slc43a-7

Overview
Nameslc43a-7 (AKN21689.1)
Smed IDSMED30011282
Length (bp)1235
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc43a-7 (SMED30011282) t-SNE clustered cells

Violin plots show distribution of expression levels for slc43a-7 (SMED30011282) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011282

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
proximal tubuleSMED30011282SMESG000075262.1 Smed-slc43a-7smed_ncbi_20200123PMID:21828097
Rink et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc43a-7 vs. Ensembl Human
Match: SLC43A3 (solute carrier family 43 member 3 [Source:HGNC Symbol;Acc:HGNC:17466])

HSP 1 Score: 55.8398 bits (133), Expect = 4.659e-8
Identity = 42/161 (26.09%), Postives = 76/161 (47.20%), Query Frame = 1
Query:   19 FSGVFCGFSSLMPICKDFGVFSQCCGTQPGSEG-----VRCAAQEACFGRAFSTWIVVRALMSFVLGMVFDRFGIGIIGVVAAVCLMGGFLCFAFTPIFNW-LLFIAGSLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIVMTMLKVFTDLG 483
            F+GV  G+ SL+ + K+   F   CG   G  G       C AQ+  F   F+    +   M+F  G +FDRF   +  ++A        L  AFT   +  LLF+A  +LT+      ++N+ +  +F    + ++++ +  +D S+ V  ++K+  + G
Sbjct:   23 FAGVLFGWPSLVFVFKNEDYFKDLCGPDAGPIGNATGQADCKAQDERFSLIFTLGSFMNNFMTFPTGYIFDRFKTTVARLIAIFFYTTATLIIAFTSAGSAVLLFLAMPMLTIGGILFLITNLQIGNLFGQHRSTIITLYNGAFDSSSAVFLIIKLLYEKG 183          
BLAST of slc43a-7 vs. Ensembl Human
Match: SLC43A3 (solute carrier family 43 member 3 [Source:HGNC Symbol;Acc:HGNC:17466])

HSP 1 Score: 56.225 bits (134), Expect = 5.798e-8
Identity = 42/161 (26.09%), Postives = 76/161 (47.20%), Query Frame = 1
Query:   19 FSGVFCGFSSLMPICKDFGVFSQCCGTQPGSEG-----VRCAAQEACFGRAFSTWIVVRALMSFVLGMVFDRFGIGIIGVVAAVCLMGGFLCFAFTPIFNW-LLFIAGSLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIVMTMLKVFTDLG 483
            F+GV  G+ SL+ + K+   F   CG   G  G       C AQ+  F   F+    +   M+F  G +FDRF   +  ++A        L  AFT   +  LLF+A  +LT+      ++N+ +  +F    + ++++ +  +D S+ V  ++K+  + G
Sbjct:   23 FAGVLFGWPSLVFVFKNEDYFKDLCGPDAGPIGNATGQADCKAQDERFSLIFTLGSFMNNFMTFPTGYIFDRFKTTVARLIAIFFYTTATLIIAFTSAGSAVLLFLAMPMLTIGGILFLITNLQIGNLFGQHRSTIITLYNGAFDSSSAVFLIIKLLYEKG 183          
BLAST of slc43a-7 vs. Ensembl Human
Match: SLC43A3 (solute carrier family 43 member 3 [Source:HGNC Symbol;Acc:HGNC:17466])

HSP 1 Score: 56.225 bits (134), Expect = 5.798e-8
Identity = 42/161 (26.09%), Postives = 76/161 (47.20%), Query Frame = 1
Query:   19 FSGVFCGFSSLMPICKDFGVFSQCCGTQPGSEG-----VRCAAQEACFGRAFSTWIVVRALMSFVLGMVFDRFGIGIIGVVAAVCLMGGFLCFAFTPIFNW-LLFIAGSLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIVMTMLKVFTDLG 483
            F+GV  G+ SL+ + K+   F   CG   G  G       C AQ+  F   F+    +   M+F  G +FDRF   +  ++A        L  AFT   +  LLF+A  +LT+      ++N+ +  +F    + ++++ +  +D S+ V  ++K+  + G
Sbjct:   23 FAGVLFGWPSLVFVFKNEDYFKDLCGPDAGPIGNATGQADCKAQDERFSLIFTLGSFMNNFMTFPTGYIFDRFKTTVARLIAIFFYTTATLIIAFTSAGSAVLLFLAMPMLTIGGILFLITNLQIGNLFGQHRSTIITLYNGAFDSSSAVFLIIKLLYEKG 183          
BLAST of slc43a-7 vs. Ensembl Human
Match: SLC43A3 (solute carrier family 43 member 3 [Source:HGNC Symbol;Acc:HGNC:17466])

HSP 1 Score: 56.225 bits (134), Expect = 5.798e-8
Identity = 42/161 (26.09%), Postives = 76/161 (47.20%), Query Frame = 1
Query:   19 FSGVFCGFSSLMPICKDFGVFSQCCGTQPGSEG-----VRCAAQEACFGRAFSTWIVVRALMSFVLGMVFDRFGIGIIGVVAAVCLMGGFLCFAFTPIFNW-LLFIAGSLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIVMTMLKVFTDLG 483
            F+GV  G+ SL+ + K+   F   CG   G  G       C AQ+  F   F+    +   M+F  G +FDRF   +  ++A        L  AFT   +  LLF+A  +LT+      ++N+ +  +F    + ++++ +  +D S+ V  ++K+  + G
Sbjct:   23 FAGVLFGWPSLVFVFKNEDYFKDLCGPDAGPIGNATGQADCKAQDERFSLIFTLGSFMNNFMTFPTGYIFDRFKTTVARLIAIFFYTTATLIIAFTSAGSAVLLFLAMPMLTIGGILFLITNLQIGNLFGQHRSTIITLYNGAFDSSSAVFLIIKLLYEKG 183          
BLAST of slc43a-7 vs. Ensembl Human
Match: SLC43A3 (solute carrier family 43 member 3 [Source:HGNC Symbol;Acc:HGNC:17466])

HSP 1 Score: 56.225 bits (134), Expect = 5.798e-8
Identity = 42/161 (26.09%), Postives = 76/161 (47.20%), Query Frame = 1
Query:   19 FSGVFCGFSSLMPICKDFGVFSQCCGTQPGSEG-----VRCAAQEACFGRAFSTWIVVRALMSFVLGMVFDRFGIGIIGVVAAVCLMGGFLCFAFTPIFNW-LLFIAGSLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIVMTMLKVFTDLG 483
            F+GV  G+ SL+ + K+   F   CG   G  G       C AQ+  F   F+    +   M+F  G +FDRF   +  ++A        L  AFT   +  LLF+A  +LT+      ++N+ +  +F    + ++++ +  +D S+ V  ++K+  + G
Sbjct:   23 FAGVLFGWPSLVFVFKNEDYFKDLCGPDAGPIGNATGQADCKAQDERFSLIFTLGSFMNNFMTFPTGYIFDRFKTTVARLIAIFFYTTATLIIAFTSAGSAVLLFLAMPMLTIGGILFLITNLQIGNLFGQHRSTIITLYNGAFDSSSAVFLIIKLLYEKG 183          
BLAST of slc43a-7 vs. Ensembl Zebrafish
Match: slc43a3b (solute carrier family 43 member 3b [Source:ZFIN;Acc:ZDB-GENE-060312-28])

HSP 1 Score: 82.0333 bits (201), Expect = 1.933e-16
Identity = 97/440 (22.05%), Postives = 188/440 (42.73%), Query Frame = 1
Query:    1 VVELSLFSGVFCGFSSLMPICKDFGVFSQCC--GTQPGSEGVRCAAQEACFGRAFSTWIVVRALMSFVLGMVFDRFGIGIIGVVAAVCLMGGFLCFAF-TPIFNWLLFIAGSLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIVMTMLKVFTDLGAPFWLLCIIHASIGVIIILGSLTILKNR-----------------ANEVISKDKGEEVNIESIN-------TESNPEGNKHINDLYNQSVEETFPTVKACVLSPEYLIQMAYFAIMLFRFTFFLSQMSSHFSYLFPTDQAIANHLLSVSNTFFIGSILISPIFGVLLDKYQ-KYTIKSLAENKVESPREIYN---RVNRCFFVPSIICSCAMIVSSSLMFVSNQYSFYVVFSSITVMKSLLFAINASYIFSAFPKKYFGTLIGAVFLTTGFLNLLQ 1227
            +VE   F+G   G++SL+ + K+ G FS  C   T  G+    C+ Q+  F   F+    +   ++   G +FDRFG  +  ++       G L  AF T   + LLF A S +++      ++NI +  +F    + ++++ +  +D S+ V  ++K+  + G       +  A   VI +  +  ++                      +  +  K EE NI++         TES+P+G           +E +F   K+C LS  +L  + + ++M  R   F+  ++   ++L   D ++ +   +      +  IL +P  G+L+D+++ K      +E + +    I +      +C      +C+   I+             Y+ F    + +S L+  NA++I  AFP  +FG L G V   +  ++LLQ
Sbjct:   21 LVECLGFAGAVFGWASLVFVLKNEGYFSSLCVNTTINGTAVEDCSRQDEQFSLIFTIASFMNNFLTLPNGFLFDRFGTTVARLLGISVYSTGMLLIAFSTTASSILLFPALSFISVGGILFLMTNIQVGNLFGTHRSTIITLYNGAFDSSSAVFLIIKLLFEDGVSLRGCFLFMACCSVIHLFRTFVLMPRTHIPYPLPENYTYGINCGGTQDYTIAKVEEKNIQTSQAEEEVAFTESSPQGQN------TNKMERSF---KSCFLSWFFLWHLLWLSVMQLRHYLFIGTLNPMLNHLTAGDPSLVSRYTNAFAFTQLCGILCAPWNGLLMDRHKGKQREPGQSEQEADLKAAILSLSLTALQCVLFS--VCAATPILPLQ----------YLTFILQVLNRSFLYGGNAAFISVAFPSVHFGKLYGTVMALSAVVSLLQ 439          
BLAST of slc43a-7 vs. Ensembl Zebrafish
Match: slc43a3b (solute carrier family 43 member 3b [Source:ZFIN;Acc:ZDB-GENE-060312-28])

HSP 1 Score: 82.0333 bits (201), Expect = 1.933e-16
Identity = 97/440 (22.05%), Postives = 188/440 (42.73%), Query Frame = 1
Query:    1 VVELSLFSGVFCGFSSLMPICKDFGVFSQCC--GTQPGSEGVRCAAQEACFGRAFSTWIVVRALMSFVLGMVFDRFGIGIIGVVAAVCLMGGFLCFAF-TPIFNWLLFIAGSLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIVMTMLKVFTDLGAPFWLLCIIHASIGVIIILGSLTILKNR-----------------ANEVISKDKGEEVNIESIN-------TESNPEGNKHINDLYNQSVEETFPTVKACVLSPEYLIQMAYFAIMLFRFTFFLSQMSSHFSYLFPTDQAIANHLLSVSNTFFIGSILISPIFGVLLDKYQ-KYTIKSLAENKVESPREIYN---RVNRCFFVPSIICSCAMIVSSSLMFVSNQYSFYVVFSSITVMKSLLFAINASYIFSAFPKKYFGTLIGAVFLTTGFLNLLQ 1227
            +VE   F+G   G++SL+ + K+ G FS  C   T  G+    C+ Q+  F   F+    +   ++   G +FDRFG  +  ++       G L  AF T   + LLF A S +++      ++NI +  +F    + ++++ +  +D S+ V  ++K+  + G       +  A   VI +  +  ++                      +  +  K EE NI++         TES+P+G           +E +F   K+C LS  +L  + + ++M  R   F+  ++   ++L   D ++ +   +      +  IL +P  G+L+D+++ K      +E + +    I +      +C      +C+   I+             Y+ F    + +S L+  NA++I  AFP  +FG L G V   +  ++LLQ
Sbjct:   21 LVECLGFAGAVFGWASLVFVLKNEGYFSSLCVNTTINGTAVEDCSRQDEQFSLIFTIASFMNNFLTLPNGFLFDRFGTTVARLLGISVYSTGMLLIAFSTTASSILLFPALSFISVGGILFLMTNIQVGNLFGTHRSTIITLYNGAFDSSSAVFLIIKLLFEDGVSLRGCFLFMACCSVIHLFRTFVLMPRTHIPYPLPENYTYGINCGGTQDYTIAKVEEKNIQTSQAEEEVAFTESSPQGQN------TNKMERSF---KSCFLSWFFLWHLLWLSVMQLRHYLFIGTLNPMLNHLTAGDPSLVSRYTNAFAFTQLCGILCAPWNGLLMDRHKGKQREPGQSEQEADLKAAILSLSLTALQCVLFS--VCAATPILPLQ----------YLTFILQVLNRSFLYGGNAAFISVAFPSVHFGKLYGTVMALSAVVSLLQ 439          
BLAST of slc43a-7 vs. Ensembl Zebrafish
Match: slc43a3a (solute carrier family 43 member 3a [Source:ZFIN;Acc:ZDB-GENE-110208-8])

HSP 1 Score: 80.4925 bits (197), Expect = 6.433e-16
Identity = 96/435 (22.07%), Postives = 198/435 (45.52%), Query Frame = 1
Query:    1 VVELSLFSGVFCGFSSLMPICKDFGVFSQCC--GTQPGSE-GVRCAAQEACFGRAFSTWIVVRALMSFVLGMVFDRFGIGIIGVVAAVCLMGGFLCFAFT-PIFNWLLFIAGSLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIVMTMLKVFTDLGAPFWLLCIIHASIGVIIILGSLTIL-KNRANEVISKDKGEEVNI---ESINTESNPEGNKHINDLYNQSVEETFPT-------------VKACVLSPEYLIQMAYFAIMLFRFTFFLSQMSSHFSYLFPTDQ-AIANHLLSVSNTFFIGSILISPIFGVLLDKYQKYTIK-SLAENKVESPREIYNRVN---RCFFVPSIICSCAMIVSSSLMFVSNQYSFYVVFSSITVMKSLLFAINASYIFSAFPKKYFGTLIGAVFLTTGFLNLLQ 1227
            ++E   F+GV  G++SL+ + K  G F   C   T  G E    C  Q+  F   F+    +   ++   G ++D FG     ++A      G L  AF+    + LLF A S + +      ++N+ +  +F    + ++++ +  +D S+++  ++KV  + G       +  ++  +I ++ +L ++ K+     I +D    ++     S N E      +  +D   ++ EE   T              ++CVLS  +L  + + ++M  R  FF+  ++   + L   +   ++ +  + + T F G +L +P  G+L+D++++  +   ++E + +    I + +    +CF     IC+       S+ F+  QY   + F    + +S L+  NA++I  AFP ++FG L G V   +  ++LLQ
Sbjct:   22 LLECLCFAGVVFGWASLVFVLKTDGYFGDLCSNATDAGGEFSSDCGLQDEHFSLVFTVASFMNNFLTLPNGFLYDHFGTMATRLLAIFLYTTGTLIVAFSNKALSVLLFPALSFIAVGGILFLMTNMQVGNLFGSHRSTIITVYNGAFDSSSVIFLIIKVLYEKGVSLRSSFLFLSACNLIHLIRTLFLMPKSHIPYPIPQDYQYGISCAKSNSYNVEEYEAKREASSDRSRRAEEELLETDSIKLTDNPEKDSFRSCVLSWFFLWHLVWLSVMQLRHYFFIGTLNPMLNRLANQNPVTVSEYTNAFAFTQFCG-VLCAPWNGLLMDRHKRKPLDPDVSEREADLRSSILSLLLTSLQCFLFS--ICA-------SIPFLPLQY---LTFILQVLNRSFLYGGNAAFISIAFPARHFGKLYGLVMSLSAVVSLLQ 443          
BLAST of slc43a-7 vs. Ensembl Zebrafish
Match: slc43a3a (solute carrier family 43 member 3a [Source:ZFIN;Acc:ZDB-GENE-110208-8])

