Protein kinase domain-containing protein

Overview
NameProtein kinase domain-containing protein
Smed IDSMED30011294
Length (bp)1216
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase domain-containing protein (SMED30011294) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30011294) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011294

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30011294SMESG000041899.1 SMESG000031064.1 SmedASXL_009246SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30011294SMESG000041899.1 SMESG000031064.1 dd_Smed_v4_8347_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30011294SMESG000041899.1 SMESG000031064.1 dd_Smed_v4_8347_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30011294SMESG000041899.1 SMESG000031064.1 dd_Smed_v4_8347_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011294SMESG000041899.1 SMESG000031064.1 dd_Smed_v4_8347_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30011294SMESG000041899.1 SMESG000031064.1 dd_Smed_v4_8347_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30011294SMESG000041899.1 SMESG000031064.1 dd_Smed_v4_8347_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
Smed sexual biotypeSMED30011294SMESG000041899.1 SMESG000031064.1 Contig49219uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011294SMESG000041899.1 SMESG000031064.1 Contig49219newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30011294SMESG000041899.1 SMESG000031064.1 dd_Smed_v6_8347_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Category 4 cellSMED30011294SMESG000041899.1 SMESG000031064.1 dd_Smed_v4_8347_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011294SMESG000041899.1 SMESG000031064.1 dd_Smed_v4_8347_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: NEK7 (NIMA related kinase 7 [Source:HGNC Symbol;Acc:HGNC:13386])

HSP 1 Score: 425.631 bits (1093), Expect = 5.842e-149
Identity = 197/276 (71.38%), Postives = 230/276 (83.33%), Query Frame = 3
Query:  114 PNSPYGSLSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEKT 941
            P+  Y +L+ F + K+IG+GQFSEV+RA        VALKKVQI+++MD KAR DCIKEIDLLKQL+HPNVIK  ASF+E+NELNIVLELADAGDLS+MIKHF+++ +L+PE+T+WKYFVQ+CS L HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LCKKI+ CDYPPLP++ YS ELR LV+ CIN DP  RP+++Y+Y VAK MH  T
Sbjct:   24 PDMGYNTLANFRIEKKIGRGQFSEVYRAACLLDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNMCINPDPEKRPDVTYVYDVAKRMHACT 299          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: NEK7 (NIMA related kinase 7 [Source:HGNC Symbol;Acc:HGNC:13386])

HSP 1 Score: 425.631 bits (1093), Expect = 5.842e-149
Identity = 197/276 (71.38%), Postives = 230/276 (83.33%), Query Frame = 3
Query:  114 PNSPYGSLSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEKT 941
            P+  Y +L+ F + K+IG+GQFSEV+RA        VALKKVQI+++MD KAR DCIKEIDLLKQL+HPNVIK  ASF+E+NELNIVLELADAGDLS+MIKHF+++ +L+PE+T+WKYFVQ+CS L HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LCKKI+ CDYPPLP++ YS ELR LV+ CIN DP  RP+++Y+Y VAK MH  T
Sbjct:   24 PDMGYNTLANFRIEKKIGRGQFSEVYRAACLLDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNMCINPDPEKRPDVTYVYDVAKRMHACT 299          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: NEK6 (NIMA related kinase 6 [Source:HGNC Symbol;Acc:HGNC:7749])

HSP 1 Score: 416.001 bits (1068), Expect = 4.427e-145
Identity = 196/279 (70.25%), Postives = 230/279 (82.44%), Query Frame = 3
Query:  102 PQNDPN--SPYGSLSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMH 932
            PQ  PN  S   SL+ F + K+IG+GQFSEV++A      + VALKKVQI+EMMD KARQDC+KEI LLKQL+HPN+IK L SF+E+NELNIVLELADAGDLSQMIK+F+++ +L+PE+T+WKYFVQ+CS + HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LC+KI+ CDYPPLP   YS +LR LVS CI  DP+ RP+I Y++ VAK+MH
Sbjct:   29 PQRHPNTLSFRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCICPDPHQRPDIGYVHQVAKQMH 307          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: NEK6 (NIMA related kinase 6 [Source:HGNC Symbol;Acc:HGNC:7749])

HSP 1 Score: 416.001 bits (1068), Expect = 4.427e-145
Identity = 196/279 (70.25%), Postives = 230/279 (82.44%), Query Frame = 3
Query:  102 PQNDPN--SPYGSLSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMH 932
            PQ  PN  S   SL+ F + K+IG+GQFSEV++A      + VALKKVQI+EMMD KARQDC+KEI LLKQL+HPN+IK L SF+E+NELNIVLELADAGDLSQMIK+F+++ +L+PE+T+WKYFVQ+CS + HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LC+KI+ CDYPPLP   YS +LR LVS CI  DP+ RP+I Y++ VAK+MH
Sbjct:   29 PQRHPNTLSFRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCICPDPHQRPDIGYVHQVAKQMH 307          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: NEK6 (NIMA related kinase 6 [Source:HGNC Symbol;Acc:HGNC:7749])

HSP 1 Score: 416.001 bits (1068), Expect = 4.427e-145
Identity = 196/279 (70.25%), Postives = 230/279 (82.44%), Query Frame = 3
Query:  102 PQNDPN--SPYGSLSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMH 932
            PQ  PN  S   SL+ F + K+IG+GQFSEV++A      + VALKKVQI+EMMD KARQDC+KEI LLKQL+HPN+IK L SF+E+NELNIVLELADAGDLSQMIK+F+++ +L+PE+T+WKYFVQ+CS + HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LC+KI+ CDYPPLP   YS +LR LVS CI  DP+ RP+I Y++ VAK+MH
Sbjct:   29 PQRHPNTLSFRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCICPDPHQRPDIGYVHQVAKQMH 307          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: nekl-3 (Serine/threonine-protein kinase nekl-3 [Source:UniProtKB/Swiss-Prot;Acc:G5EFM9])

HSP 1 Score: 389.808 bits (1000), Expect = 2.911e-135
Identity = 187/275 (68.00%), Postives = 222/275 (80.73%), Query Frame = 3
Query:  108 NDPNSPYGSLSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMH 932
            +DP     SL  F + K+IGKGQFSEV+RA+    +  VALKK+Q++EM+D KARQDC+KEIDLLKQL+H NVI+  ASF++NN+LNIVLELA+AGD+S+MIKHF++  +L+PEKTIWKYFVQ+   L HMHSKRIMHRDIKPANVFIT  G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERI E  YN  SD+WS GCLLYEMAALQSPFYGDKM L  LCKKI+ C+YPPLPA+IYS +LR LVS+CI  + + RPE S +  VA+ M+
Sbjct:   11 DDPPPDKLSLELFIIEKKIGKGQFSEVFRAQCTWVDLHVALKKIQVFEMVDQKARQDCLKEIDLLKQLNHVNVIRYYASFIDNNQLNIVLELAEAGDMSRMIKHFKKGGRLIPEKTIWKYFVQLARALAHMHSKRIMHRDIKPANVFITGNGIVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIQESGYNFKSDLWSTGCLLYEMAALQSPFYGDKMNLYSLCKKIENCEYPPLPADIYSTQLRDLVSRCILPEASKRPETSEVLQVAEHMN 285          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: nekl-3 (Serine/threonine-protein kinase nekl-3 [Source:UniProtKB/Swiss-Prot;Acc:G5EFM9])

HSP 1 Score: 389.808 bits (1000), Expect = 2.911e-135
Identity = 187/275 (68.00%), Postives = 222/275 (80.73%), Query Frame = 3
Query:  108 NDPNSPYGSLSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMH 932
            +DP     SL  F + K+IGKGQFSEV+RA+    +  VALKK+Q++EM+D KARQDC+KEIDLLKQL+H NVI+  ASF++NN+LNIVLELA+AGD+S+MIKHF++  +L+PEKTIWKYFVQ+   L HMHSKRIMHRDIKPANVFIT  G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERI E  YN  SD+WS GCLLYEMAALQSPFYGDKM L  LCKKI+ C+YPPLPA+IYS +LR LVS+CI  + + RPE S +  VA+ M+
Sbjct:   11 DDPPPDKLSLELFIIEKKIGKGQFSEVFRAQCTWVDLHVALKKIQVFEMVDQKARQDCLKEIDLLKQLNHVNVIRYYASFIDNNQLNIVLELAEAGDMSRMIKHFKKGGRLIPEKTIWKYFVQLARALAHMHSKRIMHRDIKPANVFITGNGIVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIQESGYNFKSDLWSTGCLLYEMAALQSPFYGDKMNLYSLCKKIENCEYPPLPADIYSTQLRDLVSRCILPEASKRPETSEVLQVAEHMN 285          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: nekl-1 (NEK (NEver in mitosis Kinase) Like [Source:UniProtKB/TrEMBL;Acc:A0A061AD48])

HSP 1 Score: 181.415 bits (459), Expect = 4.785e-50
Identity = 93/273 (34.07%), Postives = 156/273 (57.14%), Query Frame = 3
Query:   81 MSNNIIVPQNDPNSPYGSLSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSST--NDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRP 893
            ++N I++   +P +     +++  ++ +GKG F        +  + +V +K++ +Y++ D+  R+  + E+ LL +++HPN+I    SF E   L I +E AD G L+QM+    R   L+ E+ I    +Q+CS + ++H   ++HRD+K ANVF+T    VK+GD G+ +   + T    A+++VGTPYY+SPE     +YN  SD+W+LGC+LYEM  L+  F GD   L  L   I  C Y P+    YS E++ ++ + +  DP  RP
Sbjct:  113 INNEIMITNPNPRATSAQ-NRYERIRTVGKGAFGSAVLYRRREDSSLVIIKEINMYDL-DSSQRRLALNEVSLLSRIEHPNIIAYYDSFEEEGVLMIEMEYADGGTLAQMLS---RTQNLLDEEQIGDMMIQMCSAVAYLHENSVLHRDLKTANVFLTRDSFVKIGDFGISKIMGTETLAQGAKTVVGTPYYISPEMCSGVSYNEKSDMWALGCILYEMCCLKKAFEGD--NLPALVNSIMTCAYTPVKGP-YSAEMKMVIRELLQLDPQKRP 377          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: nekl-1 (NEK (NEver in mitosis Kinase) Like [Source:UniProtKB/TrEMBL;Acc:A0A061AD48])

HSP 1 Score: 181.8 bits (460), Expect = 4.840e-50
Identity = 93/273 (34.07%), Postives = 156/273 (57.14%), Query Frame = 3
Query:   81 MSNNIIVPQNDPNSPYGSLSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSST--NDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRP 893
            ++N I++   +P +     +++  ++ +GKG F        +  + +V +K++ +Y++ D+  R+  + E+ LL +++HPN+I    SF E   L I +E AD G L+QM+    R   L+ E+ I    +Q+CS + ++H   ++HRD+K ANVF+T    VK+GD G+ +   + T    A+++VGTPYY+SPE     +YN  SD+W+LGC+LYEM  L+  F GD   L  L   I  C Y P+    YS E++ ++ + +  DP  RP
Sbjct:  151 INNEIMITNPNPRATSAQ-NRYERIRTVGKGAFGSAVLYRRREDSSLVIIKEINMYDL-DSSQRRLALNEVSLLSRIEHPNIIAYYDSFEEEGVLMIEMEYADGGTLAQMLS---RTQNLLDEEQIGDMMIQMCSAVAYLHENSVLHRDLKTANVFLTRDSFVKIGDFGISKIMGTETLAQGAKTVVGTPYYISPEMCSGVSYNEKSDMWALGCILYEMCCLKKAFEGD--NLPALVNSIMTCAYTPVKGP-YSAEMKMVIRELLQLDPQKRP 415          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: nekl-2 (Serine/threonine-protein kinase nekl-2 [Source:UniProtKB/Swiss-Prot;Acc:O01775])

