10249.66syndecan binding protein [Source:MGI Symbol;Acc:MG... [more]
Sdcbp3.856e-10249.01syndecan binding protein [Source:MGI Symbol;Acc:MG... [more]
Sdcbp29.979e-9450.85syndecan binding protein (syntenin) 2 [Source:MGI ... [more]
Sdcbp3.847e-8150.00syndecan binding protein [Source:MGI Symbol;Acc:MG... [more]
Sdcbp2.264e-5745.89syndecan binding protein [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Syndecan binding protein (Syntenin) vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O00560|SDCB1_HUMAN1.005e-10250.83Syntenin-1 OS=Homo sapiens OX=9606 GN=SDCBP PE=1 S... [more]
sp|Q9JI92|SDCB1_RAT2.981e-10250.50Syntenin-1 OS=Rattus norvegicus OX=10116 GN=Sdcbp ... [more]
sp|O08992|SDCB1_MOUSE2.697e-10149.01Syntenin-1 OS=Mus musculus OX=10090 GN=Sdcbp PE=1 ... [more]
sp|Q9H190|SDCB2_HUMAN4.625e-9349.66Syntenin-2 OS=Homo sapiens OX=9606 GN=SDCBP2 PE=1 ... [more]
sp|Q99JZ0|SDCB2_MOUSE6.981e-9350.85Syntenin-2 OS=Mus musculus OX=10090 GN=Sdcbp2 PE=2... [more]
back to top
BLAST of Syndecan binding protein (Syntenin) vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7V3S31.448e-10552.98Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A3S0ZKF44.474e-10552.33Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A1L8FT581.036e-10452.20Uncharacterized protein OS=Xenopus laevis OX=8355 ... [more]
A0A2C9JKC32.439e-10451.64Uncharacterized protein OS=Biomphalaria glabrata O... [more]
Q6DFR31.143e-10352.19Syndecan binding protein (Syntenin) OS=Xenopus tro... [more]
back to top
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sdcbp21.212e-9550.00syntenin-1-like [Source:NCBI gene;Acc:103039708][more]
sdcbp3.822e-7849.63syndecan binding protein (syntenin) [Source:ZFIN;A... [more]
si:ch73-40i7.56.436e-923.53amyloid beta A4 precursor protein-binding family A... [more]
apba1b1.180e-725.56amyloid beta A4 precursor protein-binding family A... [more]
apba1b1.203e-725.56amyloid beta A4 precursor protein-binding family A... [more]
back to top
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
SDCBP2.381e-9551.20syndecan binding protein [Source:HGNC Symbol;Acc:H... [more]
apba1b3.472e-827.41amyloid beta (A4) precursor protein-binding, famil... [more]
back to top
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO420957.560e-9152.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO376503.209e-1024.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO456249.510e-726.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362742.512e-635.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO334324.563e-622.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Syndecan binding protein (Syntenin) vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sdcbp21.066e-9449.67syntenin-1 [Source:NCBI gene;Acc:101156166][more]
si:ch73-40i7.54.691e-925.29amyloid-beta A4 precursor protein-binding family A... [more]
ENSORLT00000021659.22.769e-826.67amyloid-beta A4 precursor protein-binding family A... [more]
apba1b2.532e-725.56amyloid-beta A4 precursor protein-binding family A... [more]
apba2a3.932e-723.78amyloid-beta A4 precursor protein-binding family A... [more]
back to top
BLAST of Syndecan binding protein (Syntenin) vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000044911.11.909e-1328.30SMESG000044911.1[more]
SMESG000044911.12.053e-1328.30SMESG000044911.1[more]
SMESG000028750.14.148e-1032.10SMESG000028750.1[more]
SMESG000028232.12.016e-829.87SMESG000028232.1[more]
SMESG000028232.12.110e-830.26SMESG000028232.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011303 ID=SMED30011303|Name=Syndecan binding protein (Syntenin)|organism=Schmidtea mediterranea sexual|type=transcript|length=1321bp
ATTTTGAATAAACTATTTTACATAATCATAAACACATTTAAATTATTACA
CTTCCATTATATTTAATTTAGATGTCTCGATTATATCCTACTTTAGAAGA
CTTGAAAGTTGATGAATTGAAATCAGCTCAACATAACTTTATTTCAACGG
TTGTTAATGAGCCTATTGGCCAAACTGGATCGCAAGGAGGCCTATTATAT
CCAGCATTAGATGATTATCTAGGAATGAATATGAGAGATGCTCAGAATCA
AATTACTCAATACTGTGGTAATAGTGTTGTTGGTTCTGGGTGGCGACAAA
ATGCACAAGTAGTTGCTCCAGTAACTCAACATGATGTTGGTATTGTTAGA
GCAGAAATTAAGCAAGGATTAAGGAGAGTTGTATTATGTAAAGACTCCAA
AGGTATGATTGGGCTACGAGTTCAAGCTGTCAACAAAGGTCTTTTTGTTT
CGTTTGTGAATGAGAATTCTCCTGCGTCAATGGCAGGATTGCGATTTGGT
GATCAAATTTTAGAAATAAACAGTCAAGTTGTTGCAGGGTGGACTACGGA
TAAAGCTCATAAATTTTTTAAAGCAGCTGGATCTAACAATATTACCGTCG
TAATTCGTGATAGACCGTTTGAACGAACAATTACAATGAACAAAGATAGC
AATGGATATATTGGATTTGTATTCAAAGATGGAAAAATAACCCATTTAGT
CAAAGACAGCAGTGCAGCAAGGAATGGGTTACTTATCGATCACAAATTGA
TTGAGGTTAACGGTCAAAATGTTATCGGTTTGAAGGATAAAGAAATACAA