HSP 1 Score: 80.4925 bits (197), Expect = 6.433e-16
Identity = 96/435 (22.07%), Postives = 198/435 (45.52%), Query Frame = 1
Query:    1 VVELSLFSGVFCGFSSLMPICKDFGVFSQCC--GTQPGSE-GVRCAAQEACFGRAFSTWIVVRALMSFVLGMVFDRFGIGIIGVVAAVCLMGGFLCFAFT-PIFNWLLFIAGSLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIVMTMLKVFTDLGAPFWLLCIIHASIGVIIILGSLTIL-KNRANEVISKDKGEEVNI---ESINTESNPEGNKHINDLYNQSVEETFPT-------------VKACVLSPEYLIQMAYFAIMLFRFTFFLSQMSSHFSYLFPTDQ-AIANHLLSVSNTFFIGSILISPIFGVLLDKYQKYTIK-SLAENKVESPREIYNRVN---RCFFVPSIICSCAMIVSSSLMFVSNQYSFYVVFSSITVMKSLLFAINASYIFSAFPKKYFGTLIGAVFLTTGFLNLLQ 1227
            ++E   F+GV  G++SL+ + K  G F   C   T  G E    C  Q+  F   F+    +   ++   G ++D FG     ++A      G L  AF+    + LLF A S + +      ++N+ +  +F    + ++++ +  +D S+++  ++KV  + G       +  ++  +I ++ +L ++ K+     I +D    ++     S N E      +  +D   ++ EE   T              ++CVLS  +L  + + ++M  R  FF+  ++   + L   +   ++ +  + + T F G +L +P  G+L+D++++  +   ++E + +    I + +    +CF     IC+       S+ F+  QY   + F    + +S L+  NA++I  AFP ++FG L G V   +  ++LLQ
Sbjct:   22 LLECLCFAGVVFGWASLVFVLKTDGYFGDLCSNATDAGGEFSSDCGLQDEHFSLVFTVASFMNNFLTLPNGFLYDHFGTMATRLLAIFLYTTGTLIVAFSNKALSVLLFPALSFIAVGGILFLMTNMQVGNLFGSHRSTIITVYNGAFDSSSVIFLIIKVLYEKGVSLRSSFLFLSACNLIHLIRTLFLMPKSHIPYPIPQDYQYGISCAKSNSYNVEEYEAKREASSDRSRRAEEELLETDSIKLTDNPEKDSFRSCVLSWFFLWHLVWLSVMQLRHYFFIGTLNPMLNRLANQNPVTVSEYTNAFAFTQFCG-VLCAPWNGLLMDRHKRKPLDPDVSEREADLRSSILSLLLTSLQCFLFS--ICA-------SIPFLPLQY---LTFILQVLNRSFLYGGNAAFISIAFPARHFGKLYGLVMSLSAVVSLLQ 443          
BLAST of slc43a-7 vs. Ensembl Zebrafish
Match: slc43a1b (solute carrier family 43 member 1b [Source:ZFIN;Acc:ZDB-GENE-070209-173])

HSP 1 Score: 72.0182 bits (175), Expect = 4.215e-13
Identity = 98/463 (21.17%), Postives = 187/463 (40.39%), Query Frame = 1
Query:    1 VVELSLFSGVFCGFSSLMPICKDFGVFSQCCGTQPGSEG------------VRCAAQEACFGRAFSTWIVVRALMSFVLGMVFDRFGIGIIGVVAAVCLMGGFLCFA---FTP-IFNWLLFIAGSLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIVMTMLKVFTDLGAPFWLLCIIHASIGVIIILG--------SLTILKNRANEVISKDKGEEVNIESINT------ESNPEGNKHINDLYNQSVE-ETFPTVKACVLSPEYLIQMAYFAIMLFRFTFFLSQMSSHFSYLFPTDQAIANHLL------------SVSNTFFIGSILISPIFGVLLDKYQKYTIKSLAENKVE-SP-------REIYNRVN--RCFFVPSIICSCAMIVSSSLMFVSNQYSFYVVFSSITVMKSLLFAINASYIFSAFPKKYFGTLIGAVFLTTGFLNLLQQ 1230
            ++E  LFS V  G+ SL+ + K+ G +S  C T+  +EG            + C  QE      F+    + +  +  LG++ D+FG   I +  + C     +  A   + P + + L+FIA S+      CL  +++ L  +F    + ++S++   Y  SA+    +K+  D+G  F ++  + A    ++ L         S    ++     + K +G+E++ +  +T      +  P+     N+  +   E ++ P  +  V SP +L  +   A+   R  FF+  M+    +L        + +L            S+  T  +  +L  P+ G ++D   K     ++    E SP       R+I    N  R F    I  +  ++    L  + N     V F   T ++  + +       + +P  +FGTL G   + +    LLQQ
Sbjct:   20 IIENLLFSAVLLGWGSLLIMLKNEGFYSHLC-TENVTEGHSNVSLTEQTVWLSCIEQEEILNLGFTIGSFIISAATLPLGVLMDKFGPRPIRLFGSSCFALSMVLIAVASYNPKVLSALIFIAVSMNGFGGICLTFTSLTLPNMFGNVRSTILSLMIGSYASSAVTFPGVKLIYDVGVSFSVIFWLWAGFACLVFLNCFLNWPGESFPAPEDIRYIAMGKLRGKELDQKMTDTNVVLREQEEPKKLPSSNEAPSDGAEAQSSPPFRRSVCSPIFLWSIITMAMTQLRIIFFMGAMNKMLEFLVTHGDPNPSEVLVKESEEQVSLYSSIFGTLQLLCLLSCPLIGYIMDWRMKECEDDVSSADGEKSPSRPPKRDRKIQKLTNAIRAF----IFTNMLLVTFGILSLIDNLPIQVVSFILHTAVRGFIHSCCGGLYAAVYPTNHFGTLTGLQSMISAVFALLQQ 477          
BLAST of slc43a-7 vs. Ensembl Xenopus
Match: kcnn4 (potassium channel, calcium activated intermediate/small conductance subfamily N alpha, member 4 [Source:Xenbase;Acc:XB-GENE-1013002])

HSP 1 Score: 67.3958 bits (163), Expect = 1.724e-11
Identity = 106/470 (22.55%), Postives = 180/470 (38.30%), Query Frame = 1
Query:    1 VVELSLFSGVFCGFSSLMPICKDFGVFSQCCGTQPGSEG------------------VRCAAQEACFGRAFSTWIVVRALMSFVLGMVFDRFGIGIIGVVA--------AVCLMGGFLCFAFTPIFNWLLFIAGSLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIVMTMLKVFTDLGAPF------W--------LLCIIHASIGVIIILGSLTILKN---RANEVISKDKGEE----VNI--ESINTESNPEGNK-HINDLYNQSVEE-TFPTVKACVLSPEYLIQMAYFAIMLFRFTFFLSQMSSHFSYLFPTDQAIANHLLSVSNTFFIGSILISPIFGVL------LDKYQKYTIKSLAENKVESPREIYNRVN--RCFFVPSIICSCAMIVSSSLMFVSNQYSFYVVFSSITVMKSLLFAINASYIFSAFPKKYFGTLIGAVFLTTGFLNLLQQV 1233
            V+E   FS V  G+ SL+ + +  G +S  C     SE                   + C AQE      F+    + +  +  LG++ DR+G   + +V         A+  + G+      P    L+F+A SL      CL  +++ L  +F    + ++S++   Y  SAI    LK+  + G  F      W        L CII+    +I      +  K    R   +  K  G++    V I  + ++ + +PE  K    DL N +    T  +      SP +L  +    +   R  FF++ M+    YL    Q      L ++  + +G  L S +FGVL         +  + +    +   E  + I    N  R F   +II  C  +       +SN    +V F   T+++  + +       + FP  +FGTL G   L +    LLQ+ 
Sbjct:   20 VLENLFFSAVLFGWGSLLIMLQQEGFYSHLCSDGNSSEKDVLSYTLGNENNSLPLPWLTCTAQEEMLNLGFTIGSFLLSATTLPLGILMDRYGPRPLRLVGSFSFALSCALMALSGYDPSVLAP----LIFLALSLNGFGGICLTFTSLTLPNLFGNMRSTMMSLMIGSYASSAITFPGLKLIYEAGVSFVAIMLGWSALACLIFLNCIINWPKELIPSPDETSYTKKVTLRTLALDHKVTGDQFYSHVTIVGQRLSQKGDPEATKLSTEDLKNITKSNGTSHSFMHSARSPIFLFSLITMMMTQLRIIFFMASMNKMIEYLVAEQQENVPDALRLNADYEVG--LYSSVFGVLQLLCLFTCPFIGFVMDWKMKEGNEGSKNIQKLTNATRAFIFTNIILICFGVTC----LISNLPLQFVTFIFHTMVRGFIHSACGGLYAAVFPSSHFGTLTGLQSLLSAVFALLQEA 479          
BLAST of slc43a-7 vs. Ensembl Xenopus
Match: kcnn4 (potassium channel, calcium activated intermediate/small conductance subfamily N alpha, member 4 [Source:Xenbase;Acc:XB-GENE-1013002])

HSP 1 Score: 67.0106 bits (162), Expect = 2.023e-11
Identity = 106/470 (22.55%), Postives = 180/470 (38.30%), Query Frame = 1
Query:    1 VVELSLFSGVFCGFSSLMPICKDFGVFSQCCGTQPGSEG------------------VRCAAQEACFGRAFSTWIVVRALMSFVLGMVFDRFGIGIIGVVA--------AVCLMGGFLCFAFTPIFNWLLFIAGSLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIVMTMLKVFTDLGAPF------W--------LLCIIHASIGVIIILGSLTILKN---RANEVISKDKGEE----VNI--ESINTESNPEGNK-HINDLYNQSVEE-TFPTVKACVLSPEYLIQMAYFAIMLFRFTFFLSQMSSHFSYLFPTDQAIANHLLSVSNTFFIGSILISPIFGVL------LDKYQKYTIKSLAENKVESPREIYNRVN--RCFFVPSIICSCAMIVSSSLMFVSNQYSFYVVFSSITVMKSLLFAINASYIFSAFPKKYFGTLIGAVFLTTGFLNLLQQV 1233
            V+E   FS V  G+ SL+ + +  G +S  C     SE                   + C AQE      F+    + +  +  LG++ DR+G   + +V         A+  + G+      P    L+F+A SL      CL  +++ L  +F    + ++S++   Y  SAI    LK+  + G  F      W        L CII+    +I      +  K    R   +  K  G++    V I  + ++ + +PE  K    DL N +    T  +      SP +L  +    +   R  FF++ M+    YL    Q      L ++  + +G  L S +FGVL         +  + +    +   E  + I    N  R F   +II  C  +       +SN    +V F   T+++  + +       + FP  +FGTL G   L +    LLQ+ 
Sbjct:   20 VLENLFFSAVLFGWGSLLIMLQQEGFYSHLCSDGNSSEKDVLSYTLGNENNSLPLPWLTCTAQEEMLNLGFTIGSFLLSATTLPLGILMDRYGPRPLRLVGSFSFALSCALMALSGYDPSVLAP----LIFLALSLNGFGGICLTFTSLTLPNLFGNMRSTMMSLMIGSYASSAITFPGLKLIYEAGVSFVAIMLGWSALACLIFLNCIINWPKELIPSPDETSYTKKVTLRTLALDHKVTGDQFYSHVTIVGQRLSQKGDPEATKLSTEDLKNITKSNGTSHSFMHSARSPIFLFSLITMMMTQLRIIFFMASMNKMIEYLVAEQQENVPDALRLNADYEVG--LYSSVFGVLQLLCLFTCPFIGFVMDWKMKEGNEGSKNIQKLTNATRAFIFTNIILICFGVTC----LISNLPLQFVTFIFHTMVRGFIHSACGGLYAAVFPSSHFGTLTGLQSLLSAVFALLQEA 479          
BLAST of slc43a-7 vs. Ensembl Mouse
Match: Slc43a3 (solute carrier family 43, member 3 [Source:MGI Symbol;Acc:MGI:1931054])

HSP 1 Score: 61.2326 bits (147), Expect = 9.641e-10
Identity = 96/446 (21.52%), Postives = 193/446 (43.27%), Query Frame = 1
Query:   19 FSGVFCGFSSLMPICKDFGVFSQCCGTQ-------PGSEGVRCAAQEACFGRAFSTWIVVRALMSFVLGMVFDRFGIGIIGVVAAVCLMGGFLCFAFTPIFN-WLLFIAGSLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIVMTMLKVFTDLG-------------------APFWLLCIIHA--------SIGVIIILGSLTILKNRANEVISKDKGEEVNIESINTESNPEGNKHINDLYNQSVEETFP---TVKACVLSPEYLIQMAYFAIMLFRFTFFLSQMSSHFSYLFPTDQ-AIANHLLSVSNTFFIGSILISPIFGVLLDKYQKYTIKSLAENKVESPREIYNRVNRCFFVPSIICSC----AMIVSSSLMFVSNQYSFYVVFSSITVMKSLLFAINASYIFSAFPKKYFGTLIGAVFLTTGFLNLLQ 1227
            F+GV  G++SL+ + K    FS+ C           G   ++  AQ+  F   F+    +   M+F  G +FDRF   +  ++A        +  AFT      LLF+A  +L +      ++N+ +  +F    + ++++ +  +D S+ V  ++K+  + G                     F L+   H         S G+    G+ +  +N+A E  +K+   +  +      S PE  +       Q  ++      + + C LS  +++ + + +I+      F+  ++S  + L   D+  ++ +  + + T F G +L +P  G+L+D+ ++   K  A  +  S  E    V  C  VPS+  +        + +S+  +  QY+ +++     V +S L+  NA+++  AFP ++FG L G V   +  ++LLQ
Sbjct:   23 FAGVLFGWTSLLFVFKAENYFSEPCEQDCLLQSNVTGPSDLK--AQDEKFSLIFTLASFMNNFMTFPTGYIFDRFKTTVARLIAIFFYTCATIIIAFTSANTAMLLFLAMPMLAVGGILFLITNLQIGNLFGKHRSTIITLYNGAFDSSSAVFLVIKLLYEQGISLRSSFIFMSVCSVWHIARTFLLMPKGHIPYPLPPNYSYGLCSRFGA-SKKENKAAEHETKELRSKECLPPKEENSGPEQQQQQEQQQQQQQQQEQHEQHSFRRCALSRRFILHVVWLSIIQLWHYLFIGTLNSLLTKLSGGDKVEVSAYTNAFAITQFFG-VLCAPWNGLLMDRLKQKYQK--AAKRTGSSSEA---VALCSMVPSLALTSLLSLGFALCASIPVMQLQYATFIL---QVVSRSFLYGCNAAFLTLAFPSEHFGKLFGLVMALSAIVSLLQ 456          
BLAST of slc43a-7 vs. Ensembl Mouse
Match: Slc43a1 (solute carrier family 43, member 1 [Source:MGI Symbol;Acc:MGI:1931352])