HSP 1 Score: 157.147 bits (396), Expect = 4.258e-44
Identity = 90/268 (33.58%), Postives = 150/268 (55.97%), Query Frame = 3
Query:  135 LSKFNVVKRIGKGQFSEVW--RAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFR-------RKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQV-KLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYM 908
            +  +  V+ +G+G F   W  R +  A+++ V +K +  + M + K       E++LLK++ HP +I  + SF+ +N+L IV++ A+ G L ++I   R       R+Y   PEKT+  YF QI   LNHMH K I+HRD+KP N+ +     V KL D G+ +   + +  A +++GTP Y+SPE    + YN  SD+WSLGC+LYE+  L+  F G+ +  + +  KI      PL  ++ S +++ LV   +    + RP++S +
Sbjct:    1 MDNYEKVRVVGRGAFGVCWLCRGKNDASHQKVIIKLINTHGMTE-KEENSIQSEVNLLKKVQHPLIIGYIDSFIMDNQLGIVMQYAEGGTLERLINDQRAIKDSNMREY--FPEKTVLDYFTQILIALNHMHQKNIVHRDLKPQNILMNRRKTVLKLSDFGISKELGTKSA-ASTVIGTPNYLSPEICESRPYNQKSDMWSLGCVLYELLQLERAFDGENLPAIVM--KITRSKQNPLGDHV-SNDVKMLVENLLKTHTDKRPDVSQL 261          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Nek2 (gene:FBgn0029970 transcript:FBtr0071142)

HSP 1 Score: 179.489 bits (454), Expect = 1.214e-49
Identity = 96/262 (36.64%), Postives = 147/262 (56.11%), Query Frame = 3
Query:  132 SLSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFV--ENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSK----RIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEI 899
            +L  + V+  +G G F   ++   K+T E+ A K +  Y+ +D       + EI +L+QL HPN+++     V  E   + IV+E    GDL+Q+++  R + Q   E  IW+   Q+C  L   H+K     I+HRDIKPAN+F+ + G  KLGD GL R      + A S VGTP+YMSPE +  + Y+  SD+W++GCL+YEM AL+ PF G       L +KI   ++  +PA IYS +L+ +++  +  D   RP I
Sbjct:   15 TLQDYEVLAVMGNGSFGTCYKVRDKSTGELFAWKGMN-YDELDEAKCDALVSEISVLRQLQHPNIVQYYHHLVNREAKSVYIVMECCAGGDLAQIVQRARSQRQRFEEPYIWRVLFQLCRALQVCHNKIPNGTILHRDIKPANIFLDAAGNAKLGDFGLARMLRRDQSFAASFVGTPHYMSPELVKGRKYDRKSDVWAVGCLVYEMCALRPPFRG--RAFDQLSEKIAQGEFSRIPA-IYSTDLQEIIAFMLAVDHEQRPGI 272          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: niki (gene:FBgn0045980 transcript:FBtr0084737)

HSP 1 Score: 175.252 bits (443), Expect = 6.207e-48
Identity = 92/256 (35.94%), Postives = 148/256 (57.81%), Query Frame = 3
Query:  135 LSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEIS 902
            L+ +  V+ +G+G F        K+    +  K++ + E+     R   + E+D+  +L HPN++  L SF+++N L I +E AD G L+Q+I   + K    PE+ I   F QI S +N+MHS+ I+HRD+K ANVF+   G VK+GD G+ +  ++  + AQ+++GTPYY SPE    + Y+  SDIW+LGC+L EM  L+  F    ++  +L  KI   +Y P+P+  Y+  LR+L+S  +  +   RP  S
Sbjct:  102 LANYEKVRVVGQGSFGIAILYRRKSDGHQIVFKQINLSEL-SPPGRDLAMNEVDVFSKLHHPNIVSYLGSFIKDNTLLIEMEYADGGTLAQIIAERQGKLHF-PERYIIAVFEQISSAINYMHSENILHRDLKTANVFLNRRGIVKIGDFGISKIMNTKIH-AQTVLGTPYYFSPEMCEGKEYDNKSDIWALGCILGEMCCLKKTFAASNLS--ELVTKIMAGNYTPVPSG-YTSGLRSLMSNLLQVEAPRRPTAS 351          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: GckIII (gene:FBgn0266465 transcript:FBtr0083399)

HSP 1 Score: 146.362 bits (368), Expect = 3.117e-38
Identity = 85/251 (33.86%), Postives = 133/251 (52.99%), Query Frame = 3
Query:  144 FNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYG-DKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRP 893
            F   +RIGKG F EV++     T ++VA+K + + E  D     D  +EI +L Q D P V K   SF++  +L I++E    G    ++K          E  I     ++  GL+++HS+R +HRDIK ANV ++  G VKL D G+    +++T+   + VGTP++M+PE I +  Y+  +DIWSLG    E+A  + P      M ++ L  K    + PP     Y++  +  V  C+NKDP +RP
Sbjct:   13 FTKQERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEI--DDIQQEIMVLSQCDSPYVTKYYGSFLKGTKLWIIMEYLGGGSALDLMKAGS-----FEEMHIGIILREVLKGLDYLHSERKLHRDIKAANVLLSEQGDVKLADFGVAGQLTNTTSKRNTFVGTPFWMAPEVIKQSQYDAKADIWSLGITAIELAKGEPPNSELHPMRVLFLIPK----NNPPQLTGSYTKSFKDFVEACLNKDPENRP 252          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Tao (gene:FBgn0031030 transcript:FBtr0309237)

HSP 1 Score: 133.65 bits (335), Expect = 7.952e-34
Identity = 85/253 (33.60%), Postives = 125/253 (49.41%), Query Frame = 3
Query:  144 FNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERI---HEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRP 893
            F  ++ IG G F  V+ A    T EIVA+KK+        +  QD +KEI  L+QL+HPN I+    ++  +   +V+E    G  S +I+  ++      E  I    + + SGL+++HS   +HRDIK  N+ +T  G VKL D G           A S VGTPY+M+PE I    E  Y+   D+WSLG    E+A  + P++   M  +     I   + P LP N +S    + V  C+ K P  RP
Sbjct:   27 FEDLREIGHGSFGAVYYARCNLTREIVAIKKMSYTGKQSQEKWQDILKEIRFLRQLNHPNTIEYKGCYLRESTAWLVMEYC-VGSASDIIEVHKKPLH---EDEIAAICLGVLSGLSYLHSLGRIHRDIKAGNILLTDNGVVKLADFGSAAIKCP----ANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPYF--NMNAMSALYHIAQNESPTLPKNDWSDAFCSFVELCLKKMPAERP 269          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Tao (gene:FBgn0031030 transcript:FBtr0336692)

HSP 1 Score: 133.265 bits (334), Expect = 9.060e-34
Identity = 85/253 (33.60%), Postives = 125/253 (49.41%), Query Frame = 3
Query:  144 FNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERI---HEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRP 893
            F  ++ IG G F  V+ A    T EIVA+KK+        +  QD +KEI  L+QL+HPN I+    ++  +   +V+E    G  S +I+  ++      E  I    + + SGL+++HS   +HRDIK  N+ +T  G VKL D G           A S VGTPY+M+PE I    E  Y+   D+WSLG    E+A  + P++   M  +     I   + P LP N +S    + V  C+ K P  RP
Sbjct:   27 FEDLREIGHGSFGAVYYARCNLTREIVAIKKMSYTGKQSQEKWQDILKEIRFLRQLNHPNTIEYKGCYLRESTAWLVMEYC-VGSASDIIEVHKKPLH---EDEIAAICLGVLSGLSYLHSLGRIHRDIKAGNILLTDNGVVKLADFGSAAIKCP----ANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPYF--NMNAMSALYHIAQNESPTLPKNDWSDAFCSFVELCLKKMPAERP 269          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: nek7 (NIMA-related kinase 7 [Source:ZFIN;Acc:ZDB-GENE-040801-136])

HSP 1 Score: 430.639 bits (1106), Expect = 2.990e-151
Identity = 199/271 (73.43%), Postives = 230/271 (84.87%), Query Frame = 3
Query:  126 YGSLSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEK 938
            Y SL+ F + K+IG+GQFSEV+RA     + IVALKK+QI+++MD KARQDCIKEIDLLKQL+HPNVIK  ASF+E NELNIVLELADAGDLSQMI+HF+++ +L+PEKT+WKYFVQ+CS L HMHS+RIMHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LCKKI+ CDYPPLP++ YS+ELR LV  CIN DP  RP+I+Y+Y +AK MH +
Sbjct:   24 YNSLANFAIEKKIGRGQFSEVYRATYVLDHTIVALKKIQIFDLMDAKARQDCIKEIDLLKQLNHPNVIKYHASFIEENELNIVLELADAGDLSQMIRHFKKQRRLIPEKTVWKYFVQLCSALEHMHSRRIMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSQELRKLVDMCINPDPEKRPDITYVYSMAKHMHGR 294          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: nek6 (NIMA-related kinase 6 [Source:ZFIN;Acc:ZDB-GENE-040724-133])

HSP 1 Score: 405.986 bits (1042), Expect = 5.805e-142
Identity = 187/262 (71.37%), Postives = 218/262 (83.21%), Query Frame = 3
Query:  144 FNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEM 929
            F + K+IG+GQFSEV+RA     N+ VALKKVQI+EMMD KARQDC+KEIDLLKQL+HPNVIK L SF+ NNELNIVLELA AGDLSQMI HF++K +L+PE+TIWKYFVQ+CS L HMHS+R+MHRDIKPANVFIT+ G+VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAAL SPFY DKM L+ LC KI+ C+YPPLP   YS++ R LVS CIN +P+ RP+IS++   + +M
Sbjct:    2 FLIEKKIGRGQFSEVYRATCLLNNQKVALKKVQIFEMMDAKARQDCVKEIDLLKQLNHPNVIKYLDSFIANNELNIVLELASAGDLSQMIMHFKKKRRLIPERTIWKYFVQLCSALEHMHSRRVMHRDIKPANVFITASGEVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALHSPFYSDKMNLLSLCHKIEQCEYPPLPTEHYSQKFRDLVSMCINPEPDQRPDISFVLQFSTQM 263          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: nek6 (NIMA-related kinase 6 [Source:ZFIN;Acc:ZDB-GENE-040724-133])

HSP 1 Score: 330.102 bits (845), Expect = 2.344e-112
Identity = 160/267 (59.93%), Postives = 190/267 (71.16%), Query Frame = 3
Query:  129 GSLSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEM 929
             +LS F + K+IG+GQFSEV+RA     N+ VALKKVQI+EMMD KARQDC+KEIDLLKQL+HPNVIK L SF+ NNELNIVLELA AGDLSQMI HF++K +L+PE+TIWKYFVQ+CS L HMHS+R+MHR                                    VGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAAL SPFY DKM L+ LC KI+ C+YPPLP   YS++ R LVS CIN +P+ RP+IS++   + +M
Sbjct:   18 SNLSNFLIEKKIGRGQFSEVYRATCLLNNQKVALKKVQIFEMMDAKARQDCVKEIDLLKQLNHPNVIKYLDSFIANNELNIVLELASAGDLSQMIMHFKKKRRLIPERTIWKYFVQLCSALEHMHSRRVMHR------------------------------------VGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALHSPFYSDKMNLLSLCHKIEQCEYPPLPTEHYSQKFRDLVSMCINPEPDQRPDISFVLQFSTQM 248          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: nek1 (NIMA-related kinase 1 [Source:ZFIN;Acc:ZDB-GENE-040730-1])

HSP 1 Score: 191.815 bits (486), Expect = 5.020e-58
Identity = 101/270 (37.41%), Postives = 160/270 (59.26%), Query Frame = 3
Query:  135 LSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYG---VAKEMHE 935
            + K+  +K+IG+G F +    + +       +K++ I   M  K RQ+  KE+ +L  + HPN+++   SF E+  L IV++  + GDL + I + R    L PE+ I  +FVQIC  L H+H ++I+HRDIK  N+F+T  G V+LGD G+ R  +S+   A++ +GTPYY+SPE    + YN  SDIW+LGC+LYEM  L+  F    M   +L  KI    YPP+  + YS +LR+L++Q   ++P  RP +S +     +A+ +H+
Sbjct:    1 MDKYERLKKIGEGSFGKAILVKSRTDGRQYVIKEIGI-SRMSNKERQESRKEVAVLANMSHPNIVQYKESFEESGCLYIVMDYCEGGDLFKKINNQRG--SLFPEEQILDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDGTVQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENKPYNNKSDIWALGCVLYEMCTLKHAFEAGNMK--NLVLKIIRGSYPPVSIH-YSPDLRSLLAQLFKRNPRERPSVSTILDKPFLARRIHK 264          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: CABZ01040556.1 (NIMA related kinase 3 [Source:NCBI gene;Acc:100536894])