AAAGTTATAGACAAAACACCGAACATTGTTACAGTTACGATAATGCCGAT
GTTTGTGTATGAGCATATGGTCAAAACATTGAGCAACAATCTGATAAAGA
ACCACATGGATCATAGCATCCCGGAAGTTTAAAAATAAACAGTTACTTGT
CTTTTACATCATGACATTTTAACACTAATCCTGATATTTATTGCCATCTA
ACTTTGTTCATTGATATAAATATATTTTGTGTGTTTTATTTATTGTGCAA
TTTTCTTTTAGTTATATGTGTAATTATTAACTTGTACAATTATGTGTGTG
TGTGTGTGTATGTATGTTAGTAGATTTATTTGAAGTTTACGGAATGTCAT
TGAGTTTTTTTACTGACTTGAATGAAAATATTCAGTGCAACAAGTTATTA
TTAATTCGACTAAAAATAAATTGCGTAATTTTCAAAAAAAAATATTTGTG
AATCTACTAATTACAATTGCTGCTCTTATTCGTGAAAAAAGCCATATTTT
GAAAATAAAATTTAAACAAAA
back to top

protein sequence of SMED30011303-orf-1

>SMED30011303-orf-1 ID=SMED30011303-orf-1|Name=SMED30011303-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=287bp
MSRLYPTLEDLKVDELKSAQHNFISTVVNEPIGQTGSQGGLLYPALDDYL
GMNMRDAQNQITQYCGNSVVGSGWRQNAQVVAPVTQHDVGIVRAEIKQGL
RRVVLCKDSKGMIGLRVQAVNKGLFVSFVNENSPASMAGLRFGDQILEIN
SQVVAGWTTDKAHKFFKAAGSNNITVVIRDRPFERTITMNKDSNGYIGFV
FKDGKITHLVKDSSAARNGLLIDHKLIEVNGQNVIGLKDKEIQKVIDKTP
NIVTVTIMPMFVYEHMVKTLSNNLIKNHMDHSIPEV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0045202synapse
GO:0005576extracellular region
GO:0005615extracellular space
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005737cytoplasm
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0005829cytosol
GO:0005856cytoskeleton
GO:0005886plasma membrane
GO:0005895interleukin-5 receptor complex
GO:0005912adherens junction
GO:0005925focal adhesion
GO:0016020membrane
GO:0030054cell junction
GO:0031965nuclear membrane
GO:0035578azurophil granule lumen
GO:0042470melanosome
GO:0043231intracellular membrane-bounded organelle
GO:0045121membrane raft
GO:0070062extracellular exosome
GO:0072562blood microparticle
GO:1903561extracellular vesicle
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000429neoblast
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036034PDZ_sf
IPR001478PDZ
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005109frizzled binding
GO:0005137interleukin-5 receptor binding
GO:0005546phosphatidylinositol-4,5-bisphosphate binding
GO:0008093cytoskeletal adaptor activity
GO:0008289lipid binding
GO:0042802identical protein binding
GO:0045296cadherin binding
GO:0045545syndecan binding
GO:0046982protein heterodimerization activity
GO:0047485protein N-terminus binding
Vocabulary: biological process
TermDefinition
GO:0002091negative regulation of receptor internalization
GO:0006612protein targeting to membrane
GO:0006930substrate-dependent cell migration, cell extension
GO:0007268chemical synaptic transmission
GO:0007346regulation of mitotic cell cycle
GO:0008284positive regulation of cell proliferation
GO:0010718positive regulation of epithelial to mesenchymal transition
GO:0010862positive regulation of pathway-restricted SMAD protein phosphorylation
GO:0030036actin cytoskeleton organization
GO:0030307positive regulation of cell growth
GO:0030335positive regulation of cell migration
GO:0030511positive regulation of transforming growth factor beta receptor signaling pathway
GO:0032435negative regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0035556intracellular signal transduction
GO:0042327positive regulation of phosphorylation
GO:0043312neutrophil degranulation
GO:0046330positive regulation of JNK cascade
GO:0048013ephrin receptor signaling pathway
GO:1903543positive regulation of exosomal secretion
GO:1903553positive regulation of extracellular exosome assembly
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001478PDZ domainSMARTSM00228pdz_newcoord: 111..182
e-value: 1.8E-14
score: 64.1
coord: 195..261
e-value: 1.2E-7
score: 41.4
IPR001478PDZ domainPFAMPF00595PDZcoord: 107..178
e-value: 1.5E-12
score: 47.7
coord: 187..258
e-value: 4.0E-8
score: 33.5
IPR001478PDZ domainPROSITEPS50106PDZcoord: 102..181
score: 16.003
IPR001478PDZ domainPROSITEPS50106PDZcoord: 186..261
score: 12.205
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 87..182
e-value: 9.7E-22
score: 78.9
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 183..267
e-value: 1.0E-34
score: 120.4
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 97..188
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 183..277
NoneNo IPR availablePANTHERPTHR12345:SF13SYNTENIN-2coord: 1..283
NoneNo IPR availablePANTHERPTHR12345SYNTENIN RELATEDcoord: 1..283
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 184..257
e-value: 1.11158E-12
score: 60.273
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 100..179
e-value: 7.64138E-16
score: 69.1326