HSP 1 Score: 58.9214 bits (141), Expect = 5.942e-9
Identity = 47/192 (24.48%), Postives = 85/192 (44.27%), Query Frame = 1
Query:    1 VVELSLFSGVFCGFSSLMPICKDFGVFSQCCGTQPGSEGVR--------CAAQEACFGRAFSTWIVVRALMSFVLGMVFDRFGIGIIGVVAAVCLMGGFLCFAF----TPIFNWLLFIAGSLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIVMTMLKVFTDLGAPFWLLCIIHASIGVIIIL 540
            VVE   FS V  G++SL+ + K  G +S  C  +  +   +        C  QE      F+    + +  +  LG++ DRFG   + +V + C        A     T + + L+F+A SL   +  CL  +++ L  +F    +  ++++   Y  SAI    +K+  D G PF ++    + +  +I L
Sbjct:   20 VVENLFFSAVLLGWASLLIMLKKEGFYSSLCPAENRTNTTQDEQHQWTSCDQQEKMLNLGFTIGSFLLSATTLPLGILMDRFGPRPLRLVGSACFAASCTLMALASRDTEVLSPLIFLALSLNGFAGICLTFTSLTLPNMFGNLRSTFMALMIGSYASSAITFPGIKLIYDAGVPFTVIMFTWSGLACLIFL 211          
BLAST of slc43a-7 vs. Ensembl Mouse
Match: Slc43a1 (solute carrier family 43, member 1 [Source:MGI Symbol;Acc:MGI:1931352])

HSP 1 Score: 58.9214 bits (141), Expect = 5.942e-9
Identity = 47/192 (24.48%), Postives = 85/192 (44.27%), Query Frame = 1
Query:    1 VVELSLFSGVFCGFSSLMPICKDFGVFSQCCGTQPGSEGVR--------CAAQEACFGRAFSTWIVVRALMSFVLGMVFDRFGIGIIGVVAAVCLMGGFLCFAF----TPIFNWLLFIAGSLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIVMTMLKVFTDLGAPFWLLCIIHASIGVIIIL 540
            VVE   FS V  G++SL+ + K  G +S  C  +  +   +        C  QE      F+    + +  +  LG++ DRFG   + +V + C        A     T + + L+F+A SL   +  CL  +++ L  +F    +  ++++   Y  SAI    +K+  D G PF ++    + +  +I L
Sbjct:   20 VVENLFFSAVLLGWASLLIMLKKEGFYSSLCPAENRTNTTQDEQHQWTSCDQQEKMLNLGFTIGSFLLSATTLPLGILMDRFGPRPLRLVGSACFAASCTLMALASRDTEVLSPLIFLALSLNGFAGICLTFTSLTLPNMFGNLRSTFMALMIGSYASSAITFPGIKLIYDAGVPFTVIMFTWSGLACLIFL 211          
BLAST of slc43a-7 vs. Ensembl Mouse
Match: Slc43a1 (solute carrier family 43, member 1 [Source:MGI Symbol;Acc:MGI:1931352])

HSP 1 Score: 58.9214 bits (141), Expect = 7.083e-9
Identity = 47/192 (24.48%), Postives = 85/192 (44.27%), Query Frame = 1
Query:    1 VVELSLFSGVFCGFSSLMPICKDFGVFSQCCGTQPGSEGVR--------CAAQEACFGRAFSTWIVVRALMSFVLGMVFDRFGIGIIGVVAAVCLMGGFLCFAF----TPIFNWLLFIAGSLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIVMTMLKVFTDLGAPFWLLCIIHASIGVIIIL 540
            VVE   FS V  G++SL+ + K  G +S  C  +  +   +        C  QE      F+    + +  +  LG++ DRFG   + +V + C        A     T + + L+F+A SL   +  CL  +++ L  +F    +  ++++   Y  SAI    +K+  D G PF ++    + +  +I L
Sbjct:   46 VVENLFFSAVLLGWASLLIMLKKEGFYSSLCPAENRTNTTQDEQHQWTSCDQQEKMLNLGFTIGSFLLSATTLPLGILMDRFGPRPLRLVGSACFAASCTLMALASRDTEVLSPLIFLALSLNGFAGICLTFTSLTLPNMFGNLRSTFMALMIGSYASSAITFPGIKLIYDAGVPFTVIMFTWSGLACLIFL 237          
BLAST of slc43a-7 vs. Ensembl Mouse
Match: Slc43a1 (solute carrier family 43, member 1 [Source:MGI Symbol;Acc:MGI:1931352])

HSP 1 Score: 58.151 bits (139), Expect = 1.262e-8
Identity = 47/192 (24.48%), Postives = 85/192 (44.27%), Query Frame = 1
Query:    1 VVELSLFSGVFCGFSSLMPICKDFGVFSQCCGTQPGSEGVR--------CAAQEACFGRAFSTWIVVRALMSFVLGMVFDRFGIGIIGVVAAVCLMGGFLCFAF----TPIFNWLLFIAGSLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIVMTMLKVFTDLGAPFWLLCIIHASIGVIIIL 540
            VVE   FS V  G++SL+ + K  G +S  C  +  +   +        C  QE      F+    + +  +  LG++ DRFG   + +V + C        A     T + + L+F+A SL   +  CL  +++ L  +F    +  ++++   Y  SAI    +K+  D G PF ++    + +  +I L
Sbjct:   63 VVENLFFSAVLLGWASLLIMLKKEGFYSSLCPAENRTNTTQDEQHQWTSCDQQEKMLNLGFTIGSFLLSATTLPLGILMDRFGPRPLRLVGSACFAASCTLMALASRDTEVLSPLIFLALSLNGFAGICLTFTSLTLPNMFGNLRSTFMALMIGSYASSAITFPGIKLIYDAGVPFTVIMFTWSGLACLIFL 254          
BLAST of slc43a-7 vs. UniProt/SwissProt
Match: sp|Q1JPD8|S43A3_BOVIN (Solute carrier family 43 member 3 OS=Bos taurus OX=9913 GN=SLC43A3 PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 4.919e-15
Identity = 95/428 (22.20%), Postives = 185/428 (43.22%), Query Frame = 1
Query:   19 FSGVFCGFSSLMPICKDFGVFSQCCGTQPGSEG-----VRCAAQEACFGRAFSTWIVVRALMSFVLGMVFDRFGIGIIGVVAAVCLMGGFLCFAFTPIFNW-LLFIAGSLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIVMTMLKVFTDLG----APFWLLCIIHA-SIGVIIIL---GSLT--ILKNRANEVISKDKGEEVNIESINTES-NPEGNKHINDLYNQSVEETFP-TVKACVLSPEYLIQMAYFAIMLFRFTFFLSQMSSHFSYLFPTDQAIANHLLSVSNTFFIGS---ILISPIFGVLLD----KYQKYTIKSLAENKVESPREIYNRVNRCFFVPSIICSCAMIVSSSLMFVSNQYSFYVVFSSITVMKSLLFAINASYIFSAFPKKYFGTLIGAVFLTTGFLNLLQ 1227
            F+GV  G++SL+ + K    F + C    GS G       C A++  F   F+        M+F  G +FDRF   +  ++A        L  AFT   +  LLF+A  +L +      ++N+ +  +F    + ++++ +  +D S+ V  ++K+  + G    A F  + +  A  +G  ++L   G +   +  N    + S+D   E + +   +E    +  + ++       ++  P +  +   SP +   + + +++      F+  ++S  + L   D AI +   + +N F +     +L +P  G+L+D    KYQ+   ++ A  K  + R +   +     +      CA I    L         Y  F    V +S L+  NA+++  AFP ++FG L G V   +  ++LLQ
Sbjct:   23 FAGVLFGWTSLVFVFKKQHYFEELCELDAGSLGNATGLDECRARDERFSLIFTLASFTINFMTFPTGYIFDRFKTTVARLIAIFLYTSATLTIAFTSADSAVLLFLAMPMLAVGGILFLITNLQIGNLFGKHRSTIITMYNGAFDSSSAVFLIIKLLYEQGVTIKASFLFISVCSAWHVGRTLLLMPRGHIPYPLPANYHYGLCSRDSPPEEDKKEAESEKLELQSKEFLSPKKETPGQQQAPGSFWSHTFSPRFAWHVVWLSVIQLWHYLFIGTLNSLLNNLASRDSAIVS---TYTNAFAVTQFFGVLCAPWNGLLMDRLKHKYQEEAKRTGAVAKAAALRSVVPSLTLTSLLSLGFAVCASIPVLPLQ--------YATFILQVVSRSFLYGCNAAFLTLAFPSEHFGKLFGLVMALSAVVSLLQ 439          
BLAST of slc43a-7 vs. UniProt/SwissProt
Match: sp|A2AVZ9|S43A3_MOUSE (Solute carrier family 43 member 3 OS=Mus musculus OX=10090 GN=Slc43a3 PE=1 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 6.744e-9
Identity = 96/446 (21.52%), Postives = 193/446 (43.27%), Query Frame = 1
Query:   19 FSGVFCGFSSLMPICKDFGVFSQCCGTQ-------PGSEGVRCAAQEACFGRAFSTWIVVRALMSFVLGMVFDRFGIGIIGVVAAVCLMGGFLCFAFTPIFN-WLLFIAGSLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIVMTMLKVFTDLG-------------------APFWLLCIIHA--------SIGVIIILGSLTILKNRANEVISKDKGEEVNIESINTESNPEGNKHINDLYNQSVEETFP---TVKACVLSPEYLIQMAYFAIMLFRFTFFLSQMSSHFSYLFPTDQ-AIANHLLSVSNTFFIGSILISPIFGVLLDKYQKYTIKSLAENKVESPREIYNRVNRCFFVPSIICSC----AMIVSSSLMFVSNQYSFYVVFSSITVMKSLLFAINASYIFSAFPKKYFGTLIGAVFLTTGFLNLLQ 1227
            F+GV  G++SL+ + K    FS+ C           G   ++  AQ+  F   F+    +   M+F  G +FDRF   +  ++A        +  AFT      LLF+A  +L +      ++N+ +  +F    + ++++ +  +D S+ V  ++K+  + G                     F L+   H         S G+    G+ +  +N+A E  +K+   +  +      S PE  +       Q  ++      + + C LS  +++ + + +I+      F+  ++S  + L   D+  ++ +  + + T F G +L +P  G+L+D+ ++   K  A  +  S  E    V  C  VPS+  +        + +S+  +  QY+ +++     V +S L+  NA+++  AFP ++FG L G V   +  ++LLQ
Sbjct:   23 FAGVLFGWTSLLFVFKAENYFSEPCEQDCLLQSNVTGPSDLK--AQDEKFSLIFTLASFMNNFMTFPTGYIFDRFKTTVARLIAIFFYTCATIIIAFTSANTAMLLFLAMPMLAVGGILFLITNLQIGNLFGKHRSTIITLYNGAFDSSSAVFLVIKLLYEQGISLRSSFIFMSVCSVWHIARTFLLMPKGHIPYPLPPNYSYGLCSRFGA-SKKENKAAEHETKELRSKECLPPKEENSGPEQQQQQEQQQQQQQQQEQHEQHSFRRCALSRRFILHVVWLSIIQLWHYLFIGTLNSLLTKLSGGDKVEVSAYTNAFAITQFFG-VLCAPWNGLLMDRLKQKYQK--AAKRTGSSSEA---VALCSMVPSLALTSLLSLGFALCASIPVMQLQYATFIL---QVVSRSFLYGCNAAFLTLAFPSEHFGKLFGLVMALSAIVSLLQ 456          
BLAST of slc43a-7 vs. UniProt/SwissProt
Match: sp|Q0VCM6|LAT4_BOVIN (Large neutral amino acids transporter small subunit 4 OS=Bos taurus OX=9913 GN=SLC43A2 PE=2 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 7.959e-9
Identity = 79/407 (19.41%), Postives = 151/407 (37.10%), Query Frame = 1
Query:    1 VVELSLFSGVFCGFSSLMPICKDFGVFSQCC-------------GTQPGSEGV-------RCAAQEACFGRAFSTWIVVRALMSFVLGMVFDRFGIGIIGVVAAVCLMGGFLCFAFTP----IFNWLLFIAGSLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIVMTMLKVFTDLGAPFWLLCIIHASIGVIIILG----------------------------------------SLTILKNR---------ANEVISKDKGEEVNIESINTESNPEGNKHINDLYNQSVEETFPTVKACVLSPEYLIQMAYFAIMLFRFTFFLSQMSSHFSYLFPTDQAIANHLLSVSNTFFIGSILISPIFGVLLDKYQK--YTIKSLAENKVESPREIYNRVNR 996
            VVE  LFS V  G+ SL+ + K  G +S  C               +P  E V        C AQ+     AF+    + + ++  LG+V D++G   + ++ + C     L  A+        + L+FIA +L      C+  +++ L  +F    +  ++++   Y  SA+    +KV  D GA F ++ ++ A    ++ L                                          +T +  R         A E  +  +G ++ + +++ E           +  Q      P+    V SP  L+ +    +   R  F++  M++   +L   DQA+ +   S+     +  +L +P+ G ++D   K         E K  +P E   + +R
Sbjct:   20 VVENLLFSAVLLGWGSLLIMLKSEGFYSYLCTEPENVTNVTVGATAEPEHEEVSRMNGWLSCKAQDEMLNLAFTVGSFLLSAITLPLGIVMDKYGPRKLRLLGSACFAVSCLLIAYGASNPNSLSVLIFIALALNGFGGMCMTFTSLTLPNMFGDLRSTFIALMIGSYASSAVTFPGVKVIYDFGASFIVILVVWAGCSGLVFLNCFFNWPLEPFPGPEDMDYTVKIKFSWLGFDHKITGKQFYKQVTTVGRRLSVGSSMRSAKEQAALQEGHKLCLSTVDLE-----------VKCQPDATAAPSFMHSVFSPILLLSLVTMCVTQLRLIFYMGAMNNILQFLVSGDQAVVSLYTSIFGVLQLLCLLTAPVIGYIMDWRLKECEDASEEPEEKDANPGEKKKKRDR 415          
BLAST of slc43a-7 vs. UniProt/SwissProt
Match: sp|Q8BSM7|LAT3_MOUSE (Large neutral amino acids transporter small subunit 3 OS=Mus musculus OX=10090 GN=Slc43a1 PE=1 SV=1)