HSP 1 Score: 168.318 bits (425), Expect = 1.962e-47
Identity = 93/259 (35.91%), Postives = 143/259 (55.21%), Query Frame = 3
Query:  135 LSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQI--YEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGD--KMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEI 899
            + +++VV+ IG+G F      +     +   +K++++   E    K+R + +    LL ++ HPN++    SF  +  L IV+E    GDL Q I+   R   L  E+ I K+F Q+C G  H+H KR++HRD+K  N+F+T  G VK+GD G     +S+   AQ+ VGTPYY+SPE    + YN  SD+WSLGC+LYE+  LQ PF     K  ++ +C+      Y PLP++ +  EL  L+      +P  RP I
Sbjct:    1 MDQYSVVRVIGEGSFGRALLVQPIHEEKHYVMKEIRLPKAESGMKKSRSEAV----LLSKMKHPNIVAFRDSFEADGHLYIVMEFCSGGDLMQRIRQQNR--LLFSEEQILKWFAQMCLGTKHIHDKRVLHRDLKSKNIFLTDSGTVKVGDFGSACSLNSAKAYAQTYVGTPYYVSPEIWDNKPYNNKSDVWSLGCVLYELCTLQHPFQARSWKSLILQVCRG----SYAPLPSH-FPYELHYLIKHMFKTNPKDRPSI 248          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: nek7 (NIMA-related kinase 7 [Source:NCBI gene;Acc:780029])

HSP 1 Score: 424.091 bits (1089), Expect = 1.185e-148
Identity = 198/276 (71.74%), Postives = 228/276 (82.61%), Query Frame = 3
Query:  114 PNSPYGSLSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEKT 941
            P+  Y  L+ F + K IG+GQFSEV+RA        VALKKVQI+++MD KAR DCIKEIDLLKQL+HPNVIK  ASF+E+NELNIVLELADAGDLS+MIKHF+++ +L+PEKT+WKYFVQ+CS L HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LCKKI+ CDYPPLP++ YS ELR LV+ CIN DP  RP+++Y+Y VAK MH  T
Sbjct:   15 PDMGYNILANFQIGKMIGRGQFSEVYRATCLLDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPEKTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRMLVNTCINPDPEKRPDVTYVYEVAKRMHALT 290          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: nek7 (NIMA-related kinase 7 [Source:NCBI gene;Acc:780029])

HSP 1 Score: 424.476 bits (1090), Expect = 1.245e-148
Identity = 198/276 (71.74%), Postives = 228/276 (82.61%), Query Frame = 3
Query:  114 PNSPYGSLSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEKT 941
            P+  Y  L+ F + K IG+GQFSEV+RA        VALKKVQI+++MD KAR DCIKEIDLLKQL+HPNVIK  ASF+E+NELNIVLELADAGDLS+MIKHF+++ +L+PEKT+WKYFVQ+CS L HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LCKKI+ CDYPPLP++ YS ELR LV+ CIN DP  RP+++Y+Y VAK MH  T
Sbjct:   25 PDMGYNILANFQIGKMIGRGQFSEVYRATCLLDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPEKTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRMLVNTCINPDPEKRPDVTYVYEVAKRMHALT 300          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: nek7 (NIMA-related kinase 7 [Source:NCBI gene;Acc:780029])

HSP 1 Score: 424.091 bits (1089), Expect = 1.423e-148
Identity = 198/276 (71.74%), Postives = 228/276 (82.61%), Query Frame = 3
Query:  114 PNSPYGSLSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEKT 941
            P+  Y  L+ F + K IG+GQFSEV+RA        VALKKVQI+++MD KAR DCIKEIDLLKQL+HPNVIK  ASF+E+NELNIVLELADAGDLS+MIKHF+++ +L+PEKT+WKYFVQ+CS L HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LCKKI+ CDYPPLP++ YS ELR LV+ CIN DP  RP+++Y+Y VAK MH  T
Sbjct:   14 PDMGYNILANFQIGKMIGRGQFSEVYRATCLLDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPEKTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRMLVNTCINPDPEKRPDVTYVYEVAKRMHALT 289          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: nek7 (NIMA-related kinase 7 [Source:NCBI gene;Acc:780029])

HSP 1 Score: 423.705 bits (1088), Expect = 2.611e-148
Identity = 198/276 (71.74%), Postives = 228/276 (82.61%), Query Frame = 3
Query:  114 PNSPYGSLSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEKT 941
            P+  Y  L+ F + K IG+GQFSEV+RA        VALKKVQI+++MD KAR DCIKEIDLLKQL+HPNVIK  ASF+E+NELNIVLELADAGDLS+MIKHF+++ +L+PEKT+WKYFVQ+CS L HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LCKKI+ CDYPPLP++ YS ELR LV+ CIN DP  RP+++Y+Y VAK MH  T
Sbjct:   24 PDMGYNILANFQIGKMIGRGQFSEVYRATCLLDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPEKTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRMLVNTCINPDPEKRPDVTYVYEVAKRMHALT 299          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: nek7 (NIMA-related kinase 7 [Source:NCBI gene;Acc:780029])

HSP 1 Score: 422.935 bits (1086), Expect = 5.750e-148
Identity = 198/276 (71.74%), Postives = 228/276 (82.61%), Query Frame = 3
Query:  114 PNSPYGSLSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEKT 941
            P+  Y  L+ F + K IG+GQFSEV+RA        VALKKVQI+++MD KAR DCIKEIDLLKQL+HPNVIK  ASF+E+NELNIVLELADAGDLS+MIKHF+++ +L+PEKT+WKYFVQ+CS L HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LCKKI+ CDYPPLP++ YS ELR LV+ CIN DP  RP+++Y+Y VAK MH  T
Sbjct:   25 PDMGYNILANFQIGKMIGRGQFSEVYRATCLLDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPEKTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRMLVNTCINPDPEKRPDVTYVYEVAKRMHALT 300          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Nek7 (NIMA (never in mitosis gene a)-related expressed kinase 7 [Source:MGI Symbol;Acc:MGI:1890645])

HSP 1 Score: 425.631 bits (1093), Expect = 3.019e-149
Identity = 198/276 (71.74%), Postives = 231/276 (83.70%), Query Frame = 3
Query:  114 PNSPYGSLSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEKT 941
            P+  Y +L+ F + K+IG+GQFSEV+RA        VALKKVQI+++MD KAR DCIKEIDLLKQL+HPNVIK  ASF+E+NELNIVLELADAGDLS+MIKHF+++ +L+PE+T+WKYFVQ+CS L+HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LCKKI+ CDYPPLP++ YS ELR LV+ CIN DP  RP+I+Y+Y VAK MH  T
Sbjct:   24 PDMGYNTLANFRIEKKIGRGQFSEVYRASCLLDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALDHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNICINPDPEKRPDIAYVYDVAKRMHACT 299          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Nek7 (NIMA (never in mitosis gene a)-related expressed kinase 7 [Source:MGI Symbol;Acc:MGI:1890645])

HSP 1 Score: 425.631 bits (1093), Expect = 3.019e-149
Identity = 198/276 (71.74%), Postives = 231/276 (83.70%), Query Frame = 3
Query:  114 PNSPYGSLSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEKT 941
            P+  Y +L+ F + K+IG+GQFSEV+RA        VALKKVQI+++MD KAR DCIKEIDLLKQL+HPNVIK  ASF+E+NELNIVLELADAGDLS+MIKHF+++ +L+PE+T+WKYFVQ+CS L+HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LCKKI+ CDYPPLP++ YS ELR LV+ CIN DP  RP+I+Y+Y VAK MH  T
Sbjct:   24 PDMGYNTLANFRIEKKIGRGQFSEVYRASCLLDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALDHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNICINPDPEKRPDIAYVYDVAKRMHACT 299          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Nek6 (NIMA (never in mitosis gene a)-related expressed kinase 6 [Source:MGI Symbol;Acc:MGI:1891638])

HSP 1 Score: 413.305 bits (1061), Expect = 4.367e-144
Identity = 195/279 (69.89%), Postives = 230/279 (82.44%), Query Frame = 3
Query:  102 PQNDPN--SPYGSLSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMH 932
            PQ  PN  S   SL+ F + K+IG+GQFSEV++A      + VALKKVQI+EMMD KARQDC+KEI LLKQL+HPN+IK L SF+E+NELNIVLELADAGDLSQMIK+F+++ +L+PE+T+WKYFVQ+CS + HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LC+KI+ CDYPPLP   YS +LR LVS CI  DP+ RP+I Y++ VA++MH
Sbjct:   29 PQRLPNTLSFRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGIVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCIYPDPDHRPDIVYVHQVARQMH 307          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Nek6 (NIMA (never in mitosis gene a)-related expressed kinase 6 [Source:MGI Symbol;Acc:MGI:1891638])

HSP 1 Score: 413.305 bits (1061), Expect = 4.367e-144
Identity = 195/279 (69.89%), Postives = 230/279 (82.44%), Query Frame = 3
Query:  102 PQNDPN--SPYGSLSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMH 932
            PQ  PN  S   SL+ F + K+IG+GQFSEV++A      + VALKKVQI+EMMD KARQDC+KEI LLKQL+HPN+IK L SF+E+NELNIVLELADAGDLSQMIK+F+++ +L+PE+T+WKYFVQ+CS + HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LC+KI+ CDYPPLP   YS +LR LVS CI  DP+ RP+I Y++ VA++MH
Sbjct:   29 PQRLPNTLSFRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGIVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCIYPDPDHRPDIVYVHQVARQMH 307          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Nek6 (NIMA (never in mitosis gene a)-related expressed kinase 6 [Source:MGI Symbol;Acc:MGI:1891638])

HSP 1 Score: 409.068 bits (1050), Expect = 1.077e-142
Identity = 188/265 (70.94%), Postives = 223/265 (84.15%), Query Frame = 3
Query:  138 SKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMH 932
            + F + K+IG+GQFSEV++A      + VALKKVQI+EMMD KARQDC+KEI LLKQL+HPN+IK L SF+E+NELNIVLELADAGDLSQMIK+F+++ +L+PE+T+WKYFVQ+CS + HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LC+KI+ CDYPPLP   YS +LR LVS CI  DP+ RP+I Y++ VA++MH
Sbjct:   32 TDFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGIVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCIYPDPDHRPDIVYVHQVARQMH 296          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9ES74|NEK7_MOUSE (Serine/threonine-protein kinase Nek7 OS=Mus musculus OX=10090 GN=Nek7 PE=1 SV=1)

HSP 1 Score: 425.631 bits (1093), Expect = 2.112e-148
Identity = 198/276 (71.74%), Postives = 231/276 (83.70%), Query Frame = 3
Query:  114 PNSPYGSLSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEKT 941
            P+  Y +L+ F + K+IG+GQFSEV+RA        VALKKVQI+++MD KAR DCIKEIDLLKQL+HPNVIK  ASF+E+NELNIVLELADAGDLS+MIKHF+++ +L+PE+T+WKYFVQ+CS L+HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LCKKI+ CDYPPLP++ YS ELR LV+ CIN DP  RP+I+Y+Y VAK MH  T
Sbjct:   24 PDMGYNTLANFRIEKKIGRGQFSEVYRASCLLDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALDHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNICINPDPEKRPDIAYVYDVAKRMHACT 299          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8TDX7|NEK7_HUMAN (Serine/threonine-protein kinase Nek7 OS=Homo sapiens OX=9606 GN=NEK7 PE=1 SV=1)

HSP 1 Score: 425.631 bits (1093), Expect = 2.806e-148
Identity = 197/276 (71.38%), Postives = 230/276 (83.33%), Query Frame = 3
Query:  114 PNSPYGSLSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEKT 941
            P+  Y +L+ F + K+IG+GQFSEV+RA        VALKKVQI+++MD KAR DCIKEIDLLKQL+HPNVIK  ASF+E+NELNIVLELADAGDLS+MIKHF+++ +L+PE+T+WKYFVQ+CS L HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LCKKI+ CDYPPLP++ YS ELR LV+ CIN DP  RP+++Y+Y VAK MH  T
Sbjct:   24 PDMGYNTLANFRIEKKIGRGQFSEVYRAACLLDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNMCINPDPEKRPDVTYVYDVAKRMHACT 299          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|D3ZBE5|NEK7_RAT (Serine/threonine-protein kinase Nek7 OS=Rattus norvegicus OX=10116 GN=Nek7 PE=2 SV=1)

HSP 1 Score: 425.246 bits (1092), Expect = 3.062e-148
Identity = 198/276 (71.74%), Postives = 231/276 (83.70%), Query Frame = 3
Query:  114 PNSPYGSLSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEKT 941
            P+  Y +L+ F + K+IG+GQFSEV+RA        VALKKVQI+++MD KAR DCIKEIDLLKQL+HPNVIK  ASF+E+NELNIVLELADAGDLS+MIKHF+++ +L+PE+T+WKYFVQ+CS L+HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LCKKI+ CDYPPLP++ YS ELR LV+ CIN DP  RP+I+Y+Y VAK MH  T
Sbjct:   24 PDMGYNTLANFRIEKKIGRGQFSEVYRASCLLDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALDHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNICINPDPEKRPDIAYVYDVAKRMHACT 299          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|P59895|NEK6_RAT (Serine/threonine-protein kinase Nek6 OS=Rattus norvegicus OX=10116 GN=Nek6 PE=1 SV=1)

HSP 1 Score: 417.157 bits (1071), Expect = 6.752e-145
Identity = 197/279 (70.61%), Postives = 230/279 (82.44%), Query Frame = 3
Query:  102 PQNDPN--SPYGSLSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMH 932
            PQ  PN  S   SL+ F + K+IG+GQFSEV++A      + VALKKVQI+EMMD KARQDC+KEI LLKQL+HPN+IK L SF+E+NELNIVLELADAGDLSQMIK+F+++ +L+PE+T+WKYFVQ+CS + HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LC+KI+ CDYPPLP   YS +LR LVS CI  DPN RP+I Y++ VAK+MH
Sbjct:   29 PQRHPNTLSFRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGIVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCIYPDPNHRPDIEYVHQVAKQMH 307          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|A2BD05|NEK6_PIG (Serine/threonine-protein kinase Nek6 OS=Sus scrofa OX=9823 GN=NEK6 PE=3 SV=1)

HSP 1 Score: 416.387 bits (1069), Expect = 1.435e-144
Identity = 196/279 (70.25%), Postives = 230/279 (82.44%), Query Frame = 3
Query:  102 PQNDPN--SPYGSLSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMH 932
            PQ  PN  S   SL+ F + K+IG+GQFSEV++A      + VALKKVQI+EMMD KARQDC+KEI LLKQL+HPN+IK L SF+E+NELNIVLELADAGDLSQMIK+F+++ +L+PE+T+WKYFVQ+CS + HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LC+KI+ CDYPPLP   YS +LR LVS CI  DPN RP+I Y++ VA++MH
Sbjct:   29 PQRHPNALSFRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGIVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCIYPDPNQRPDIGYVHQVARQMH 307          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A1I8GQY4 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 467.233 bits (1201), Expect = 9.920e-161
Identity = 218/286 (76.22%), Postives = 247/286 (86.36%), Query Frame = 3
Query:   81 MSNNIIVPQNDPNSPYGSLSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEK 938
            M  + +VP +DP + YGSL+KF + K+IGKGQFSEVWRA  +    +VALKKVQI+EMMD KARQDCIKEIDLLKQLDHPNVI+ LASF+ENNELNIVLELADAGDLS+MIKHF+++ +L+PEKTIWKYFVQICSGL+HMHSKRIMHRDIKPANVFIT+ GQVKLGDLGLGRFFSS T +A SLVGTPYYMSPERIHE  YN  SD+WSLGCLLYEMAALQSPFYGDKM L  LCKKI+ CDYPPLPA+IYS ELR LVS  I   P++RP+ISY+Y VA+ MH K
Sbjct:  108 MDADFVVPNHDPENKYGSLAKFKIDKKIGKGQFSEVWRAICREDECVVALKKVQIFEMMDAKARQDCIKEIDLLKQLDHPNVIRYLASFIENNELNIVLELADAGDLSRMIKHFKKQQRLIPEKTIWKYFVQICSGLDHMHSKRIMHRDIKPANVFITASGQVKLGDLGLGRFFSSKTTNAHSLVGTPYYMSPERIHENGYNFKSDLWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPADIYSSELRDLVSAMIQPSPDARPDISYVYEVAQRMHAK 393          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A267EEI4 (Protein kinase domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig024690g2 PE=3 SV=1)

HSP 1 Score: 457.218 bits (1175), Expect = 1.610e-158
Identity = 212/280 (75.71%), Postives = 245/280 (87.50%), Query Frame = 3
Query:   99 VPQNDPNSPYGSLSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEK 938
            VP  DP + YGSL KFN+ K+IGKGQFSEVWRA  K    ++ALKKVQI+EMMD KARQDCIKEIDLLKQLDHPNVI+ LASF+ENNELNIVLELADAGDLS+MI+HF+++ +L+PE+TIWKYFVQICSGL+HMHSKRIMHRDIKPANVFIT+ GQVKLGDLGLGRFFSS T +A SLVGTPYYMSPERIHE  YN  SD+WSLGCLLYEMAALQSPFYG++M L  LCKKI+ CDYPPLPA+IYS ELR LV   I+ +P++RP+IS++Y VA++MH K
Sbjct:    2 VPSYDPQNKYGSLDKFNIDKKIGKGQFSEVWRAICKEDGCVIALKKVQIFEMMDAKARQDCIKEIDLLKQLDHPNVIRYLASFIENNELNIVLELADAGDLSRMIRHFKKQQRLIPERTIWKYFVQICSGLDHMHSKRIMHRDIKPANVFITATGQVKLGDLGLGRFFSSKTTNAHSLVGTPYYMSPERIHETGYNFKSDMWSLGCLLYEMAALQSPFYGEQMNLYSLCKKIEQCDYPPLPADIYSNELRELVVTMISSNPDARPDISHVYQVAQDMHAK 281          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A267DU22 (Protein kinase domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032178g2 PE=3 SV=1)

HSP 1 Score: 456.833 bits (1174), Expect = 2.140e-158
Identity = 212/280 (75.71%), Postives = 245/280 (87.50%), Query Frame = 3
Query:   99 VPQNDPNSPYGSLSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEK 938
            VP  DP + YGSL KFN+ K+IGKGQFSEVWRA  K    ++ALKKVQI+EMMD KARQDCIKEIDLLKQLDHPNVI+ LASF+ENNELNIVLELADAGDLS+MI+HF+++ +L+PE+TIWKYFVQICSGL+HMHSKRIMHRDIKPANVFIT+ GQVKLGDLGLGRFFSS T +A SLVGTPYYMSPERIHE  YN  SD+WSLGCLLYEMAALQSPFYG++M L  LCKKI+ CDYPPLPA+IYS ELR LV   I+ +P++RP+IS++Y VA++MH K
Sbjct:    2 VPSYDPQNKYGSLDKFNIDKKIGKGQFSEVWRAICKEDGCVIALKKVQIFEMMDAKARQDCIKEIDLLKQLDHPNVIRYLASFIENNELNIVLELADAGDLSRMIRHFKKQQRLIPERTIWKYFVQICSGLDHMHSKRIMHRDIKPANVFITATGQVKLGDLGLGRFFSSKTTNAHSLVGTPYYMSPERIHETGYNFKSDMWSLGCLLYEMAALQSPFYGEQMNLYSLCKKIEQCDYPPLPADIYSNELRELVVTMISSNPDARPDISHVYQVAQDMHAK 281          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A1S3JQM7 (serine/threonine-protein kinase Nek7 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106175288 PE=3 SV=1)

HSP 1 Score: 455.292 bits (1170), Expect = 1.563e-157
Identity = 213/284 (75.00%), Postives = 241/284 (84.86%), Query Frame = 3
Query:   81 MSNNIIVPQNDPNSPYGSLSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMH 932
            M  ++ VP NDPN+ Y +LS F + K+IGKGQFSEVWRA  K     +ALKKVQI+EMMD KARQDCIKEIDLLKQL+HPNVIK LASF+E+NELNIVLELADAGDLS+MIKHF+++ +L+PE+TIWKYF+QICS L HMHSKRIMHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LCKKI+ CDYPPLP++ YS ELR LV+ CIN DP  RP+I+Y+Y VAK+MH
Sbjct:    4 MECDLPVPTNDPNNMYCTLSSFEIDKKIGKGQFSEVWRARCKTDGSAIALKKVQIFEMMDAKARQDCIKEIDLLKQLNHPNVIKYLASFIEDNELNIVLELADAGDLSRMIKHFKKQDRLIPERTIWKYFIQICSSLEHMHSKRIMHRDIKPANVFITAQGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRNLVAVCINPDPEQRPDITYIYEVAKKMH 287          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A1I8ICQ9 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 460.299 bits (1183), Expect = 1.719e-157
Identity = 218/300 (72.67%), Postives = 248/300 (82.67%), Query Frame = 3
Query:   81 MSNNIIVPQNDPNSPYGSLSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEKTRVDSAGGSRTSSR 980
            M  + +VP +DP + YGSL+KF + K+IGKGQFSEVWRA  +    +VALKKVQI+EMMD KARQDCIKEIDLLKQLDHPNVI+ LASF+ENNELNIVLELADAGDLS+MIKHF+++ +L+PEKTIWKYFVQICSGL+HMHSKRIMHRDIKPANVFIT+ GQVKLGDLGLGRFFSS T +A SLVGTPYYMSPERIHE  YN  SD+WSLGCLLYEMAALQSPFYGDKM L  LCKKI+ CDYPPLPA+IYS ELR LVS  I   P++RP+ISY+Y VA      T     G +  S +
Sbjct:  108 MDADFVVPNHDPENKYGSLAKFKIDKKIGKGQFSEVWRAICREDECVVALKKVQIFEMMDAKARQDCIKEIDLLKQLDHPNVIRYLASFIENNELNIVLELADAGDLSRMIKHFKKQQRLIPEKTIWKYFVQICSGLDHMHSKRIMHRDIKPANVFITASGQVKLGDLGLGRFFSSKTTNAHSLVGTPYYMSPERIHENGYNFKSDLWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPADIYSSELRDLVSAMIQPSPDARPDISYVYEVASGCTPSTASSREGHACQSPK 407          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: nek7 (NIMA related kinase 7 [Source:NCBI gene;Acc:103046491])

HSP 1 Score: 432.18 bits (1110), Expect = 8.956e-152
Identity = 199/272 (73.16%), Postives = 228/272 (83.82%), Query Frame = 3
Query:  126 YGSLSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEKT 941
            Y +LS F + K+IG+GQFSEV+RA     N  VALKK+QI+++MD KARQDCIKEIDLLKQL+HPNVIK  ASF+E NELNIVLELADAGDLS+MIKHF+++ +L+PEKT+WKYFVQ+CS L HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LCKKI+ CDYPPLP++ YS ELR LV  CIN DP  RP+I+Y+Y +AK MH  T
Sbjct:   34 YSTLSNFQIEKKIGRGQFSEVYRARYLINNTAVALKKIQIFDLMDAKARQDCIKEIDLLKQLNHPNVIKYHASFIEENELNIVLELADAGDLSRMIKHFKKQRRLIPEKTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRKLVDMCINPDPERRPDIAYVYNIAKHMHALT 305          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: nek6 (NIMA-related kinase 6 [Source:ZFIN;Acc:ZDB-GENE-040724-133])