HSP 1 Score: 58.9214 bits (141), Expect = 4.157e-8
Identity = 47/192 (24.48%), Postives = 85/192 (44.27%), Query Frame = 1
Query:    1 VVELSLFSGVFCGFSSLMPICKDFGVFSQCCGTQPGSEGVR--------CAAQEACFGRAFSTWIVVRALMSFVLGMVFDRFGIGIIGVVAAVCLMGGFLCFAF----TPIFNWLLFIAGSLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIVMTMLKVFTDLGAPFWLLCIIHASIGVIIIL 540
            VVE   FS V  G++SL+ + K  G +S  C  +  +   +        C  QE      F+    + +  +  LG++ DRFG   + +V + C        A     T + + L+F+A SL   +  CL  +++ L  +F    +  ++++   Y  SAI    +K+  D G PF ++    + +  +I L
Sbjct:   20 VVENLFFSAVLLGWASLLIMLKKEGFYSSLCPAENRTNTTQDEQHQWTSCDQQEKMLNLGFTIGSFLLSATTLPLGILMDRFGPRPLRLVGSACFAASCTLMALASRDTEVLSPLIFLALSLNGFAGICLTFTSLTLPNMFGNLRSTFMALMIGSYASSAITFPGIKLIYDAGVPFTVIMFTWSGLACLIFL 211          
BLAST of slc43a-7 vs. UniProt/SwissProt
Match: sp|Q8NBI5|S43A3_HUMAN (Solute carrier family 43 member 3 OS=Homo sapiens OX=9606 GN=SLC43A3 PE=1 SV=2)

HSP 1 Score: 56.225 bits (134), Expect = 2.785e-7
Identity = 42/161 (26.09%), Postives = 76/161 (47.20%), Query Frame = 1
Query:   19 FSGVFCGFSSLMPICKDFGVFSQCCGTQPGSEG-----VRCAAQEACFGRAFSTWIVVRALMSFVLGMVFDRFGIGIIGVVAAVCLMGGFLCFAFTPIFNW-LLFIAGSLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIVMTMLKVFTDLG 483
            F+GV  G+ SL+ + K+   F   CG   G  G       C AQ+  F   F+    +   M+F  G +FDRF   +  ++A        L  AFT   +  LLF+A  +LT+      ++N+ +  +F    + ++++ +  +D S+ V  ++K+  + G
Sbjct:   23 FAGVLFGWPSLVFVFKNEDYFKDLCGPDAGPIGNATGQADCKAQDERFSLIFTLGSFMNNFMTFPTGYIFDRFKTTVARLIAIFFYTTATLIIAFTSAGSAVLLFLAMPMLTIGGILFLITNLQIGNLFGQHRSTIITLYNGAFDSSSAVFLIIKLLYEKG 183          
BLAST of slc43a-7 vs. TrEMBL
Match: A0A0H3YJM1 (Slc43a-7 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=slc43a-7 PE=2 SV=1)

HSP 1 Score: 828.55 bits (2139), Expect = 0.000e+0
Identity = 411/411 (100.00%), Postives = 411/411 (100.00%), Query Frame = 1
Query:    1 VVELSLFSGVFCGFSSLMPICKDFGVFSQCCGTQPGSEGVRCAAQEACFGRAFSTWIVVRALMSFVLGMVFDRFGIGIIGVVAAVCLMGGFLCFAFTPIFNWLLFIAGSLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIVMTMLKVFTDLGAPFWLLCIIHASIGVIIILGSLTILKNRANEVISKDKGEEVNIESINTESNPEGNKHINDLYNQSVEETFPTVKACVLSPEYLIQMAYFAIMLFRFTFFLSQMSSHFSYLFPTDQAIANHLLSVSNTFFIGSILISPIFGVLLDKYQKYTIKSLAENKVESPREIYNRVNRCFFVPSIICSCAMIVSSSLMFVSNQYSFYVVFSSITVMKSLLFAINASYIFSAFPKKYFGTLIGAVFLTTGFLNLLQQV 1233
            VVELSLFSGVFCGFSSLMPICKDFGVFSQCCGTQPGSEGVRCAAQEACFGRAFSTWIVVRALMSFVLGMVFDRFGIGIIGVVAAVCLMGGFLCFAFTPIFNWLLFIAGSLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIVMTMLKVFTDLGAPFWLLCIIHASIGVIIILGSLTILKNRANEVISKDKGEEVNIESINTESNPEGNKHINDLYNQSVEETFPTVKACVLSPEYLIQMAYFAIMLFRFTFFLSQMSSHFSYLFPTDQAIANHLLSVSNTFFIGSILISPIFGVLLDKYQKYTIKSLAENKVESPREIYNRVNRCFFVPSIICSCAMIVSSSLMFVSNQYSFYVVFSSITVMKSLLFAINASYIFSAFPKKYFGTLIGAVFLTTGFLNLLQQV
Sbjct:    1 VVELSLFSGVFCGFSSLMPICKDFGVFSQCCGTQPGSEGVRCAAQEACFGRAFSTWIVVRALMSFVLGMVFDRFGIGIIGVVAAVCLMGGFLCFAFTPIFNWLLFIAGSLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIVMTMLKVFTDLGAPFWLLCIIHASIGVIIILGSLTILKNRANEVISKDKGEEVNIESINTESNPEGNKHINDLYNQSVEETFPTVKACVLSPEYLIQMAYFAIMLFRFTFFLSQMSSHFSYLFPTDQAIANHLLSVSNTFFIGSILISPIFGVLLDKYQKYTIKSLAENKVESPREIYNRVNRCFFVPSIICSCAMIVSSSLMFVSNQYSFYVVFSSITVMKSLLFAINASYIFSAFPKKYFGTLIGAVFLTTGFLNLLQQV 411          
BLAST of slc43a-7 vs. TrEMBL
Match: A0A4Z2CQ55 (Solute carrier family 43 member 3 OS=Schistosoma japonicum OX=6182 GN=EWB00_008422 PE=4 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 6.589e-49
Identity = 138/430 (32.09%), Postives = 223/430 (51.86%), Query Frame = 1
Query:    1 VVELSLFSGVFCGFSSLMPICKDFGVFSQCCGTQPGSEGVRCAAQEACFGRAFSTWIVVRALMSFVLGMVFDRFGIGIIGVVAAVCLMGGFLCFAFT-----PIFNWLLFIAGSLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIVMTML---KVFTDLGAPFWLLCIIHASIGVIIIL-----GSLTILK-NRANEVISKDKGEEVNIESINTESNPEGNKHINDLYNQSVEETFPTVKACVLSPEYLIQMAYFAIMLFRFTFFLSQMSSHFSYLFPTDQAIANHLLSVSNTFFIGSILISPIFGVLLDKYQKYTIKSLAENKVESPREIYNR----VNRCFFVPS-IICSCAMIVSSSLMFVSNQYSFYVVFSSITVMKSLLFAINASYIFSAFPKKYFGTLIGAVFLTTGFLNLLQQV 1233
            +++L LF G + GF+SL+ I K  G+FS  C TQ G     C   +  FG +F+ WIV +  +  + G+  D+ G+  + +V+A+    G + FAFT     P+F    FIAG L+ +S+ C  + N  ++ +      + +S+ S  +D S +V  ++        L   F  L I    +G+ I L      S+ + K  R NE  S  +  E  +E     S+ + +K ++++ N    E FPT+K CV S  Y +   +F + LFRF  FLSQ+     YLFPTDQ + +HLL VS+ F +   L++PI G+++D   + T   +A   + S   + N+       C  VP+ II S   I+ S++MF+ N+ + Y  F  + +++SLLF+   SY+ + FP +YFGTL G      G  +LLQ +
Sbjct:   25 ILDLFLFGGYYYGFNSLIGIYKSLGLFSYNC-TQYG-----CMYDDNMFGISFNVWIVTQMCLITLAGIFMDKVGLRPLKIVSALLYAAGTVMFAFTTGKVAPLF----FIAGILVALSSICSLMCNHQISSMLPQIRGLCISLFSGAFDSSTVVAYVISKNHAHFSLQWSFVSLAIGSLIMGIFIALFVLSKKSVDMAKFARVNEKESIFRSRESCLEE---SSSVDIDKELSNVIN----ERFPTLKKCVFSASYALINLWFLLGLFRFAMFLSQLYKQLVYLFPTDQQLVDHLLEVSSVFSMCGFLVAPISGLIIDLSLRRTRDKVANMLINSKFNLSNKKMYYTYICGLVPALIIMSIFAIILSAMMFIPNKTAIYTAFVCLVIVRSLLFSSFVSYLLTGFPIRYFGTLNGISSAIAGLFSLLQHI 437          
BLAST of slc43a-7 vs. TrEMBL
Match: A0A4Z2D7V3 (Solute carrier family 43 member 3 OS=Schistosoma japonicum OX=6182 GN=EWB00_003676 PE=4 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 1.717e-47
Identity = 127/428 (29.67%), Postives = 233/428 (54.44%), Query Frame = 1
Query:    1 VVELSLFSGVFCGFSSLMPICKDFGVFSQCCGTQPGSEGVRCAAQEACFGRAFSTWIVVRALMSFVLGMVFDRFGIGIIGVVA-----AVCLMGGFLCFAFTPIFNWLLFIAGSLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIVMTMLKVFTDLGAPF-WLLCIIHASIGVIIILG--SLTILKNRANEV----ISKDKGEEVNIESINTESNPEGNKHINDLYNQSVEETFPTVKACVLSPEYLIQMAYFAIMLFRFTFFLSQMSSHFSYLFPTDQAIANHLLSVSNTFFIGSILISPIFGVLLD---KYQKYTIKSLAENKVE--SPREIYNRVNRCFFVPSIICSCAMIVSSSLMFVSNQYSFYVVFSSITVMKSLLFAINASYIFSAFPKKYFGTLIGAVFLTTGFLNLLQQV 1233
            ++++ LF G+  GF+SL+ + K  G+F+  C T+ G     C   ++ FG  F+ W+V + ++    G++ D  G+ ++ +VA       CLM GF      P+F    + AG L+ + + C  + N  ++ +F  F  + +S++S  YD S ++  ++ + T L  PF W   I+  ++G +I+ G  +L IL  +  ++      K +GE +  E  + ES+ + + H     +  ++E FP++K+C+LS  Y++   +F   LFRF+F+LS ++ H + +F  DQ +A+HLL  S+ FF+ S L+SPI G+++D   +  +  IK++   K +  SP  +Y  +         I +   ++ S +M++ N  + Y  F  + V++S LF+   S++ SAFP +YFGTL G     +G L+L+Q +
Sbjct:   25 IIDVFLFGGIHYGFNSLIHVYKSVGLFAYNC-TEEG-----CMYNDSMFGVVFTVWMVSQMVLIVFAGIMMDTVGLRVLKLVAVGMYCTGCLMFGFTTATTVPLF----YAAGVLVALGSICSLICNHQVSSMFPQFRGLCISLLSGAYDSSTVIAYVISL-TYLLFPFKWSFIIL--AVGSVIVGGFVALFILTRKCGDMGKFSSHKRRGEAL-CEETSIESSTQVDIHSE--VSSVLDERFPSLKSCILSLPYMMINIWFTFGLFRFSFYLSHLTKHINGMFSDDQPLADHLLQTSSAFFMSSFLLSPITGLVIDFSLQRARTNIKNMLTTKRDSVSPDNLYYALIVGLVPGQYIMASFAVLLSLMMYIDNHIACYAGFVFLVVVRSFLFSCFISFLLSAFPVRYFGTLNGISSAVSGLLSLMQNL 436          
BLAST of slc43a-7 vs. TrEMBL
Match: A0A0H3YFM8 (Slc43a-5 OS=Schmidtea mediterranea OX=79327 GN=slc43a-5 PE=2 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 7.931e-47
Identity = 130/432 (30.09%), Postives = 211/432 (48.84%), Query Frame = 1
Query:    1 VVELSLFSGVFCGFSSLMPICKDFGVFSQCCG-------TQPGSEGVRCAAQEACFGRAFSTWIVVRALMSFVLGMVFDRFGIGIIGVVAAVCLMGGFLCFAFTPIFNWLLFIAGSLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIVMTMLKVFTDLGAPFW----------LLCIIHASIGVI-IILGSLTILKNRAN-EVISKD--KGEEVNIESINTESNPEGNKHINDLYNQS-VEETFPTVKACVLSPEYLIQMAYFAIMLFRFTFFLSQMSSHFSYLFPTDQAIANHLLSVSNTFFIGSILISPIFGVLLD-KYQKYTIKSLAENKVESPREIYNRVNRCFFVPSIICSCAMIVSSSLMFVSNQYSFYVVFSSITVMKSLLFAINASYIFSAFPKKYFGTLIGAVFLTTGFLNLLQ 1227
            ++E+  F+ +  GF+SL  + K  GVFSQ C        T        C  Q+  +G  F  W+  R+ M+   G++ D FGI +  +V ++    G   F      +WLL  AG L   +A  + + N  L   F    N+++SI S +   S +V TM+ +   +G P +          L+ II +S  V+   + ++ I   ++N E I++D  K EE   E I T            L+ Q  +   FPT+     S  Y++ M +F++ L+R  FFLSQM S  +YLF  D A+   L   SN FF   I  S   G+LLD + +  T K +     +   + +   ++ + +P ++C+ A+ + S L+ + NQY +Y++F    + +S    +  S+I S+FPKKYFGTL+G   L +G +NL Q
Sbjct:   19 LIEMFFFTVIIYGFNSLSYVYKSLGVFSQLCDANNTRTFTNESQGFTTCFNQDLLYGNIFVIWVSFRSAMAIPGGIMMDHFGIKLSKIVGSIIFSIGCFLFGIVQYNSWLLIPAGCLTAYAALIVTMVNFSLADNFGSHKNLMISIESGVMGSSMLVFTMISLLYSIGVPLYGSFTVLAISSLITIICSSYFVLPYFIRTVDIPSFKSNYETITQDDFKDEEAKQELIVTMG----------LHRQRFLMNCFPTIWKAFFSKRYILNMLFFSMTLYRLIFFLSQMGSQLTYLFKNDMAMVKKLQFQSNLFFAFGIFASLFSGLLLDFQLKNTTAKVMKFYMTKQSDKHFYLYDQVYIIPCLMCATAIFIPSLLVGIPNQYVYYMIFVLFCIGRSFNACLLGSFIISSFPKKYFGTLVGITILFSGVINLSQ 440          
BLAST of slc43a-7 vs. TrEMBL
Match: A0A0H3YKI8 (Slc43a-1 OS=Schmidtea mediterranea OX=79327 GN=slc43a-1 PE=2 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 5.645e-45
Identity = 129/420 (30.71%), Postives = 213/420 (50.71%), Query Frame = 1
Query:    4 VELSLFSGVFCGFSSLMPICKDFGVFSQCCGTQPGSEGVRCAAQEACFGRAFSTWIVVRALMSFVLGMVFDRFGIGIIGVVAAVCLMGGFLCFAFTPIF---NWLLFIAGSLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIVMTMLKVFTDLGAPFWLLCIIHASIGVIIILGSLTILKNRANEVISKDKGEEVNIESINTESNPEGNKHI------NDLYNQSVEETFPTVKACVLSPEYLIQMAYFAIMLFRFTFFLSQMSSHFSYLFPTDQAIANHLLSVSNTFFIGSILISPIFGVLLDKYQKYTIKSLAENKVESPRE---IYNRVNRCFFVPSIICSCAMIVSSSLMFVSNQYSFYVVFSSITVMKSLLFAINASYIFSAFPKKYFGTLIGAVFLTTGFLNLLQ 1227
            +E+  +SG+  G +SL+PI K+ G F         +       Q   FG    T I    L SF LG+V DR+GI    +++A  L+ G  C  F+  F   + L+F A  LL + A  + + N  L ++   F N+++SI S  +  SA+++T +      G       +     G I+++ S   L ++ + + +K+    +N ES N   N + + ++       + Y  S    FP +K  + +  +L Q+ +  I  FRF+FFL+Q+S      F  D+  A  +L V N FFI S++ISPI G+++D YQK        N+V   ++    Y  + +CF +P +ICS A +  S L+ + N+ + Y+ + + TV +  +F++NASYI SAFP+KYFG L G      G ++ LQ
Sbjct:   34 IEMIFYSGIMFGLNSLLPILKENGFFHNQFNRTYDNANATSTKQNETFGYILITGIASCHLFSFPLGLVMDRYGIKTTKLISASSLLFG--CLLFSSCFLIRDILIFPAFVLLGIFAQSICICNFPLAILVPKFQNIIISIFSGSFSSSAMMLTFVLYAYQRGIDVSTSILTIGISGFILMICSRKFLLDKVDRIKAKEILVTLNGESDNRIRNCKSDSYLMTSIMKQENYKNS---QFPRMKTILRNHYFLFQLFFMVITFFRFSFFLAQLSVQMEKNFSDDETKAKSILLVGNYFFIPSVVISPIVGLMID-YQK--------NRVSPSKDQEAFYKSILKCFGIPMLICSLANLSMSILIIIPNEVAMYMAYLACTVTRCFMFSLNASYIISAFPRKYFGKLFGLNITICGCVSFLQ 439          
BLAST of slc43a-7 vs. Ensembl Cavefish
Match: slc43a3a (solute carrier family 43 member 3 [Source:NCBI gene;Acc:103029120])

HSP 1 Score: 84.7297 bits (208), Expect = 2.422e-17
Identity = 99/435 (22.76%), Postives = 187/435 (42.99%), Query Frame = 1
Query:   19 FSGVFCGFSSLMPICKDFGVFSQCCGTQPGSEGV---RCAAQEACFGRAFSTWIVVRALMSFVLGMVFDRFGIGIIGVVAAVCLMGGFLCFAFT-PIFNWLLFIAGSLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIVMTMLKVFTDLGAPFWLLCIIHASIGVIIILGSLTIL--------------------KNRANEVISKDKGEEVNIESINTESNPEGNKHINDLYNQ--SVEETFP--TVKACVLSPEYLIQMAYFAIMLFRFTFFLSQMSSHFSYLFPTDQAIANHLLSVSNTFFIGSILISPIFGVLLDKYQKYTIKSLAENKVESPREIYNRVNRCFFVPSIICS----CAMIVSSSLMFVSNQYSFYVVFSSITVMKSLLFAINASYIFSAFPKKYFGTLIGAVFLTTGFLNLLQ 1227
            F+GV  G++SL+ + K+ G FS  C     + G     C+AQ+  F   F+    +   ++   G +FDRFG     ++A      G L  A +    ++L F A S + +      L+NI +  +F    + ++++ +  +D S+ V  ++KV  + G       +  +   VI +L +L ++                    K+ +  V   +   E+   +  TE+  +    +    N   SVE T    + K+CVLS  +L  + + ++M  R   F+  ++   + L   D    +   +      +  I  +P  G+L+D+++    K+L   + E   ++ + V    F+ S+ C     CA +    L         Y+ F    + +S L+  NA++I  AFP ++FG L G V   +  ++LLQ
Sbjct:   28 FAGVVFGWASLVFVLKNDGYFSDLCVNVTEANGTTVTDCSAQDERFSLIFTVASFMNNFLTLPNGFIFDRFGTMATRLLAIFLYTLGTLLVALSSKALSFLFFPAISFIAVGGILFLLTNIQVGNLFGTHRSTIITLYNGAFDSSSAVFLIIKVLREKGISLRSSFLFLSVCDVIHLLRTLFLMPKSHIPYPVPENYKYGVTCGKSNSYNVEEFEATRELKYVADTTETAQDRESELLKCENSAPSVEPTGKDNSFKSCVLSWFFLWHLIWLSVMQLRHYLFIGTLNPMLNRLANQDPDTVSQYTNAFAITQLTGIFCAPWNGLLMDRHKG---KALKPGETEKEADLRSSV-LSLFITSLQCLLFSICATVPLLPLQ--------YITFILQVLNRSFLYGGNAAFISIAFPAQHFGKLYGLVMSLSAVVSLLQ 450          
BLAST of slc43a-7 vs. Ensembl Cavefish
Match: slc43a3a (solute carrier family 43 member 3 [Source:NCBI gene;Acc:103029120])

HSP 1 Score: 84.7297 bits (208), Expect = 2.422e-17
Identity = 99/435 (22.76%), Postives = 187/435 (42.99%), Query Frame = 1
Query:   19 FSGVFCGFSSLMPICKDFGVFSQCCGTQPGSEGV---RCAAQEACFGRAFSTWIVVRALMSFVLGMVFDRFGIGIIGVVAAVCLMGGFLCFAFT-PIFNWLLFIAGSLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIVMTMLKVFTDLGAPFWLLCIIHASIGVIIILGSLTIL--------------------KNRANEVISKDKGEEVNIESINTESNPEGNKHINDLYNQ--SVEETFP--TVKACVLSPEYLIQMAYFAIMLFRFTFFLSQMSSHFSYLFPTDQAIANHLLSVSNTFFIGSILISPIFGVLLDKYQKYTIKSLAENKVESPREIYNRVNRCFFVPSIICS----CAMIVSSSLMFVSNQYSFYVVFSSITVMKSLLFAINASYIFSAFPKKYFGTLIGAVFLTTGFLNLLQ 1227
            F+GV  G++SL+ + K+ G FS  C     + G     C+AQ+  F   F+    +   ++   G +FDRFG     ++A      G L  A +    ++L F A S + +      L+NI +  +F    + ++++ +  +D S+ V  ++KV  + G       +  +   VI +L +L ++                    K+ +  V   +   E+   +  TE+  +    +    N   SVE T    + K+CVLS  +L  + + ++M  R   F+  ++   + L   D    +   +      +  I  +P  G+L+D+++    K+L   + E   ++ + V    F+ S+ C     CA +    L         Y+ F    + +S L+  NA++I  AFP ++FG L G V   +  ++LLQ
Sbjct:   28 FAGVVFGWASLVFVLKNDGYFSDLCVNVTEANGTTVTDCSAQDERFSLIFTVASFMNNFLTLPNGFIFDRFGTMATRLLAIFLYTLGTLLVALSSKALSFLFFPAISFIAVGGILFLLTNIQVGNLFGTHRSTIITLYNGAFDSSSAVFLIIKVLREKGISLRSSFLFLSVCDVIHLLRTLFLMPKSHIPYPVPENYKYGVTCGKSNSYNVEEFEATRELKYVADTTETAQDRESELLKCENSAPSVEPTGKDNSFKSCVLSWFFLWHLIWLSVMQLRHYLFIGTLNPMLNRLANQDPDTVSQYTNAFAITQLTGIFCAPWNGLLMDRHKG---KALKPGETEKEADLRSSV-LSLFITSLQCLLFSICATVPLLPLQ--------YITFILQVLNRSFLYGGNAAFISIAFPAQHFGKLYGLVMSLSAVVSLLQ 450          
BLAST of slc43a-7 vs. Ensembl Cavefish
Match: slc43a3b (solute carrier family 43 member 3 [Source:NCBI gene;Acc:103033106])

HSP 1 Score: 72.0182 bits (175), Expect = 2.954e-13
Identity = 92/438 (21.00%), Postives = 183/438 (41.78%), Query Frame = 1
Query:    1 VVELSLFSGVFCGFSSLMPICKDFGVFSQCC--GTQPGSEGVRCAAQEACFGRAFSTWIVVRALMSFVLGMVFDRFGIGIIGVVAAVCLMGGFLCFAFTPI-FNWLLFIAGSLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIVMTMLKVFTDLGAPFWLLCIIHASIGVIIILGSLTILKNR-------------------ANEVISKDKGEEVNIESIN-TESNPEGNKHINDLYNQSVEETFPTVKACVLSPEYLIQMAYFAIMLFRFTFFLSQMSSHFSYLFPTDQAIANHLLSVSNTFFIGS---ILISPIFGVLLDKYQKYTIKSLAENKVESPREIYNRV-NRCFFVPSII--CSCAMIVSSSLMFVSNQYSFYVVFSSITVMKSLLFAINASYIFSAFPKKYFGTLIGAVFLTTGFLNLLQ 1227
            +VE   F+G   G++SL+ + K  G FS  C   T  G+    C+ Q+  F   F+    +    +   G +FD  G  +  +V       G L  AF+    + LL+ A S + +      ++N+ +  +F    + ++++ +  +D S+ V  ++K+    G       I  +S  V+ ++ +  +L                            K++    NI+     E  P  +++  +        T  + K+C+LS  +L  + + ++M  R   F+  ++   + L   D A+ +   + +N F I     IL +P  G+++D++++   K   E + E+  ++   + + C      +    CA I    L         Y+ F    + +S L+  NA++I  AFP  +FG + G V   +  ++LLQ
Sbjct:   21 LVECLCFAGAVFGWASLVFVLKSDGYFSYLCVNKTVNGTITEDCSGQDEQFSIIFTVASFMNNFFTLPNGFLFDHCGTTVTRLVGISIYTTGALLIAFSDAALSILLYPALSFIAVGGILFLVTNMQVGNLFGTHRSTIITLYNGAFDSSSAVFLVVKLLFQDGISLRSCLIFLSSCSVLHLIRTFLLLPRSHIPYPLPENYSYGLTCGKAERSPTPKNRTANGNIQDSQVNERTPFHSENSTEASKTETAVTERSFKSCILSWFFLWHLLWLSVMQLRHYLFIGTLNPMLNRLTDGDPALVS---TYTNAFAITQLCGILCAPWNGLIMDRHKR---KPREEGQSETEADLKAAILSLCLTALQCVLFSLCAAIPVLPLQ--------YLTFILQVLNRSFLYGGNAAFISLAFPPAHFGKVYGTVMALSAVVSLLQ 444          
BLAST of slc43a-7 vs. Ensembl Cavefish
Match: slc43a3b (solute carrier family 43 member 3 [Source:NCBI gene;Acc:103033106])

HSP 1 Score: 72.0182 bits (175), Expect = 3.178e-13
Identity = 93/440 (21.14%), Postives = 186/440 (42.27%), Query Frame = 1
Query:    1 VVELSLFSGVFCGFSSLMPICKDFGVFSQCC--GTQPGSEGVRCAAQEACFGRAFSTWIVVRALMSFVLGMVFDRFGIGIIGVVAAVCLMGGFLCFAFTPI-FNWLLFIAGSLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIVMTMLKVFTDLGAPFWLLCIIHASIGVIIILGSLTILKNR-------------------ANEVISKDKGEEVNIESIN-TESNPEGNKHINDLYNQSVEETFPTVKACVLSPEYLIQMAYFAIMLFRFTFFLSQMSSHFSYLFPTDQAIANHLLSVSNTFFIGS---ILISPIFGVLLDKYQKYTIKSLAENKVESPREIYNRV-NRCFFVPSIICS----CAMIVSSSLMFVSNQYSFYVVFSSITVMKSLLFAINASYIFSAFPKKYFGTLIGAVFLTTGFLNLLQ 1227
            +VE   F+G   G++SL+ + K  G FS  C   T  G+    C+ Q+  F   F+    +    +   G +FD  G  +  +V       G L  AF+    + LL+ A S + +      ++N+ +  +F    + ++++ +  +D S+ V  ++K+    G       I  +S  V+ ++ +  +L                            K++    NI+     E  P  +++  +        T  + K+C+LS  +L  + + ++M  R   F+  ++   + L   D A+ +   + +N F I     IL +P  G+++D++++   K   E + E+  ++   + + C  + ++ C     CA I    L         Y+ F    + +S L+  NA++I  AFP  +FG + G V   +  ++LLQ
Sbjct:   21 LVECLCFAGAVFGWASLVFVLKSDGYFSYLCVNKTVNGTITEDCSGQDEQFSIIFTVASFMNNFFTLPNGFLFDHCGTTVTRLVGISIYTTGALLIAFSDAALSILLYPALSFIAVGGILFLVTNMQVGNLFGTHRSTIITLYNGAFDSSSAVFLVVKLLFQDGISLRSCLIFLSSCSVLHLIRTFLLLPRSHIPYPLPENYSYGLTCGKAERSPTPKNRTANGNIQDSQVNERTPFHSENSTEASKTETAVTERSFKSCILSWFFLWHLLWLSVMQLRHYLFIGTLNPMLNRLTDGDPALVS---TYTNAFAITQLCGILCAPWNGLIMDRHKR---KPREEGQSETEADLKAAILSLC--LTALQCVLFSLCAAIPVLPLQ--------YLTFILQVLNRSFLYGGNAAFISLAFPPAHFGKVYGTVMALSAVVSLLQ 444          
BLAST of slc43a-7 vs. Ensembl Cavefish
Match: slc43a1b (large neutral amino acids transporter small subunit 3 [Source:NCBI gene;Acc:103021346])