HSP 1 Score: 407.142 bits (1045), Expect = 4.563e-142
Identity = 188/267 (70.41%), Postives = 223/267 (83.52%), Query Frame = 3
Query:  129 GSLSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEM 929
             +LS F + K+IG+GQFSEV+RA     N+ VALKKVQI+EMMD K+RQDCIKEIDLLKQL+HPNVIK L SF+E+NELNIVLELADAGDLS MIK+F++K +L+PE+TIWKYFVQ+CS + HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T    SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFY D+M L+ LC+KI+ CDYPPLP   +S +LR+LVS CIN D + RP+I ++   +K+M
Sbjct:   26 SALSNFRIEKKIGRGQFSEVYRATYLLENQQVALKKVQIFEMMDAKSRQDCIKEIDLLKQLNHPNVIKYLDSFIEDNELNIVLELADAGDLSHMIKYFKKKRRLIPERTIWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTVVHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYSDQMNLLSLCQKIEQCDYPPLPPEHFSEKLRSLVSMCINPDADERPDIVFVLQFSKQM 292          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: nek7 (NIMA related kinase 7 [Source:NCBI gene;Acc:103046491])

HSP 1 Score: 383.259 bits (983), Expect = 8.263e-133
Identity = 182/272 (66.91%), Postives = 208/272 (76.47%), Query Frame = 3
Query:  126 YGSLSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEKT 941
            Y +LS F + K+IG+GQFSEV+RA     N  VALKK+Q                     QL+HPNVIK  ASF+E NELNIVLELADAGDLS+MIKHF+++ +L+PEKT+WKYFVQ+CS L HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LCKKI+ CDYPPLP++ YS ELR LV  CIN DP  RP+I+Y+Y +AK MH  T
Sbjct:   34 YSTLSNFQIEKKIGRGQFSEVYRARYLINNTAVALKKIQ---------------------QLNHPNVIKYHASFIEENELNIVLELADAGDLSRMIKHFKKQRRLIPEKTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRKLVDMCINPDPERRPDIAYVYNIAKHMHALT 284          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: nek6 (NIMA-related kinase 6 [Source:ZFIN;Acc:ZDB-GENE-040724-133])

HSP 1 Score: 338.191 bits (866), Expect = 1.106e-115
Identity = 167/284 (58.80%), Postives = 203/284 (71.48%), Query Frame = 3
Query:   81 MSNNIIVPQNDPNSPYGSLSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMH 932
            M+NN + PQ  P S +  LS F + K+IG+GQFSEV+RA     N+ VALKKVQI+EMMD K+RQDCIKEIDLLKQL+HPNVIK L SF+E+NELNIVLELADAGDLS MIK+F++K +L+PE+TIWKYFVQ+CS + HMHS+R+MHR                                    VGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFY D+M L+ LC+KI+ CDYPPLP   +S +LR+LVS CIN D + RP+I ++   +K+M 
Sbjct:    1 MANNCVEPQK-PFSLFA-LSNFRIEKKIGRGQFSEVYRATYLLENQQVALKKVQIFEMMDAKSRQDCIKEIDLLKQLNHPNVIKYLDSFIEDNELNIVLELADAGDLSHMIKYFKKKRRLIPERTIWKYFVQLCSAVEHMHSRRVMHR------------------------------------VGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYSDQMNLLSLCQKIEQCDYPPLPPEHFSEKLRSLVSMCINPDADERPDIVFVLQFSKQMQ 246          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: nek6 (NIMA-related kinase 6 [Source:ZFIN;Acc:ZDB-GENE-040724-133])

HSP 1 Score: 332.028 bits (850), Expect = 6.510e-113
Identity = 167/270 (61.85%), Postives = 195/270 (72.22%), Query Frame = 3
Query:  129 GSLSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMP--EKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMH 932
             +LS F + K+IG+GQFSEV+RA     N+ VALKKVQI+EMMD K+RQDCIKEIDLLKQL+HPNVIK L SF+E+NELNIVLELADAGDLS MIK        +P  + T+W                      IKPANVFIT+ G VKLGDLGLGRFFSS T    SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFY D+M L+ LC+KI+ CDYPPLP   +S +LR+LVS CIN D + RP+I ++   +K+M 
Sbjct:   25 SALSNFRIEKKIGRGQFSEVYRATYLLENQQVALKKVQIFEMMDAKSRQDCIKEIDLLKQLNHPNVIKYLDSFIEDNELNIVLELADAGDLSHMIK--------LPSVQTTVWH---------------------IKPANVFITATGVVKLGDLGLGRFFSSKTTVVHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYSDQMNLLSLCQKIEQCDYPPLPPEHFSEKLRSLVSMCINPDADERPDIVFVLQFSKQMQ 265          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007414.1 (pep scaffold:Pmarinus_7.0:GL476981:230882:244405:1 gene:ENSPMAG00000006689.1 transcript:ENSPMAT00000007414.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 187.963 bits (476), Expect = 1.090e-56
Identity = 96/258 (37.21%), Postives = 152/258 (58.91%), Query Frame = 3
Query:  135 LSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYM 908
            + ++ +V +IG+G F +    + KA   +  +K++ I  M   K R +  KE+ +L  + HPN++    SF E   L IV++  + GDL + I    +K  L  E  I  + VQ+C  L H+H ++I+HRDIK  N+F+T  G V+LGD G+ R  +S+T  A++ +GTPYY+SPE    + YN  SD+W+LGC+LYEM  L+  F    M   +L  KI    +PP+ A+ YS ELR+ +S  + +DP +RP ++ +
Sbjct:    1 MERYTMVSQIGEGSFGKAMLVKSKADGHLYVIKEINISRM-SPKERDEARKEVCVLANMRHPNIVSYKESFEERGNLYIVMDYCEGGDLFKRINA--QKGVLFSEDQILDWLVQLCLALKHVHDRKILHRDIKSQNIFLTKAGIVQLGDFGIARVLNSTTELARTCIGTPYYLSPEICENKPYNHKSDMWALGCVLYEMCTLRHAFEAGNMK--NLVLKIIRGSFPPVSAH-YSSELRSTLSGLLRRDPRARPPVAVL 252          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: nek2 (NIMA-related kinase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-752])

HSP 1 Score: 171.014 bits (432), Expect = 3.990e-49
Identity = 99/277 (35.74%), Postives = 153/277 (55.23%), Query Frame = 3
Query:  234 KVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVE--NNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMH-----SKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYM--YGVAKEMHEKTRVDSAG----GSRTSSRQTSAGSTHSK*SIIS 1025
            KV  Y  M    +Q  + E++LL++L HPN+++     ++  N  L IV+E  + GDL+ +I   RR  + + E+ + +   Q+   L   H      + ++HRD+KPANVF+ +   VKLGD GL R     T+ A++ VGTPYYMSPE+    +YN  SDIWSLGCLLYE+ AL  PF    M    L +KIK   +  +P   YS EL  ++S+ +N     RP I  +  YG+  E+ ++ +  +A     G  T+ R+ S GS  ++  +++
Sbjct:    6 KVLDYGTMSEPEKQMLVSEVNLLRELKHPNIVRYFDRIIDRSNTTLYIVMEYCECGDLASLISRCRRDRRFLEEEFVLRVLAQLVLALRECHRRTAGGRTVLHRDLKPANVFLDARHNVKLGDFGLARILQHDTSFAKTFVGTPYYMSPEQFSRMSYNEKSDIWSLGCLLYELCALVPPFTA--MNQKQLAEKIKEGKFRRIPYR-YSDELNEIISKMLNLKDYLRPSIEQIMQYGLLAEVLDEEQARAAPEKPRGVPTTERR-SGGSPSAEEGLVA 278          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: NEK9 (NIMA related kinase 9 [Source:HGNC Symbol;Acc:HGNC:18591])

HSP 1 Score: 164.466 bits (415), Expect = 6.412e-45
Identity = 92/254 (36.22%), Postives = 139/254 (54.72%), Query Frame = 3
Query:  153 VKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLC-------KKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRP 893
            V+ +G+G F E         N +V  K++ +  + D K R+D   EID+L  L+H N+I     F++ N L I LE  + G L + I   ++     PEK I  YF Q+ S +  +H+ +I+HRDIK  N+F+T    +K+GD G+ +   S +  A+S VGTPYYMSPE I    YN  SDIW++GC+LYE+  L   F  D    + LC       K+++I D        YS+E++ +V +C+ +D   RP
Sbjct:   39 VRVLGRGAFGEAALYRRNEDNSLVVWKEIDLTRLSD-KERRDSQNEIDILSLLEHANIISYYNHFLDGNVLLIELEYCNGGTLYEKI--IKQHGAFFPEKDIVWYFYQLVSAVEQIHNFKILHRDIKTLNIFLTKSDLIKVGDFGISKILDSRSQMAESYVGTPYYMSPELIRGDKYNTKSDIWAMGCVLYELLTLTRTF--DATNPLKLCYEIIHGKKQVEIDDQ-------YSKEIKEVVQKCLQQDAEQRP 280          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: STK36 (serine/threonine kinase 36 [Source:HGNC Symbol;Acc:HGNC:17209])

HSP 1 Score: 156.762 bits (395), Expect = 5.360e-42
Identity = 90/253 (35.57%), Postives = 148/253 (58.50%), Query Frame = 3
Query:  135 LSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKM-TLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSR 890
            + K++V++ IG+G F +V++   + T ++VALK +      D + R +  +EID+++ L HPN+++ L SF  + E+ +V + A+ G+L Q+++        +PE+ + +   Q+ S L ++HS RI+HRD+KP N+ +   G VKL D G  R  S +T    S+ GTP YMSPE + E+ Y+ T+D+WS+GC+LYE+     PFY + +  LV L  K    D    P N+ S E R  +   + K+P  R
Sbjct:    1 MEKYHVLEMIGEGSFGKVYKGRKRYTGQVVALKFIPKVGRSDKELR-NLRREIDIMRGLQHPNIVQMLDSFETDKEVVVVTDYAE-GELFQILEDDGN----LPEEQVREIACQLVSALYYLHSHRILHRDMKPQNILLGKGGVVKLCDFGFARAMSINTLVLTSIKGTPLYMSPELVEEKPYDHTADLWSMGCILYELFVGTPPFYTNSIFQLVSLIIK----DPVKWPKNM-SSEFRNFLQGLLTKEPKLR 242          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000555.1 (pep scaffold:Pmarinus_7.0:GL477093:35206:42652:1 gene:ENSPMAG00000000500.1 transcript:ENSPMAT00000000555.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 130.183 bits (326), Expect = 1.570e-36
Identity = 63/159 (39.62%), Postives = 100/159 (62.89%), Query Frame = 3
Query:  435 QLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGD---KMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEIS 902
            Q++ +  + ++FVQ+C  + ++HS +I+HRDIK +NVF+T  G VK+GD G+ +    + + A + VGTPYY+SPE   +  Y+  SD+W+LGCLLYE+ AL+  F      ++T   L  KI   +  PL  + YSR++R LV+  +++ P  RP  S
Sbjct:    3 QIITKTNVMQWFVQVCMAVQYIHSVKILHRDIKTSNVFLTKAGTVKVGDFGISKAMEGTLDMAVTCVGTPYYLSPEMCQDLPYSSKSDVWALGCLLYELCALRPAFEASNIIRLTRRSLFYKIMRGEPDPLDES-YSRDVRALVALLLSRSPEDRPSAS 160          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: KIN3 (Nonessential serine/threonine protein kinase; possible role in DNA damage response; influences tolerance to high levels of ethanol [Source:SGD;Acc:S000000071])