HSP 1 Score: 66.6254 bits (161), Expect = 1.581e-11
Identity = 96/468 (20.51%), Postives = 193/468 (41.24%), Query Frame = 1
Query:    1 VVELSLFSGVFCGFSSLMPICKDFGVFSQCC---GTQ--------PGSEGVRCAAQEACFGRAFSTWIVVRALMSFVLGMVFDRFGIGIIGVVAAVCL---MGGFLCFAFTP-IFNWLLFIAGSLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIVMTMLKVFTDLGAPFWLLCIIHASIGVIIILG---SLTILKNRANEVISKDKGEEVN-------------IESINTESNPEGNKHINDLYNQS-----VEETFPTVKACVLSPEYLIQMAYFAIMLFRFTFFLSQMSSHFSYLF-------PTDQAI-ANHLLSVSNTFFIGSI----LIS-PIFGVLLD-------KYQKYTIKSLAENKVESPREIYNRVN--RCFFVPSIICSCAMIVSSSLMFVSNQYSFYVVFSSITVMKSLLFAINASYIFSAFPKKYFGTLIGAVFLTTGFLNLLQQ 1230
            V+E  LFS V  G+ SL+ + K+ G +S  C   GT+          +E + C  QE      F+    + +  +  LG++ D++G   + ++ + C    MG     ++ P + + ++F+A S       CL  +++ L  +F    + ++S++   Y  SA+    +K+  D G  F ++  + A +  ++ +    +  +      E ++  K   +N                + TE     NK +++ + QS       +  P  +  V SP +L  +    +   R  F++  M+    +L        P D  + A   +S  ++ F G++    L+S P+ G ++D       + +K +I    +  ++  R+I    N  R F   +++     I+S     + N     V F   T ++  + +       + +P  +FGTL G   L +    L+QQ
Sbjct:   20 VIENLLFSAVLLGWGSLLLMLKNEGFYSHLCTENGTELRANRSSGDSTEWLSCVEQEEILNLGFTIGSFIISGATLPLGILMDKYGPRPLRLLGSFCFALSMGLIAVASYDPSVLSAIIFVAVSFNGFGGICLTFTSLTLPNMFGNIRSTILSLMIGSYASSAVTFPGVKLIYDAGVSFHVIFWVWAGLAGLVFINCFLNWPVEPFPGPEEVNYTKKVTLNSVAMDHKVTGDRSYSHVTTEEQEISNKELSEEHKQSNGVATQSQGSPPFRRSVCSPIFLWSLITMPMTQLRIIFYMGAMNKMLEFLVTHGDPNTPEDLMLEAEEQVSFYSSIF-GTLQLLCLVSCPLIGYIMDWKMKECEEEEKKSIADGNKRPLKRDRKIQKLTNAIRAFIFTNLLLVGFGIIS----LIDNLPVQVVSFILHTAVRGFIHSCCGGLYAAVYPSNHFGTLTGMQSLVSALFALIQQ 482          
BLAST of slc43a-7 vs. Ensembl Yeast
Match: FMP42 (Putative protein of unknown function; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies; physical interaction with Atg27p suggests a possible role in autophagy [Source:SGD;Acc:S000004834])

HSP 1 Score: 48.521 bits (114), Expect = 1.344e-6
Identity = 70/355 (19.72%), Postives = 147/355 (41.41%), Query Frame = 1
Query:   22 SGVFCGFSSLMPICKDFGVFSQCCGTQPGSEGVRCAAQEACFGRAFSTWIVVRALMSFVLGMVFDRFGIGIIGVVAAVCLM----GGFLCFAFTPIFNWLLFIAG-SLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIVMTMLKVFTDLGAP------FWLLCIIHASIGVIIILGSLTILKNRANEVISK--------------------------DKGEEVNIESINTE-----SNPEGNKHINDLYNQSVEETFPTVKACVL-------------SPEYLIQMAYFAIMLFRFTFFLSQMSSHFSYLFPTDQAIANHLLSVSNTFF-IGSILISPIFGVLLDK 918
            +G+  GF++L PI    GV+ + C  + G   + C AQ+      F+    V  +M+  +G + D +G  + G++ + CL+    G F+  A   +  W  ++ G +LL ++   + +S   L   F   S  ++++++  +D S+ +  + ++      P      F+ L +I   + V I+   LTI+ + + + ++                           D+ E  ++ +I  E     S P+  K + + Y   VE+        +              SP + + + +  + + R  +F++ + +   YL   D  +A  L S+ +    +G  +  P  G+LLD 
Sbjct:   23 AGIIFGFAALKPILISEGVYHELCDPKDGDR-LLCTAQDLKLNFIFALSATVTNIMALPVGKILDMYGPRVCGIIGS-CLLFLASGNFIS-AKHLVSLWDPYLVGYTLLAVAGPFVFISCFQLANSFPQRSGTVLALLTGSFDSSSALFLLYRLLYQNWFPTLNVSRFFTLYLI---VPVFILACQLTIMPHSSYKTVNHIAKIAVEGLDENGRLIEGDTGSGIIPDEQERQSLIAIEREEDSIPSRPQRRKSVLETY---VEDKLQKKSGGIFGVLHGKSAYEQIKSPWFYLMLLFALVAMLRINYFIATVRTQEEYLL-NDPDLALKLNSIFDMLLPLGGAVSIPFIGLLLDH 367          
BLAST of slc43a-7 vs. Ensembl Nematostella
Match: EDO39904 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8P0])

HSP 1 Score: 49.2914 bits (116), Expect = 2.182e-6
Identity = 59/239 (24.69%), Postives = 101/239 (42.26%), Query Frame = 1
Query:    1 VVELSLFSGVFCGFSSLMPICKDFGVFSQCCGTQ-------PGSEGVRCAAQEACFGRAFSTWIVVRALMSFVLGMVFDRFGIGIIGVVAAV--CLMGGFLCFA--FTPIFNWLLFIAGSLLTMS---AHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIVMTMLKVFTDLGAPFWLLCIIHASIGVIIILGSLTILKNRANEVISKDKGEEVNIESINTESNPEGNKHINDLYNQ 675
            VVE+SLF+    G+SSL+ + K   VF   C             E   C AQ+     A +    V A+M FV+G   DR G  ++ ++++V   + GGFL      TP+   +LF   +LL M    A   A    G+T  F  + +++ S  +     SA+   ++K+  + G  +  LC         + L S+ +  N  N   +     +   E+ + +      + + +LY  
Sbjct:   22 VVEMSLFASPLLGWSSLVFVLKGERVFFHLCPENVTRLVPSDNDELRGCGAQDDRLNLALTIACFVNAIMMFVMGWAIDRVGAKMVKILSSVLFAMSGGFLALTTQRTPM---MLF--ATLLVMGVAYAGIYASITRGVTA-FGKWQSVVNSAYNCAMQSSALTFLLVKMLYEHGVAYQTLCYGFVGACTALFLSSVVVFPNIQNNTSNSTTKPDKMSEAASGDLLGHMRRCVKELYGH 254          
BLAST of slc43a-7 vs. Ensembl Medaka
Match: slc43a3a (solute carrier family 43 member 3-like [Source:NCBI gene;Acc:101160876])

HSP 1 Score: 87.0409 bits (214), Expect = 3.936e-18
Identity = 96/418 (22.97%), Postives = 184/418 (44.02%), Query Frame = 1
Query:    1 VVELSLFSGVFCGFSSLMPICKDFGVFSQCCGTQPGSEGVRCAAQEACFGRAFSTWIVVRALMSFVLGMVFDRFGIGIIGVVAAVCLMGGFLCFAFTPIFNWLLFIAGSLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIVMTMLKVFTDLGAP------FWLLCIIHASIGVIIILGSLTI---LKNRANEVISKDKGEEVNIESINTESNPEGNKHINDLYNQSVEETFPTVKACVLSPEYLIQMAYFAIMLFRFTFFLSQMSSHFSYLFPTDQAIANHLLSVSNTFFIGSILISPIFGVLLDKYQKYTIKSLAENKVESPREIYNRVNRCFFVPSIICSCAMIVSSSLMFVSNQYSFYVVFSSITVMKSLLFAINASYIFSAFPKKYFGTLIGAVFLTTGFLNLLQ 1227
            ++E   F+GV  GF+SL+ + K+ G FS+ C +        C +Q+  F   F+    +   +S V G +FDRFG  +  ++A      G L  AF+   + +LF A S + +    L ++N+ +  +F    + +++I +  +D S+ V  ++KV  + G        F  +C I   +  ++++    I   L +     ++  +    ++E I+     E       L +     +F   ++CVLS  +L  + + +IM  R   F+  ++     L   D  + +   +      +  +L +P  G LLD+++    K  A  + E   ++ +     F     + S    V  S+  +  Q   Y+ F    + +S L+  NA++I  AFP  +FG L G +   +   +LLQ
Sbjct:   20 MLECLCFAGVVFGFASLVFVLKEDGFFSELCISNLEINS-NCTSQDEQFSLVFTIASFLNNFLSLVNGFLFDRFGTFMTRLLAIFVYTTGTLLVAFSTELSLMLFPALSCIGVGGMLLLITNMQVGNLFPAHRSTIITIYNGAFDSSSAVFLLIKVLHEQGVSLRSSFLFLSICSIIHLMRTVLLMPKTHIPHPLPDSYTYGVNCGRANAYDVEQIDDRR--EVMMRSQKLLSICSVRSF---QSCVLSWFFLWHLVWLSIMQLRLYLFIGTLNPTLERLANNDPGLVSRYTNAFAMTQLCGVLCAPWNGFLLDRHKG---KPRAAGETEQEADLRSSCLSLFLTS--LQSLVFSVCVSIPVLPLQ---YLTFILQVLNRSFLYGGNAAFISIAFPACHFGKLYGLMMSLSAVFSLLQ 423          
BLAST of slc43a-7 vs. Ensembl Medaka
Match: slc43a3b (solute carrier family 43 member 3 [Source:NCBI gene;Acc:101166393])

HSP 1 Score: 82.8037 bits (203), Expect = 8.930e-17
Identity = 88/420 (20.95%), Postives = 185/420 (44.05%), Query Frame = 1
Query:    1 VVELSLFSGVFCGFSSLMPICKDFGVFSQCC---GTQPGSEGVRCAAQEACFGRAFSTWIVVRALMSFVLGMVFDRFGIGIIGVVAAVCLMGGFLCFAF-TPIFNWLLFIAGSLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIVMTMLKVFTDLGAPFWLLCIIHASIGVIIILGSLTIL-KNRANEVISKDKGEEVNIESINTE------SNPEGNKHINDLYNQSVEETFPTVKACVLSPEYLIQMAYFAIMLFRFTFFLSQMSSHFSYLFPTDQAIANHLLSVSNTFFIGSILISPIFGVLLDKYQKYTIKSLAENKVESPREIYNRVNRCFFVPSIICSCAMIVSSSLMFVSNQYSFYVVFSSITVMKSLLFAINASYIFSAFPKKYFGTLIGAVFLTTGFLNLLQ 1227
            +VE   F+G   G++SL+ + K+ G FS  C    T  G++ + C+AQ+  F   F+    +   ++   G +FDRFG  +  +        G L  +F T    +LLF A SLL +      ++N+ +  +F    + ++++ +  +D S+ +  ++K+  + G       +  ++  V  IL +L +L +N     +       +N     TE      ++P        L   +  +   + + CV+S  ++  + + ++M  R   F+  ++     L   + ++ +   +      +  +L +P  G+++D+++    K  A  + E   ++   V    F+ ++ C    + +SS          Y+ F    + +S L+  NA+++  AFP  +FG L G V   +   ++LQ
Sbjct:   20 LVECLCFAGAVFGWASLVFVLKEEGYFSSMCVNTTTVNGTQSLDCSAQDEQFSLVFTIASFLNNFLTLPNGFLFDRFGTTVARLFGIFLYTMGTLMVSFSTAALGYLLFPALSLLAVGGILFLMTNMQVGNLFGSRRSTIITLYNGAFDSSSALFLIIKLLHEAGISLRGSFLFLSACSVAHILRTLFLLPRNFIPYPLPDHYTYGMNCGKSETERTEVATNSPHKTAEEAPLTKDAPVKQERSFRECVMSRFFVWHLLWLSVMQLRHYLFIGTLNPMLQRLTAGESSLVSQYTNAFAVTQLCGVLCAPWNGLIMDRHKS---KPRAAGETEQEADLRASV-LSLFLTALQCVLFSVCASSPSLPLQ----YLTFVLQVLNRSFLYGGNAAFLSVAFPSCHFGKLYGLVMALSAVFSILQ 431          
BLAST of slc43a-7 vs. Ensembl Medaka
Match: slc43a1a (solute carrier family 43 member 1 [Source:NCBI gene;Acc:101157303])

HSP 1 Score: 70.8626 bits (172), Expect = 6.502e-13
Identity = 103/461 (22.34%), Postives = 191/461 (41.43%), Query Frame = 1
Query:    1 VVELSLFSGVFCGFSSLMPICKDFGVFSQCCGTQPG--------SEG-----VRCAAQEACFGRAFSTWIVVRALMSFVLGMVFDRFGIGIIGVVAAVCLMGGFLCF-----AFTP-IFNWLLFIAGSLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIVMTMLKVFTDLGAPFWLLCIIHASIGVII---------ILGSLTILKNRANEVISKDKGEEVNIESINTESNPEGNKHINDLYNQSVEETFPT---VKACVLSPEYLIQMAYFAIMLFRFTFFLSQMSSHFSYL------FPTDQAIA------NHLLSVSNTFFIGSILISPIFGVLLDKYQKY----TIKSLAENK--VESPREIYNRVN--RCFFVPSIICSCAMIVSSSLMFVSNQYSFYVVFSSITVMKSLLFAINASYIFSAFPKKYFGTLIGAVFLTTGFLNLLQQ 1230
            V+E  L S V  G+ SL+ + K  G +S  C             S+G     + C  QE      F+    + +  +  LG++ D+FG   I ++ +     G  C       + P   + L+F+A SL      CL  ++I L  +F   S+ ++S++   Y  SA+    +KV  D GA F L+  + A +  ++         I G  T  +   +++++K +      +SI TE++  G+ H +     +   T P     +  V SP +L  +    +   R  F++  M+    +L       P+++ ++      N   S+  T  +  ++  P+ G ++D   K     T  S  E K   +  R+I    N  R F    I+ +  +I+      + N    ++ F   T+++  + +       + +P  +FGTL G   L +  + LLQQ
Sbjct:   20 VIENLLCSAVLLGWGSLLIMLKREGFYSHLCSENDSVVVSIGNSSDGHADHWLTCVDQEEMLNLGFTIGSFLLSATTLPLGILMDKFGPRPIRLMGSSLF--GLSCIIMAASVYNPHALSALIFLALSLNGFGGICLTFTSITLPNMFGAMSSTIMSLMIGSYASSAVTFPGVKVIYDAGASFQLIMWMWAGLAGLVFINCFFNWPIEGFPTPDEVDYSKILTKKELPSSEEKSI-TENHKNGDVHHSAEKLPNGPSTSPNGVPFRRSVFSPIFLWSLVTMGMTQLRIIFYMGAMNKMLEFLVTHGKDHPSEKLVSEAEETVNFYASIFGTMQLLCLVTCPLIGYIMDWRMKECADATAVSSGEEKSGPQRDRKIQKITNAMRAF----ILTNMLLIIFGICCLIENLPLQFLTFILHTMVRGFIHSCCGGLYAAVYPSNHFGTLTGLQSLISAVVALLQQ 473          
BLAST of slc43a-7 vs. Ensembl Medaka
Match: slc43a1b (large neutral amino acids transporter small subunit 3 [Source:NCBI gene;Acc:101159485])