HSP 1 Score: 149.443 bits (376), Expect = 2.985e-41
Identity = 102/328 (31.10%), Postives = 154/328 (46.95%), Query Frame = 3
Query:  102 PQNDPNSPYGSLSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLA-SFVENNE-LNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMH---------------------SKRIMHRDIKPANVFIT-------------------------------------SYGQ--VKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIK--ICDYPPLPANIYSRELRTLVSQCINKDPNSRP 893
            PQ     P    S++ V++ IG+G F  V +     T +++  K ++ Y  M++K RQ  I E  +L QL H N+++     F E  E L + +E    GDLSQMIKH++++++ +PEK +W    Q+ + L   H                        ++HRD+KP N+F++                                      Y Q  VKLGD GL +   +S   A + VGTPYYMSPE + +Q Y+  SDIWSLGC+++EM +L  PF       ++L  KIK   CD  P     YSR L  ++   I+ +  +RP
Sbjct:   13 PQQQQGHP--PRSEYQVLEEIGRGSFGSVRKVIHIPTKKLLVRKDIK-YGHMNSKERQQLIAECSILSQLKHENIVEFYNWDFDEQKEVLYLYMEYCSRGDLSQMIKHYKQEHKYIPEKIVWGILAQLLTALYKCHYGVELPTLTTIYDRMKPPVKGKNIVIHRDLKPGNIFLSYDDSDYNINEQVDGHEEVNSNYYRDHRVNSGKRGSPMDYSQVVVKLGDFGLAKSLETSIQFATTYVGTPYYMSPEVLMDQPYSPLSDIWSLGCVIFEMCSLHPPFQAK--NYLELQTKIKNGKCDTVP---EYYSRGLNAIIHSMIDVNLRTRP 332          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: STE7 (Signal transducing MAP kinase kinase; involved in pheromone response where it phosphorylates Fus3p; involved in the pseudohyphal/invasive growth pathway where it phosphorylates of Kss1p; phosphorylated by Ste11p; degraded by ubiquitin pathway [Source:SGD;Acc:S000002318])

HSP 1 Score: 131.724 bits (330), Expect = 2.613e-34
Identity = 90/279 (32.26%), Postives = 147/279 (52.69%), Query Frame = 3
Query:  117 NSPYGSLSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLD-HPNVIKCLASFVE---NNELNIVLELADAGDLSQMIKHFRR---------KYQLMPEKTIWKYFVQICSGLNHMHSK-RIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMT---LVDLCKKIKICDYPPLPAN-IYSRELRTLVSQCINKDPNSRPEI 899
            N  Y  L     + +IG G    V +A     ++IVA K + + +   T   Q  ++E+ ++K +  H N+I    ++     NNE+ I++E +D G L +++  ++R         K     E TI K    + +GL+H++ + +I+HRDIKP+NV I S GQ+KL D G+ +   +S   A + VGT  YMSPERI    Y++  D+WSLG ++ E+   + P  G   T   ++DL ++I     P LP + IYS+E+   V++C  K+   R  I
Sbjct:  182 NGNYIQLQDLVQLGKIGAGNSGTVVKALHVPDSKIVAKKTIPVEQNNSTIINQ-LVRELSIVKNVKPHENIITFYGAYYNQHINNEIIILMEYSDCGSLDKILSVYKRFVQRGTVSSKKTWFNELTISKIAYGVLNGLDHLYRQYKIIHRDIKPSNVLINSKGQIKLCDFGVSKKLINSI--ADTFVGTSTYMSPERIQGNVYSIKGDVWSLGLMIIELVTGEFPLGGHNDTPDGILDLLQRIVNEPSPRLPKDRIYSKEMTDFVNRCCIKNERERSSI 457          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: CDC5 (Polo-like kinase; controls targeting and activation of Rho1p at cell division site via Rho1p guanine nucleotide exchange factors; regulates Spc72p; also functions in adaptation to DNA damage during meiosis; regulates the shape of the nucleus and expansion of the nuclear envelope during mitosis; similar to Xenopus Plx1 and S. pombe Plo1p; human homologs PLK1, PLK3 can each complement yeast cdc5 thermosensitive mutants [Source:SGD;Acc:S000004603])

HSP 1 Score: 129.028 bits (323), Expect = 6.372e-33
Identity = 73/249 (29.32%), Postives = 133/249 (53.41%), Query Frame = 3
Query:  162 IGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERI--HEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEIS 902
            +G+G F+  ++ +   + EI A K V    +   K R+  + EI + K + HPN+++ +  F +++ + I+LE+   G L +++K  RRK    PE  +  +  QIC  + +MHS+R++HRD+K  N+F  S   +K+GD GL    ++ +    ++ GTP Y++PE +      ++   DIWSLG +LY +   + PF    +  +   ++IK  D+        S E + L+   ++ DP  RP ++
Sbjct:   88 LGEGGFARCFQIK-DDSGEIFAAKTVAKASIKSEKTRKKLLSEIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLK--RRKVLTEPE--VRFFTTQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNYIAPEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTI--YERIKCRDFSFPRDKPISDEGKILIRDILSLDPIERPSLT 329          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: TPK3 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk2p; localizes to P-bodies during stationary phase; TPK3 has a paralog, TPK1, that arose from the whole genome duplication [Source:SGD;Acc:S000001649])

HSP 1 Score: 124.02 bits (310), Expect = 3.194e-32
Identity = 63/208 (30.29%), Postives = 110/208 (52.88%), Query Frame = 3
Query:  132 SLSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFY 755
            SLS F +++ +G G F  V            ALK ++ + ++  K  +    E  +L  + HP +I+   +F ++ ++ +V++  + G+L  ++    RK Q  P      Y  ++C  L ++HSK I++RD+KP N+ +   G +K+ D G  ++    T    +L GTP Y++PE +  + YN + D WS G L+YEM A  +PFY
Sbjct:   84 SLSDFQILRTLGTGSFGRVHLIRSNHNGRFYALKTLKKHTIVKLKQVEHTNDERRMLSIVSHPFIIRMWGTFQDSQQVFMVMDYIEGGELFSLL----RKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVT---YTLCGTPDYIAPEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPFY 284          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: SPS1 (Putative protein serine/threonine kinase; localizes to the nucleus and cytoplasm; required for efficient spore packaging, prospore membrane development and closure and localization of enzymes involved in spore wall synthesis; interacts with and required for Ssp1p phosphorylation and turnover; member of the GCKIII subfamily of STE20 kinases; multiply phosphorylated on S/T residues; interacts with 14-3-3 proteins, Bmh1p and Bmh2p; expressed at the end of meiosis [Source:SGD;Acc:S000002931])

HSP 1 Score: 124.79 bits (312), Expect = 5.338e-32
Identity = 82/248 (33.06%), Postives = 126/248 (50.81%), Query Frame = 3
Query:  162 IGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERI--HEQNYNLTSDIWSLGCLLYEMAALQSPF--YGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRP 893
            IG+G F +V++A  + T EIVA+K V + E  D    +   +EI  L +L  P +   +A+ +E+  + IV+E    G  S ++K  R     +PE+ +     ++  GL ++H +R +HRDIK AN+ +   G VKLGD G+      ST    + VGTPY+M+PE +      YN  +DIWSLG   YE+     P   Y     + +L K+      PP     +S   +  V+ C+ K P  RP
Sbjct:   24 IGRGNFGDVYKAVDRVTQEIVAIKVVNL-EHSDEDI-ELLAQEIFFLAELKSPLITNYIATMLEDVSMWIVMEYCGGGSCSDLLK--RSYVNGLPEEKVSFIIHEVTLGLKYLHEQRKIHRDIKAANILLNEEGMVKLGDFGVSGHI-RSTLKRDTFVGTPYWMAPEVVCCEVDGYNEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKR-----KPPKLQGPFSDAAKDFVAGCLVKTPADRP 261          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO34646 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNS0])

HSP 1 Score: 418.698 bits (1075), Expect = 3.017e-147
Identity = 195/275 (70.91%), Postives = 229/275 (83.27%), Query Frame = 3
Query:  108 NDPNSPYGSLSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMH 932
            +D  + Y  L  F + K+IG+GQFS V++A   A N+IVALKK+QI++MMD KARQDCIKEIDLLKQL+HPNVIK  ASF+ENNELNIVLELADAGDLS+MIKHF+++ +L+PE+T+WKYFVQ+ + L HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERI E  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LCKKI+ CDYPPLPA  YS++LR LVS CIN  P+ RP+I+Y+  +A EMH
Sbjct:    9 DDEYAVYNCLGNFEIEKKIGRGQFSVVYKARCTANNQIVALKKIQIFDMMDAKARQDCIKEIDLLKQLNHPNVIKYYASFIENNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLTAALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIKENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPAEHYSQQLRHLVSLCINPIPDQRPDITYINEIANEMH 283          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO49822 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG20])

HSP 1 Score: 193.741 bits (491), Expect = 2.426e-59
Identity = 98/256 (38.28%), Postives = 153/256 (59.77%), Query Frame = 3
Query:  135 LSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEIS 902
            + ++  VK+IG+G F +    + +   +   +K++ I  M   + R++  KE+ +L QL HPN++    SF E+  L IV++  D GDL + I   R       E  +  +FVQIC GL H+H ++I+HRDIK  N+F+T +G +K+GD G+ R   S+   A++ +GTPYY+SPE +  + YN  SDIWSLGC+LYEM  L+  F    M   +L  KI    YPP+P   YS ++R LV+Q + ++P+ RP ++
Sbjct:    1 MERYVRVKKIGEGSFGKALLVKKRNDGKHYVIKEINICRM-KPREREESRKEVKVLSQLKHPNIVSYQESFEESGNLYIVMDYCDGGDLYKKINGQRG--IAFSEDQVMDWFVQICLGLKHVHDRKILHRDIKSQNIFLTRHGIIKMGDFGIARVLHSTVELARTCIGTPYYLSPEIVENRPYNNKSDIWSLGCVLYEMLTLKHAFEAGNMK--NLVLKIIRGSYPPIPLR-YSADIRMLVAQLLKRNPHDRPSVN 250          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO37413 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFU9])

HSP 1 Score: 185.652 bits (470), Expect = 4.282e-56
Identity = 95/265 (35.85%), Postives = 158/265 (59.62%), Query Frame = 3
Query:  123 PYGSLSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVE--NNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKR----IMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEI 899
            P G L  +  ++RIG G +    +   K  N+++  K++   +M +T+ +Q  + E++LL++L HP++++     ++  N  + IV+E  + GDL  +IK  +R+ +   E  +WK   Q+   +   H ++    ++HRD+KPANVF+ +   VKLGD GL R  S  T+ A++ VGTPYYMSPE++++++YN  SDIWSLGCL+YE+ AL  PF    M  + L  KIK+  + P+P++ YS  L  L++  +  +   RP I
Sbjct:    2 PSGRLHDYEELERIGSGSYGICKKIRRKKDNKVLVWKELDYGQMSETE-KQMLVSEVNLLRELKHPHIVRYYDRIIDRTNTTIYIVMEFCENGDLGALIKKHKREKRYTAEDLVWKLLYQLVLAVQECHRRKDGGHVLHRDLKPANVFLDANMNVKLGDFGLARVLSHDTSFAKTFVGTPYYMSPEQVNKRSYNEKSDIWSLGCLMYELCALSPPFTA--MDQIRLEAKIKVGRFHPIPSH-YSSSLSQLINSMLQVNDEMRPSI 262          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO37069 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGU2])

HSP 1 Score: 180.259 bits (456), Expect = 3.910e-54
Identity = 96/253 (37.94%), Postives = 149/253 (58.89%), Query Frame = 3
Query:  138 SKFNVVKRIGKGQFSEVWRAE-VKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRP 893
            +++ VV+R+G G F  V+  E +KA  E   LK++ + E+   +   D ++E  LL +L+HPN++K + SF++     IV E  + GDL   I  +R+  +   E  I  +F+QI   + HMH  RI+HRD+K  N+F+ +   VKLGD G+ R    +++ A +  GTPYYMSPE +  + YN  SDIWSLG +LYE+  LQ  F G   +L+ +  KI   + P L ++ YS +L+   S+ ++KDP  RP
Sbjct:    4 NRYRVVRRLGSGSFGTVFLVEDLKANGERKVLKEIYVGELQPDET-VDAMREAKLLSKLNHPNIVKFMDSFMDREYFCIVTEYCEGGDLDDKISAWRKSGKKFDESLILAWFIQIVLAVQHMHEMRILHRDLKTRNIFLKN-NIVKLGDFGISRILMGTSDMATTFTGTPYYMSPEVLKHEGYNHKSDIWSLGVVLYELCNLQHAFQGQ--SLMGVMYKIVEGELPAL-SDKYSSQLQAFYSRLMDKDPKLRP 251          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO49690 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG02])