HSP 1 Score: 67.3958 bits (163), Expect = 9.306e-12
Identity = 90/420 (21.43%), Postives = 168/420 (40.00%), Query Frame = 1
Query:   19 FSGVFCGFSSLMPICKDFGVFSQCCGTQ----PGSEGV------RCAAQEACFGRAFSTWIVVRALMSFVLGMVFDRFGIGIIGVVAAVCLMGGFLCFA---FTP-IFNWLLFIAGSLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIVMTMLKVFTDLGAPFWLLCIIHASIGVIIILGSLTILKNRANEVISKDKGEEVNIESINTESNPEGNKHINDLYNQSVEETFPTVKACVLSPEYLIQMAYFAIMLFRFTFFLSQMSSHFSYL-FPTDQAIAN-HLLSVSNTFFIGSILISPIFGVLLDKYQKYTIKSLAENKVESPREIYNRVNRCFFVPSIICSCAMIVSSSLMFVSNQYSFYVVFSSITVMKSLLFAINASYIFSAFPKKYFGTLIGAVFLTTGFLNLLQQ 1230
            FS V  G+ SL+ + K  G +S  C       P    +       C  QE      F+    + +  +  LG++ DRFG   + +V + C        A   + P +F+ L+F+A  L      CL  +++ L  +F    + ++S++   Y  SA+    +K+  DLGA F ++  +   +  ++IL  L    N   E     +        +    +    +H  D ++     + P  ++ V SP +L  +   AI   R  FF+  M+    +L    D    N HL  +S T  +G    S +FG +     +   KS    + +  +++ N +    F      +  ++V   +  + N       F   T+++  + +       + +P  +FG+L G   + +    LLQQ
Sbjct:   26 FSAVLLGWGSLLIMLKSEGFYSHLCTENLTGAPNETFIYYNGWPSCIEQEEVLNLGFTIGSFLLSAATMPLGLLMDRFGPRPVRLVGSSCFAASCAVMAAAAYNPRVFSILIFLAVCLNGFGGICLTFTSLTLPNMFGNIRSTILSLMIGSYASSAVTFPGVKLIYDLGASFRVIMWVWTGLACMVILNCLL---NWPGESFPAPEDIRYTSGGVRGPVDRGQVRHPPDRHDGHRGASVPLCRS-VCSPIFLWSVVTMAITQLRVIFFMGAMNKMLEFLVIHGDPHRKNSHLCLLSPT--VG--FYSSVFGTMQLLCLEDLHKSDPPTRDKKIQKLTNAITAFIFT-----NLLLVVFGVISLIDNLPVQLGAFVLHTMVRGFIHSCCGGLYHAVYPSNHFGSLTGMQSMISAAFALLQQ 432          
BLAST of slc43a-7 vs. Ensembl Medaka
Match: slc43a1b (large neutral amino acids transporter small subunit 3 [Source:NCBI gene;Acc:101159485])

HSP 1 Score: 64.6994 bits (156), Expect = 4.004e-11
Identity = 80/334 (23.95%), Postives = 144/334 (43.11%), Query Frame = 1
Query:   19 FSGVFCGFSSLMPICKDFGVFSQCCGTQPGSEGVRCAAQEACFGRAFSTWIVVRALMSFVLGMVFDRFGIGIIGVVAAVCLMGGFLCFAFTPIFNWLLFIAGSLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIVMTMLKVFTDLGAPFWLLCIIHASIGVIIILGSLTILKNRANEVISKDKGEEVNIESINTESN---PEGNKHINDLYNQSVEETFPTVKAC--VLSPEYLIQMAYFAIMLFRFTFFLSQMSSHFSYL------FPTD--QAIANHLL----SVSNTFFIGSILISPIFGVLLDKYQKYTIKSLAENKVESP 969
            FS V  G+ SL+ + K  G +S  C  +P    + C  QE      F+    + +  +  LG++ DRFG   + +V +        CF+ + +F+ L+F+A  L      CL  +++ L  +F    + ++S++   Y  SA+    +K+  DLGA F ++  +   +  ++IL  L    N   E  S    E++   S+    N   P  +   +  + + +  +  +V  C  V SP +L  +   AI   R  FF+  M+    +L       P++  Q  A   +    SV  T  +  ++  P+ G ++D   K       E + ESP
Sbjct:   26 FSAVLLGWGSLLIMLKSEGFYSHLCTGEPH---LPCIEQEEVLNLGFTIGSFLLSAATMPLGLLMDRFGPRPVRLVGS--------CFS-SSVFSILIFLAVCLNGFGGICLTFTSLTLPNMFGNIRSTILSLMIGSYASSAVTFPGVKLIYDLGASFRVIMWVWTGLACMVILNCLL---NWPGE--SFPAPEDIRYTSVLHGGNLHKPASSLTGSCSHPRLICPSPASVPLCRSVCSPIFLWSVVTMAITQLRVIFFMGAMNKMLEFLVIHGDPHPSEELQREAEEQVGFYSSVFGTMQLLCLVTCPLIGYIMDWRMK-------ECEEESP 335          
BLAST of slc43a-7 vs. Planmine SMEST
Match: SMESG000075262.1 (SMESG000075262.1)

HSP 1 Score: 785.408 bits (2027), Expect = 0.000e+0
Identity = 390/411 (94.89%), Postives = 399/411 (97.08%), Query Frame = 1
Query:    1 VVELSLFSGVFCGFSSLMPICKDFGVFSQCCGTQPGSEGVRCAAQEACFGRAFSTWIVVRALMSFVLGMVFDRFGIGIIGVVAAVCLMGGFLCFAFTPIFNWLLFIAGSLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIVMTMLKVFTDLGAPFWLLCIIHASIGVIIILGSLTILKNRANEVISKDKGEEVNIESINTESNPEGNKHINDLYNQSVEETFPTVKACVLSPEYLIQMAYFAIMLFRFTFFLSQMSSHFSYLFPTDQAIANHLLSVSNTFFIGSILISPIFGVLLDKYQKYTIKSLAENKVESPREIYNRVNRCFFVPSIICSCAMIVSSSLMFVSNQYSFYVVFSSITVMKSLLFAINASYIFSAFPKKYFGTLIGAVFLTTGFLNLLQQV 1233
            VVE+SLFSGVF GF+SL+PI KDFGVFSQ C TQP +E +RCAAQE  FGRAFSTWI+V+ALMSFVLGMVFDRFGI II V+AA+CLMGGFLCFAFTPIFNWLLFIAGSLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIVMTMLKVFTDLGAPFWLLCIIHASIGVIIILGSLTILKNRANEVISKDKGEEVNIESINTESNPEGNKHINDLYNQSVEETFPTVKACVLSPEYLIQMAYFAIMLFRFTFFLSQMSSHFSYLFPTDQAIANHLLSVSNTFFIGSI ISPIFGVLLDKYQKYTIKSLAENKVESPREIYNRVN CFFVPSIICSCAMIVSSSLMFVSNQYSFYVVFSSITVMKSLLFAINASYIFSAFPKKYFGTLIGAVFLTTGFLNLLQQV
Sbjct:   14 VVEMSLFSGVFYGFNSLIPIYKDFGVFSQYCETQPRNESIRCAAQETYFGRAFSTWIIVQALMSFVLGMVFDRFGIRIIKVIAAICLMGGFLCFAFTPIFNWLLFIAGSLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIVMTMLKVFTDLGAPFWLLCIIHASIGVIIILGSLTILKNRANEVISKDKGEEVNIESINTESNPEGNKHINDLYNQSVEETFPTVKACVLSPEYLIQMAYFAIMLFRFTFFLSQMSSHFSYLFPTDQAIANHLLSVSNTFFIGSIFISPIFGVLLDKYQKYTIKSLAENKVESPREIYNRVNGCFFVPSIICSCAMIVSSSLMFVSNQYSFYVVFSSITVMKSLLFAINASYIFSAFPKKYFGTLIGAVFLTTGFLNLLQQV 424          
BLAST of slc43a-7 vs. Planmine SMEST
Match: SMESG000005041.1 (SMESG000005041.1)

HSP 1 Score: 455.677 bits (1171), Expect = 1.073e-158
Identity = 227/419 (54.18%), Postives = 303/419 (72.32%), Query Frame = 1
Query:    1 VVELSLFSGVFCGFSSLMPICKDFGVFSQCCGTQPGSEGVRCAAQEACFGRAFSTWIVVRALMSFVLGMVFDRFGIGIIGVVAAVCLMGGFLCFAFTPIFNWLLFIAGSLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIVMTMLKVFTDLGAPFWLLCIIHASIGVIIILGSLTILKNRANEVISKDKGEEVNIESINT--------ESNPEGNKHINDLYNQSVEETFPTVKACVLSPEYLIQMAYFAIMLFRFTFFLSQMSSHFSYLFPTDQAIANHLLSVSNTFFIGSILISPIFGVLLDKYQKYTIKSLAENKVESPREIYNRVNRCFFVPSIICSCAMIVSSSLMFVSNQYSFYVVFSSITVMKSLLFAINASYIFSAFPKKYFGTLIGAVFLTTGFLNLLQQV 1233
            ++E+S+ SGVF GF++L+PI  + GVFSQ C  +  S  VRC+AQ+  FGRAFSTWIVV+A+MSFVLGM+FD++GI  + ++AAV  + GF+CFAFTP   +L F+ GSLL +SA+ L ++NI L+VIF    N+L+S  SSL+D SAIVMT++K   D GA FWL+C+ +   GV IILGS+ ILK+RA  +++  K  E ++  I+T        +++    +++   Y +SVEE+FPT+K+C+LS EY IQ+ YF I+LFRFTFFLSQ+SS   YLFP   AI++HLL++ N FFIGSI ISPIFG+LLDKYQ YT   L+  K  S R++YN VN CF +PSI+CS  +IV  SLMF+    SFY VF S+T+ KSLL  IN SY+FSAFPK++FGTLIG  FLTT F NL QQ+
Sbjct:   14 LIEMSMLSGVFYGFNALIPIYTNLGVFSQFCVYRNQSTRVRCSAQDTLFGRAFSTWIVVQAIMSFVLGMIFDKYGIRTVKIIAAVFFLSGFICFAFTPKIGYLFFLGGSLLAISAYSLGIANISLSVIFKDRQNLLISFYSSLFDTSAIVMTLIKYLFDFGALFWLVCVSYGCFGVFIILGSVIILKDRAQNLLAYSKTTEYSLSPISTIKETVFSDKNSLASQEYLKHFYERSVEESFPTIKSCILSTEYAIQIFYFDILLFRFTFFLSQLSSQLDYLFPNKLAISDHLLTICNVFFIGSIFISPIFGILLDKYQNYTFVYLSMYKCISARKVYNEVNACFCLPSIVCSLTIIVGLSLMFIPKVISFYFVFVSMTIAKSLLLNINGSYMFSAFPKRFFGTLIGLNFLTTSFCNLFQQL 432          
BLAST of slc43a-7 vs. Planmine SMEST
Match: SMESG000051641.1 (SMESG000051641.1)

HSP 1 Score: 177.178 bits (448), Expect = 2.206e-50
Identity = 130/432 (30.09%), Postives = 211/432 (48.84%), Query Frame = 1
Query:    1 VVELSLFSGVFCGFSSLMPICKDFGVFSQCCG-------TQPGSEGVRCAAQEACFGRAFSTWIVVRALMSFVLGMVFDRFGIGIIGVVAAVCLMGGFLCFAFTPIFNWLLFIAGSLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIVMTMLKVFTDLGAPFW----------LLCIIHASIGVI-IILGSLTILKNRAN-EVISKD--KGEEVNIESINTESNPEGNKHINDLYNQS-VEETFPTVKACVLSPEYLIQMAYFAIMLFRFTFFLSQMSSHFSYLFPTDQAIANHLLSVSNTFFIGSILISPIFGVLLD-KYQKYTIKSLAENKVESPREIYNRVNRCFFVPSIICSCAMIVSSSLMFVSNQYSFYVVFSSITVMKSLLFAINASYIFSAFPKKYFGTLIGAVFLTTGFLNLLQ 1227
            ++E+  F+ +  GF+SL  + K  GVFSQ C        T        C  Q+  +G  F  W+  R+ M+   G++ D FGI +  +V ++    G   F      +WLL  AG L   +A  + + N  L   F    N+++SI S +   S +V TM+ +   +G P +          L+ II +S  V+   + ++ I   ++N E I++D  K EE   E I T            L+ Q  +   FPT+     S  Y++ M +F++ L+R  FFLSQM S  +YLF  D A+   L   SN FF   I  S   G+LLD + +  T K +     +   + +   ++ + +P ++C+ A+ + S L+ + NQY +Y++F    + +S    +  S+I S+FPKKYFGTL+G   L +G +NL Q
Sbjct:   19 LIEMFFFTVIIYGFNSLSYVYKSLGVFSQLCDANNTRTFTNESQGFTTCFNQDLLYGNIFVIWVSFRSAMAIPGGIMMDHFGIKLSKIVGSIIFSIGCFLFGIVQYNSWLLIPAGCLTAYAALIVTMVNFSLADNFGSHKNLMISIESGVMGSSMLVFTMISLLYSIGVPLYGSFTVLAISSLITIICSSYFVLPYFIRTVDIPSFKSNYETITQDDFKDEEAKQELIVTMG----------LHRQRFLMNCFPTIWKAFFSKRYILNMLFFSMTLYRLIFFLSQMGSQLTYLFKNDMAMVKKLQFQSNLFFAFGIFASLFSGLLLDFQLKNTTAKVMKFYMTKQSDKHFYLYDQVYIIPCLMCATAIFIPSLLVGIPNQYVYYMIFVLFCIGRSFNACLLGSFIISSFPKKYFGTLVGITILFSGVINLSQ 440          
BLAST of slc43a-7 vs. Planmine SMEST
Match: SMESG000043545.1 (SMESG000043545.1)