HSP 1 Score: 175.252 bits (443), Expect = 4.649e-52
Identity = 99/258 (38.37%), Postives = 147/258 (56.98%), Query Frame = 3
Query:  132 SLSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNE-LNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEIS 902
            SL ++ + K IGKG + EV+ ++ K   +   LKKV + +    + R+    E  LL QL HPN++    SF ++   L I +   + GDL   +K   +K   + E  I ++FVQI   L +MH K I+HRD+K  N+F+T    +K+GDLG+ R   SS++ A +L+GTPYYMSPE    + YN  SD+W+LGC LYEM  L+  F    M+   L  KI     PPLP   YS +L +++   +++DP+ RP  S
Sbjct:    2 SLDRYTIGKCIGKGSYGEVFLSKHKKDKKQYVLKKVDL-QKASVRERKAAELEAKLLSQLRHPNIVSYRESFQDDTGFLYIAMNFCEGGDLYSRLK--AQKGIPLDENQIVEWFVQIAMALQYMHEKHILHRDLKTQNIFLTKSKIIKVGDLGIARVLESSSDMATTLIGTPYYMSPELFSNKPYNHKSDVWALGCCLYEMCTLRHAFNAKDMS--SLVYKILKGKTPPLPKQ-YSTDLCSIIKSMLDQDPDKRPSAS 253          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: nek6 (NIMA related kinase 6 [Source:NCBI gene;Acc:101173323])

HSP 1 Score: 424.476 bits (1090), Expect = 1.016e-148
Identity = 200/286 (69.93%), Postives = 236/286 (82.52%), Query Frame = 3
Query:   99 VPQNDPNSPYG-----SLSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEKT 941
            VP  D  +P G     S++ F V ++IG+GQFSEV+RA      + VALKKVQI+EMMD KARQDCIKEIDLLKQL+HPN+IK L SF+E+NELNIVLELADAGDLSQMIK+F++K +L+PE+TIWKYFVQ+CS L HMHS+R+MHRDIKPANVFIT+ G+VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L+ LC+KI+ CDYPPLP + YS +LR LVS CIN +P+ RP+I ++  +A +MH KT
Sbjct:   21 VPPEDQKNPTGCGFRCSMANFRVERKIGRGQFSEVYRAVRLLDRQSVALKKVQIFEMMDAKARQDCIKEIDLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKKRRLIPERTIWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGEVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLLSLCRKIEQCDYPPLPPDQYSDKLRELVSMCINSEPDQRPDIIFVLQIANQMHVKT 306          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: nek7 (NIMA related kinase 7 [Source:NCBI gene;Acc:101170580])

HSP 1 Score: 417.157 bits (1071), Expect = 6.301e-146
Identity = 196/296 (66.22%), Postives = 229/296 (77.36%), Query Frame = 3
Query:   75 KPMSNNIIVPQNDPNSP------YGSLSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEKTR 944
            +P       P   P  P      Y SL+ F + K+IGKGQFSEV+RA     N  VALKK+QI+ +MD KARQDCIKEIDLLKQL+HPNVIK  ASF+E+NELNIVLELADAGDLS+MI HF+ + +L+PEK +WKYFVQ+C  L HMHS+R+MHRDIKPANVF+T+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPER+ E  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LC KI+ CDYPPLP++ YS+ELR LV  CIN DP  RP+I+Y+Y +AK+M   T+
Sbjct:    6 QPQGQQAETPPFQPQKPLQLDMDYSSLANFQIEKKIGKGQFSEVYRARYILDNTPVALKKIQIFNLMDAKARQDCIKEIDLLKQLNHPNVIKYHASFIEDNELNIVLELADAGDLSRMINHFKNQRRLIPEKAVWKYFVQVCRALEHMHSRRVMHRDIKPANVFVTATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERLRENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCTKIQQCDYPPLPSDHYSQELRDLVDMCINPDPEKRPDITYVYDIAKKMRNMTQ 301          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000034147.1 (serine/threonine-protein kinase Nek5 [Source:NCBI gene;Acc:101162253])

HSP 1 Score: 188.734 bits (478), Expect = 5.273e-53
Identity = 102/259 (39.38%), Postives = 158/259 (61.00%), Query Frame = 3
Query:  135 LSKFNVVKRIGKGQFSEVW--RAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYG-QVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEIS 902
            ++ + V+ +IG+G F + +  R++    +    +K++ + + M  K R+   KE+ LL ++ HPN++  ++SF+E   L IV+E  D GDL + I + +R      E+ I   FVQIC GL H+H K+++HRDIK  N+F+T+ G + KLGD G+ R  ++S + A++ VGTPYY+SPE    + YN  +D+WSLGC+LYE+  L+ PF G   +L  L  KI    Y P+P   Y+ ELR LV+Q    +P  RP IS
Sbjct:    1 MNDYEVLWQIGEGAFGKAFLVRSKTGGGDTQCVIKQINL-QKMSAKERESSRKEVTLLSRMRHPNIVSFISSFLEKGSLFIVMEFCDGGDLLKKI-NMQRGVPFR-EEEILDLFVQICLGLKHIHDKKVLHRDIKCQNIFLTNGGMKAKLGDFGIARMLNNSMDLARTCVGTPYYLSPEICESRPYNNKTDVWSLGCVLYELCTLRHPFEGS--SLRQLLGKICRGRYAPVPTR-YTHELRLLVNQLFKVNPRDRPSIS 253          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000000545.2 (pep primary_assembly:ASM223467v1:4:1040495:1044496:1 gene:ENSORLG00000000439.2 transcript:ENSORLT00000000545.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 176.407 bits (446), Expect = 2.372e-52
Identity = 99/256 (38.67%), Postives = 148/256 (57.81%), Query Frame = 3
Query:  135 LSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEIS 902
            + K+  VK+IG+G F +      K       +K++ I   M TK R++  KE+ +L  + HPN+++   SF E   L IV++  + GDL + I    +K  L  E  I  +FVQIC  L H+H ++I+HRDIK  N+F+T  G V+LGD G+ R   ++   A++ +GTPYY+SPE    + YN   DIW+LGC+LYEM  L+  F    M   +L  KI    YPP+  + YS ELR+L++Q   ++P  RP +S
Sbjct:    1 MDKYENVKQIGEGSFGKAILVNSKEDGRQYVIKEIGI-SGMSTKERRESRKEVSVLANMSHPNIVQYKESF-EGGCLYIVMDYCEGGDLFKKINS--QKGVLFSEDQILDWFVQICLALKHVHGRKILHRDIKSQNIFLTKDGTVQLGDFGIARVL-NTVELARTCIGTPYYLSPEICENKPYN-NKDIWALGCVLYEMCTLKHAFEAGNMK--NLVLKIIRGSYPPVSVH-YSPELRSLLAQLFRRNPRERPSVS 247          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: nek2 (NIMA related kinase 2 [Source:NCBI gene;Acc:101168418])

HSP 1 Score: 170.629 bits (431), Expect = 3.020e-48
Identity = 95/261 (36.40%), Postives = 152/261 (58.24%), Query Frame = 3
Query:  144 FNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVE--NNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKR-----IMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPF--YGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEI 899
            + V+  IG G +    + + K+  +I+  K++  Y  M    +Q  + E++LL++L HPN+++     ++  N  L I++E  + GDLS +I    ++ + + E+ I +  VQ+   L   H +R     ++HRD+KPAN+F+ +   VKLGD GL R  +  T+ A++ VGTPYYMSPE+I+  +YN  SDIWSLGCLLYE+ AL  PF  Y  K    +L +KI+   +  +P   YS EL +L+S+ +N     RP +
Sbjct:    8 YEVLYTIGSGSYGRCQKIKRKSDGKILVWKELD-YGTMAECEKQMLVSEVNLLRELKHPNIVRYYDRIIDRRNTMLYIIMEYCEGGDLSCLISKCIKERKYLEEQFILRVMVQLSLALKECHRRRDGRATVLHRDLKPANIFLDANQNVKLGDFGLARILNHDTSFAKTFVGTPYYMSPEQINRMSYNEKSDIWSLGCLLYELCALSPPFTAYNQK----ELAEKIREGKFRRIPFR-YSEELNSLISRMLNLKDYLRPSV 262          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000055481.1 (SMESG000055481.1)

HSP 1 Score: 409.838 bits (1052), Expect = 4.717e-143
Identity = 193/284 (67.96%), Postives = 236/284 (83.10%), Query Frame = 3
Query:  105 QNDPN---SPYGSLSKFNVVKRIGKGQFSEVWRAEVKATNE-IVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEKTR 944
            QND +     + +LSKF + K+IG+GQFS V++A     N+ I+ALKKV+I+EMMD K R+DCIKEIDLLK+LDHP++IK ++SF+E+NEL IVLELADAGDLS+MIKHF ++ +L+PE+TIWKYFVQICS L +MHS+RIMHRDIKPANVFITS G+VKLGD GLGRFFS+ T++  SLVGTPYYMSPERI E  Y++ SDIWSLGC+LYEMAALQSPFYG+ +TL  LC++I+  DYPPLP  IYS ELR LV +CI  DPNSRP IS++Y VAK MHEKTR
Sbjct:    6 QNDQDYQLEAFSNLSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYHVAKNMHEKTR 289          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000020466.1 (SMESG000020466.1)

HSP 1 Score: 196.438 bits (498), Expect = 4.556e-55
Identity = 103/260 (39.62%), Postives = 154/260 (59.23%), Query Frame = 3
Query:  129 GSLSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYM 908
             S+S F  + +IG+G F   W  E K   +   LK++ +Y+M + K R +  KE+ LL +++HPN++    SF E    +I++E  + GDL + IK   +   L  E  +  YF+QIC  L H+H +RI+HRDIKP N+F+T    VKLGD G+ +   S+T   ++ VGTP+Y SPE      YN  SDIWSLGC+LYE+ +L   FYG  +T+  L  +IK  +Y P+P+ ++S  LR LV     + P+ RP I+ +
Sbjct:    2 SSISDFKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHE-KERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKT--QNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITI--LAMRIKKVNYKPVPS-VFSAPLRALVDNMFRRRPDERPNINTI 255          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000020466.1 (SMESG000020466.1)

HSP 1 Score: 196.438 bits (498), Expect = 4.650e-55
Identity = 103/260 (39.62%), Postives = 154/260 (59.23%), Query Frame = 3
Query:  129 GSLSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYM 908
             S+S F  + +IG+G F   W  E K   +   LK++ +Y+M + K R +  KE+ LL +++HPN++    SF E    +I++E  + GDL + IK   +   L  E  +  YF+QIC  L H+H +RI+HRDIKP N+F+T    VKLGD G+ +   S+T   ++ VGTP+Y SPE      YN  SDIWSLGC+LYE+ +L   FYG  +T+  L  +IK  +Y P+P+ ++S  LR LV     + P+ RP I+ +
Sbjct:    2 SSISDFKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHE-KERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKT--QNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITI--LAMRIKKVNYKPVPS-VFSAPLRALVDNMFRRRPDERPNINTI 255          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000020466.1 (SMESG000020466.1)

HSP 1 Score: 196.438 bits (498), Expect = 4.690e-55
Identity = 103/260 (39.62%), Postives = 154/260 (59.23%), Query Frame = 3
Query:  129 GSLSKFNVVKRIGKGQFSEVWRAEVKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYM 908
             S+S F  + +IG+G F   W  E K   +   LK++ +Y+M + K R +  KE+ LL +++HPN++    SF E    +I++E  + GDL + IK   +   L  E  +  YF+QIC  L H+H +RI+HRDIKP N+F+T    VKLGD G+ +   S+T   ++ VGTP+Y SPE      YN  SDIWSLGC+LYE+ +L   FYG  +T+  L  +IK  +Y P+P+ ++S  LR LV     + P+ RP I+ +
Sbjct:    2 SSISDFKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHE-KERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKT--QNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITI--LAMRIKKVNYKPVPS-VFSAPLRALVDNMFRRRPDERPNINTI 255          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000057044.1 (SMESG000057044.1)

HSP 1 Score: 177.948 bits (450), Expect = 7.381e-50
Identity = 93/249 (37.35%), Postives = 147/249 (59.04%), Query Frame = 3
Query:  162 IGKGQFSEVWRAE----VKATNEIVALKKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPE 896
            IGKG F  V++ +     +    I  LK+V + + MD    ++C +E  LL +L+H N++K   SF   N   I+ E  + GDL Q+I+  +R    + E  I ++F+Q+  GL+++H ++I+HRD+KP N+F+  Y  VK+GD G+ R  + + + A + +GTPYYMSPE +    YN  SDIWS G +LYEM AL+  F GD +  V +      C  P +P+N YS  L+ ++   + KDP++RP+
Sbjct:   21 IGKGSFGTVYKVKDFRGPEGQESIKVLKEVNV-DTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFL-KYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPC--PRIPSN-YSENLQEVLECILVKDPDNRPK 264          
The following BLAST results are available for this feature:
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NEK75.842e-14971.38NIMA related kinase 7 [Source:HGNC Symbol;Acc:HGNC... [more]
NEK75.842e-14971.38NIMA related kinase 7 [Source:HGNC Symbol;Acc:HGNC... [more]
NEK64.427e-14570.25NIMA related kinase 6 [Source:HGNC Symbol;Acc:HGNC... [more]
NEK64.427e-14570.25NIMA related kinase 6 [Source:HGNC Symbol;Acc:HGNC... [more]
NEK64.427e-14570.25NIMA related kinase 6 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nekl-32.911e-13568.00Serine/threonine-protein kinase nekl-3 [Source:Un... [more]
nekl-32.911e-13568.00Serine/threonine-protein kinase nekl-3 [Source:Un... [more]
nekl-14.785e-5034.07NEK (NEver in mitosis Kinase) Like [Source:UniPro... [more]
nekl-14.840e-5034.07NEK (NEver in mitosis Kinase) Like [Source:UniPro... [more]
nekl-24.258e-4433.58Serine/threonine-protein kinase nekl-2 [Source:Un... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nek21.214e-4936.64gene:FBgn0029970 transcript:FBtr0071142[more]
niki6.207e-4835.94gene:FBgn0045980 transcript:FBtr0084737[more]
GckIII3.117e-3833.86gene:FBgn0266465 transcript:FBtr0083399[more]
Tao7.952e-3433.60gene:FBgn0031030 transcript:FBtr0309237[more]
Tao9.060e-3433.60gene:FBgn0031030 transcript:FBtr0336692[more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nek72.990e-15173.43NIMA-related kinase 7 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
nek65.805e-14271.37NIMA-related kinase 6 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
nek62.344e-11259.93NIMA-related kinase 6 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
nek15.020e-5837.41NIMA-related kinase 1 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
CABZ01040556.11.962e-4735.91NIMA related kinase 3 [Source:NCBI gene;Acc:100536... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nek71.185e-14871.74NIMA-related kinase 7 [Source:NCBI gene;Acc:780029... [more]
nek71.245e-14871.74NIMA-related kinase 7 [Source:NCBI gene;Acc:780029... [more]
nek71.423e-14871.74NIMA-related kinase 7 [Source:NCBI gene;Acc:780029... [more]
nek72.611e-14871.74NIMA-related kinase 7 [Source:NCBI gene;Acc:780029... [more]
nek75.750e-14871.74NIMA-related kinase 7 [Source:NCBI gene;Acc:780029... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nek73.019e-14971.74NIMA (never in mitosis gene a)-related expressed k... [more]
Nek73.019e-14971.74NIMA (never in mitosis gene a)-related expressed k... [more]
Nek64.367e-14469.89NIMA (never in mitosis gene a)-related expressed k... [more]
Nek64.367e-14469.89NIMA (never in mitosis gene a)-related expressed k... [more]
Nek61.077e-14270.94NIMA (never in mitosis gene a)-related expressed k... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9ES74|NEK7_MOUSE2.112e-14871.74Serine/threonine-protein kinase Nek7 OS=Mus muscul... [more]
sp|Q8TDX7|NEK7_HUMAN2.806e-14871.38Serine/threonine-protein kinase Nek7 OS=Homo sapie... [more]
sp|D3ZBE5|NEK7_RAT3.062e-14871.74Serine/threonine-protein kinase Nek7 OS=Rattus nor... [more]
sp|P59895|NEK6_RAT6.752e-14570.61Serine/threonine-protein kinase Nek6 OS=Rattus nor... [more]
sp|A2BD05|NEK6_PIG1.435e-14470.25Serine/threonine-protein kinase Nek6 OS=Sus scrofa... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8GQY49.920e-16176.22Protein kinase domain-containing protein OS=Macros... [more]
A0A267EEI41.610e-15875.71Protein kinase domain-containing protein (Fragment... [more]
A0A267DU222.140e-15875.71Protein kinase domain-containing protein (Fragment... [more]
A0A1S3JQM71.563e-15775.00serine/threonine-protein kinase Nek7 isoform X2 OS... [more]
A0A1I8ICQ91.719e-15772.67Protein kinase domain-containing protein OS=Macros... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nek78.956e-15273.16NIMA related kinase 7 [Source:NCBI gene;Acc:103046... [more]
nek64.563e-14270.41NIMA-related kinase 6 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
nek78.263e-13366.91NIMA related kinase 7 [Source:NCBI gene;Acc:103046... [more]
nek61.106e-11558.80NIMA-related kinase 6 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
nek66.510e-11361.85NIMA-related kinase 6 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007414.11.090e-5637.21pep scaffold:Pmarinus_7.0:GL476981:230882:244405:1... [more]
nek23.990e-4935.74NIMA-related kinase 2 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
NEK96.412e-4536.22NIMA related kinase 9 [Source:HGNC Symbol;Acc:HGNC... [more]
STK365.360e-4235.57serine/threonine kinase 36 [Source:HGNC Symbol;Acc... [more]
ENSPMAT00000000555.11.570e-3639.62pep scaffold:Pmarinus_7.0:GL477093:35206:42652:1 g... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
KIN32.985e-4131.10Nonessential serine/threonine protein kinase; poss... [more]
STE72.613e-3432.26Signal transducing MAP kinase kinase; involved in ... [more]
CDC56.372e-3329.32Polo-like kinase; controls targeting and activatio... [more]
TPK33.194e-3230.29cAMP-dependent protein kinase catalytic subunit; p... [more]
SPS15.338e-3233.06Putative protein serine/threonine kinase; localize... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO346463.017e-14770.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498222.426e-5938.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374134.282e-5635.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO370693.910e-5437.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO496904.649e-5238.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nek61.016e-14869.93NIMA related kinase 6 [Source:NCBI gene;Acc:101173... [more]
nek76.301e-14666.22NIMA related kinase 7 [Source:NCBI gene;Acc:101170... [more]
ENSORLT00000034147.15.273e-5339.38serine/threonine-protein kinase Nek5 [Source:NCBI ... [more]
ENSORLT00000000545.22.372e-5238.67pep primary_assembly:ASM223467v1:4:1040495:1044496... [more]
nek23.020e-4836.40NIMA related kinase 2 [Source:NCBI gene;Acc:101168... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000055481.14.717e-14367.96SMESG000055481.1[more]
SMESG000020466.14.556e-5539.62SMESG000020466.1[more]
SMESG000020466.14.650e-5539.62SMESG000020466.1[more]
SMESG000020466.14.690e-5539.62SMESG000020466.1[more]
SMESG000057044.17.381e-5037.35SMESG000057044.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011294 ID=SMED30011294|Name=Protein kinase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1216bp
CTATATAAATCTTATATGTTTGTAATTATTTTTAAAAAAATCGTTTAATT
GTTTATAAATTTGGAATTTTTTAAAAACCAATGAGCAATAACATAATTGT
GCCTCAAAACGATCCCAATAGTCCATATGGTTCGCTGAGTAAATTTAATG
TTGTAAAGAGAATAGGTAAAGGACAATTTTCTGAAGTGTGGCGGGCAGAA
GTGAAAGCCACCAATGAGATAGTTGCTTTGAAAAAAGTTCAGATTTACGA
AATGATGGATACAAAGGCAAGGCAGGATTGTATAAAGGAAATTGATTTAT
TGAAGCAATTAGATCATCCAAATGTCATAAAATGTTTGGCATCGTTTGTT
GAAAACAACGAATTGAATATTGTTTTAGAATTAGCAGATGCAGGGGACCT
GTCACAGATGATCAAGCATTTTCGAAGAAAATATCAACTAATGCCTGAGA
AAACTATTTGGAAATATTTCGTTCAAATCTGCAGTGGATTAAATCATATG
CATTCGAAAAGGATTATGCATCGAGATATTAAGCCTGCTAATGTTTTTAT
CACATCATATGGCCAAGTAAAACTTGGAGATTTGGGACTTGGAAGATTTT
TTAGCTCGTCAACTAATGATGCTCAATCTCTAGTTGGTACTCCATATTAC
ATGTCTCCGGAGAGAATTCATGAACAAAATTACAACTTGACATCTGATAT
ATGGTCCCTCGGTTGTTTATTGTATGAAATGGCAGCTTTACAATCCCCGT
TTTATGGGGATAAAATGACGCTCGTTGACTTGTGTAAGAAAATTAAAATT
TGTGACTATCCTCCGCTACCTGCAAATATTTATTCTCGTGAATTACGAAC
TTTGGTCAGTCAATGTATAAATAAGGATCCTAATTCCCGTCCAGAAATCA
GTTATATGTACGGTGTTGCTAAAGAAATGCACGAAAAAACAAGGGTGGAC
AGTGCAGGTGGCAGTCGTACGAGTAGCCGGCAAACAAGTGCCGGCAGCAC
ACATTCTAAATAATCGATAATTTCTTTATACTTTATACAACTATTTTTAA
CAATTTGATCCGTCTTAATCAATTTAGATCAATTCTGCATCCGTCCGGAT
AAAACCACTTTTACAAATACTTTTATCATTTTTCACATATCTTCGATTTA
TATTTTATATTATCATATGAAGCTGTTGTTTTTAGTAATGTTAAAATATT
TACAATATTATGTAGC
back to top

protein sequence of SMED30011294-orf-1

>SMED30011294-orf-1 ID=SMED30011294-orf-1|Name=SMED30011294-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=311bp
MSNNIIVPQNDPNSPYGSLSKFNVVKRIGKGQFSEVWRAEVKATNEIVAL
KKVQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLE
LADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDI
KPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQN
YNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANI
YSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEKTRVDSAGGSRTSSR
QTSAGSTHSK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR001245Ser-Thr/Tyr_kinase_cat_dom
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
Vocabulary: cellular component
TermDefinition
GO:0000922spindle pole
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005815microtubule organizing center
GO:0005856cytoskeleton
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001245Serine-threonine/tyrosine-protein kinase, catalytic domainPRINTSPR00109TYRKINASEcoord: 205..227
score: 38.02
coord: 139..157
score: 27.78
coord: 251..273
score: 28.04
coord: 99..112
score: 28.33
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 22..287
e-value: 1.3E-87
score: 307.1
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 22..274
e-value: 6.1E-66
score: 222.5
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 22..287
score: 48.061
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 22..102
e-value: 1.2E-85
score: 288.4
NoneNo IPR availablePIRSFPIRSF000654ILKcoord: 6..291
e-value: 9.0E-40
score: 134.3
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 61..270
e-value: 1.2E-85
score: 288.4
NoneNo IPR availablePFAMPF12330Haspin_kinasecoord: 28..174
e-value: 9.2E-7
score: 28.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 286..310
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 292..310
NoneNo IPR availablePANTHERPTHR43289:SF13SERINE/THREONINE-PROTEIN KINASE NEK6coord: 16..287
NoneNo IPR availablePANTHERPTHR43289FAMILY NOT NAMEDcoord: 16..287
NoneNo IPR availableCDDcd08224STKc_Nek6_7coord: 21..282
e-value: 0.0
score: 522.602
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 145..157
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 28..51
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 20..276