HSP 1 Score: 169.474 bits (428), Expect = 1.543e-47
Identity = 130/420 (30.95%), Postives = 213/420 (50.71%), Query Frame = 1
Query:    4 VELSLFSGVFCGFSSLMPICKDFGVFSQCCGTQPGSEGVRCAAQEACFGRAFSTWIVVRALMSFVLGMVFDRFGIGIIGVVAAVCLMGGFLCFAFTPIF---NWLLFIAGSLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIVMTMLKVFTDLGAPFWLLCIIHASIGVIIILGSLTILKNRANEVISKDKGEEVNIESINTESNPEGNKHI------NDLYNQSVEETFPTVKACVLSPEYLIQMAYFAIMLFRFTFFLSQMSSHFSYLFPTDQAIANHLLSVSNTFFIGSILISPIFGVLLDKYQKYTIKSLAENKVESPRE---IYNRVNRCFFVPSIICSCAMIVSSSLMFVSNQYSFYVVFSSITVMKSLLFAINASYIFSAFPKKYFGTLIGAVFLTTGFLNLLQ 1227
            +E+  +SG+  G +SL+PI K+ G F         +       Q   FG    T I    L SF LG+V DR+GI    +++A  L+ G  C  F+  F   + L+F A  LL + A  + + N  L ++   F N+++SI S  +  SAI++T +      G       +     G I+++ S   L ++ + + +K+    +N ES N   N + + ++       + Y  S    FP +K  + +  +L Q+ +  I  FRF+FFL+Q+S      F  D+  A  +L V N FFI S++ISPI G+++D YQK        N+V   ++    Y  + +CF +P +ICS A +  S L+ + N+ + Y+ + + TV +  +F++NASYI SAFP+KYFG L G      G ++ LQ
Sbjct:   34 IEMIFYSGILFGLNSLLPILKENGFFHNQFNRTYDNANATSTKQNETFGYILITGIASCHLFSFPLGLVMDRYGIKTTKLISASSLLFG--CLLFSSCFLIRDILIFPAFVLLGIFAQSICICNFPLAILVPKFQNIIISIFSGSFSSSAIMLTFVFYAYQRGIDVSTSILTIGISGFILMICSRKFLLDKVDRIKAKEILVTLNGESDNRIRNCKSDSYLMTSIMKQENYKNS---QFPRMKTILRNHYFLFQLFFMVITFFRFSFFLAQLSVQMEKNFSDDETKAKSILLVGNYFFIPSVVISPIVGLMID-YQK--------NRVSPSKDQEAFYKSILKCFGIPMLICSLANLSMSILIIIPNEVAMYMAYLACTVTRCFMFSLNASYIISAFPRKYFGKLFGLNITICGCVSFLQ 439          
BLAST of slc43a-7 vs. Planmine SMEST
Match: SMESG000043543.1 (SMESG000043543.1)

HSP 1 Score: 154.451 bits (389), Expect = 6.407e-42
Identity = 121/422 (28.67%), Postives = 210/422 (49.76%), Query Frame = 1
Query:    4 VELSLFSGVFCGFSSLMPICKDFGVFSQCCGTQPGSEGVRCAAQEACFGRAFSTWIVVRALMSFVLGMVFDRFGIGIIGVVAAVCLMGGFLCFAFTPIF-NWLLFIAGSLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIV-----MTMLKVFTDLGAPFWLLC---IIHASIGVIIILGSLTILKNRA-NEVISKDKGEEVNIESINTESNPEGN--KHINDLYNQSV--EETFPTVKACVLSPEYLIQMAYFAIMLFRFTFFLSQMSSHFSYLFPTDQAIANHLLSVSNTFFIGSILISPIFGVLLDKYQKYTIKSLAENKVESPREIYNRVNRCFFVPSIICSCAMIVSSSLMFVSNQYSFYVVFSSITVMKSLLFAINASYIFSAFPKKYFGTLIGAVFLTTGFLNLLQ 1227
            +E+  +SG+  G + L+P  K    F   C     S    C  Q   FG    T I   ++ S  LG+ FD+FG     +  ++    G L FA + +  + +LF A  +L +SA  LA+ N+ L  +      ++V++    +D S IV     +T L  F+ L A F ++    +    +   +++G++  +K +      S +K    +I S+  E    G   K  + L N +   +  +P +K  + S  +LIQ+ ++ I+ FRF+FFL+Q+S      F ++  +  +LLSVS+ FF+ SI I+PI G+++D   K  IK + +     P ++Y      F +P IIC     + +  + V+  ++ Y+ + S+TV ++ LF + AS+I +AFP KYFG L G    T G ++ +Q
Sbjct:   32 IEMLFYSGILYGLNVLIPSLKREKYFFDLCSPMLHSANASCVKQNQLFGYNLITGITAFSISSLPLGIFFDKFGYKYTKIFCSLLCFFGCLLFALSSVIKSEMLFPAMLVLGVSAQSLAVCNLPLGGLVPDHETLIVALYVGSFDTSVIVFIFINLTYLSGFSLL-ASFLIMAFTGLALMELDAFLLMGAVDQIKAKPLKSFTSNNKIGMEDIASVTDEVQASGAVIKEPDTLANLNAYRDSIYPGLKQILSSRYFLIQLMFYIIVFFRFSFFLAQLSIQLDTGFVSNHNMVLYLLSVSSYFFMTSIGIAPISGIIVDAL-KARIKPMTD-----PVQLYKTTLSTFGIPLIICCVTNELMAIFIVVAENWAIYIAYMSLTVARAFLFTLTASFILTAFPVKYFGMLFGITVTTGGVISFIQ 446          
The following BLAST results are available for this feature:
BLAST of slc43a-7 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC43A34.659e-826.09solute carrier family 43 member 3 [Source:HGNC Sym... [more]
SLC43A35.798e-826.09solute carrier family 43 member 3 [Source:HGNC Sym... [more]
SLC43A35.798e-826.09solute carrier family 43 member 3 [Source:HGNC Sym... [more]
SLC43A35.798e-826.09solute carrier family 43 member 3 [Source:HGNC Sym... [more]
SLC43A35.798e-826.09solute carrier family 43 member 3 [Source:HGNC Sym... [more]
back to top
BLAST of slc43a-7 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc43a-7 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc43a-7 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc43a3b1.933e-1622.05solute carrier family 43 member 3b [Source:ZFIN;Ac... [more]
slc43a3b1.933e-1622.05solute carrier family 43 member 3b [Source:ZFIN;Ac... [more]
slc43a3a6.433e-1622.07solute carrier family 43 member 3a [Source:ZFIN;Ac... [more]
slc43a3a6.433e-1622.07solute carrier family 43 member 3a [Source:ZFIN;Ac... [more]
slc43a1b4.215e-1321.17solute carrier family 43 member 1b [Source:ZFIN;Ac... [more]
back to top
BLAST of slc43a-7 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
kcnn41.724e-1122.55potassium channel, calcium activated intermediate/... [more]
kcnn42.023e-1122.55potassium channel, calcium activated intermediate/... [more]
back to top
BLAST of slc43a-7 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc43a39.641e-1021.52solute carrier family 43, member 3 [Source:MGI Sym... [more]
Slc43a15.942e-924.48solute carrier family 43, member 1 [Source:MGI Sym... [more]
Slc43a15.942e-924.48solute carrier family 43, member 1 [Source:MGI Sym... [more]
Slc43a17.083e-924.48solute carrier family 43, member 1 [Source:MGI Sym... [more]
Slc43a11.262e-824.48solute carrier family 43, member 1 [Source:MGI Sym... [more]
back to top
BLAST of slc43a-7 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q1JPD8|S43A3_BOVIN4.919e-1522.20Solute carrier family 43 member 3 OS=Bos taurus OX... [more]
sp|A2AVZ9|S43A3_MOUSE6.744e-921.52Solute carrier family 43 member 3 OS=Mus musculus ... [more]
sp|Q0VCM6|LAT4_BOVIN7.959e-919.41Large neutral amino acids transporter small subuni... [more]
sp|Q8BSM7|LAT3_MOUSE4.157e-824.48Large neutral amino acids transporter small subuni... [more]
sp|Q8NBI5|S43A3_HUMAN2.785e-726.09Solute carrier family 43 member 3 OS=Homo sapiens ... [more]
back to top
BLAST of slc43a-7 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJM10.000e+0100.00Slc43a-7 (Fragment) OS=Schmidtea mediterranea OX=7... [more]
A0A4Z2CQ556.589e-4932.09Solute carrier family 43 member 3 OS=Schistosoma j... [more]
A0A4Z2D7V31.717e-4729.67Solute carrier family 43 member 3 OS=Schistosoma j... [more]
A0A0H3YFM87.931e-4730.09Slc43a-5 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YKI85.645e-4530.71Slc43a-1 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
back to top
BLAST of slc43a-7 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc43a3a2.422e-1722.76solute carrier family 43 member 3 [Source:NCBI gen... [more]
slc43a3a2.422e-1722.76solute carrier family 43 member 3 [Source:NCBI gen... [more]
slc43a3b2.954e-1321.00solute carrier family 43 member 3 [Source:NCBI gen... [more]
slc43a3b3.178e-1321.14solute carrier family 43 member 3 [Source:NCBI gen... [more]
slc43a1b1.581e-1120.51large neutral amino acids transporter small subuni... [more]
back to top
BLAST of slc43a-7 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc43a-7 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
FMP421.344e-619.72Putative protein of unknown function; the authenti... [more]
back to top
BLAST of slc43a-7 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO399042.182e-624.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc43a-7 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc43a3a3.936e-1822.97solute carrier family 43 member 3-like [Source:NCB... [more]
slc43a3b8.930e-1720.95solute carrier family 43 member 3 [Source:NCBI gen... [more]
slc43a1a6.502e-1322.34solute carrier family 43 member 1 [Source:NCBI gen... [more]
slc43a1b9.306e-1221.43large neutral amino acids transporter small subuni... [more]
slc43a1b4.004e-1123.95large neutral amino acids transporter small subuni... [more]
back to top
BLAST of slc43a-7 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000075262.10.000e+094.89SMESG000075262.1[more]
SMESG000005041.11.073e-15854.18SMESG000005041.1[more]
SMESG000051641.12.206e-5030.09SMESG000051641.1[more]
SMESG000043545.11.543e-4730.95SMESG000043545.1[more]
SMESG000043543.16.407e-4228.67SMESG000043543.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30011282
GenBankAKN21689.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011282 ID=SMED30011282|Name=slc43a-7|organism=Schmidtea mediterranea sexual|type=transcript|length=1235bp
GTCGTTGAGTTGTCTCTTTTCAGTGGAGTGTTTTGCGGATTCAGTTCTTT
GATGCCGATCTGCAAGGATTTCGGGGTCTTCTCTCAATGCTGTGGGACGC
AGCCGGGGAGCGAAGGTGTCCGATGTGCAGCGCAGGAAGCCTGTTTTGGA
CGAGCCTTCAGCACATGGATCGTTGTTCGGGCTCTCATGAGCTTTGTGTT
GGGAATGGTTTTTGACAGATTCGGAATCGGAATTATCGGGGTTGTTGCCG
CAGTTTGTTTGATGGGAGGATTTCTGTGTTTTGCCTTTACACCAATATTT
AATTGGTTGTTATTCATTGCCGGTTCTTTATTGACCATGTCAGCTCACTG
TTTGGCTCTCTCAAATATTGGCTTAACTGTAATATTTGCCGGATTCAGTA
ACATGTTGGTGTCGATTATTAGTTCTCTTTATGATGTTTCGGCCATTGTA
ATGACGATGCTCAAAGTTTTCACCGATTTGGGAGCTCCATTTTGGTTATT
ATGTATCATTCATGCTAGTATAGGTGTCATCATTATTCTAGGGTCACTAA
CCATTCTGAAGAATCGTGCAAATGAAGTGATATCAAAAGACAAAGGTGAA
GAAGTTAACATTGAGTCTATAAATACTGAATCAAACCCTGAAGGAAATAA
ACATATCAATGATTTATACAATCAATCCGTTGAAGAAACATTTCCAACTG
TTAAAGCATGTGTTTTGTCTCCTGAATATTTGATCCAGATGGCTTATTTC
GCAATTATGTTATTCAGATTCACTTTTTTCCTTTCTCAAATGTCGTCTCA
CTTTTCATATTTGTTCCCAACTGATCAGGCAATCGCCAACCACCTTCTGT
CCGTTAGCAATACTTTCTTTATTGGATCTATCTTGATTTCTCCAATATTT
GGAGTTCTTCTAGACAAATACCAGAAATACACCATCAAAAGTCTAGCTGA
AAATAAGGTAGAGTCTCCAAGAGAAATTTACAATAGAGTCAATCGGTGCT
TTTTTGTGCCAAGCATCATATGCTCATGTGCCATGATTGTGTCATCCTCA
TTAATGTTTGTGTCAAACCAATATTCTTTCTATGTGGTATTTTCTAGCAT
AACGGTCATGAAATCATTATTGTTCGCTATCAATGCGTCGTACATTTTCT
CAGCTTTCCCAAAGAAATATTTCGGAACTTTGATTGGAGCTGTGTTTTTG
ACAACGGGTTTTCTGAATTTGTTGCAGCAAGTGAT
back to top

protein sequence of SMED30011282-orf-1

>SMED30011282-orf-1 ID=SMED30011282-orf-1|Name=SMED30011282-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=411bp
VVELSLFSGVFCGFSSLMPICKDFGVFSQCCGTQPGSEGVRCAAQEACFG
RAFSTWIVVRALMSFVLGMVFDRFGIGIIGVVAAVCLMGGFLCFAFTPIF
NWLLFIAGSLLTMSAHCLALSNIGLTVIFAGFSNMLVSIISSLYDVSAIV
MTMLKVFTDLGAPFWLLCIIHASIGVIIILGSLTILKNRANEVISKDKGE
EVNIESINTESNPEGNKHINDLYNQSVEETFPTVKACVLSPEYLIQMAYF
AIMLFRFTFFLSQMSSHFSYLFPTDQAIANHLLSVSNTFFIGSILISPIF
GVLLDKYQKYTIKSLAENKVESPREIYNRVNRCFFVPSIICSCAMIVSSS
LMFVSNQYSFYVVFSSITVMKSLLFAINASYIFSAFPKKYFGTLIGAVFL
TTGFLNLLQQV
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000087proximal tubule
Vocabulary: INTERPRO
TermDefinition
IPR011701MFS
IPR036259MFS_trans_sf
IPR020846MFS_dom
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011701Major facilitator superfamilyPFAMPF07690MFS_1coord: 11..403
e-value: 8.4E-13
score: 48.0
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 234..410
e-value: 2.7E-6
score: 28.7
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 4..193
e-value: 2.6E-6
score: 28.9
NoneNo IPR availablePANTHERPTHR20772:SF2PROTEIN FMP42coord: 1..228
NoneNo IPR availablePANTHERPTHR20772:SF2PROTEIN FMP42coord: 196..409
NoneNo IPR availablePANTHERPTHR20772FAMILY NOT NAMEDcoord: 1..228
coord: 196..409
NoneNo IPR availableCDDcd17355MFS_YcxA_likecoord: 49..134
e-value: 3.98679E-4
score: 39.9469
NoneNo IPR availableTMHMMTMhelixcoord: 52..71
NoneNo IPR availableTMHMMTMhelixcoord: 137..154
NoneNo IPR availableTMHMMTMhelixcoord: 390..409
NoneNo IPR availableTMHMMTMhelixcoord: 110..132
NoneNo IPR availableTMHMMTMhelixcoord: 334..356
NoneNo IPR availableTMHMMTMhelixcoord: 282..304
NoneNo IPR availableTMHMMTMhelixcoord: 243..262
NoneNo IPR availableTMHMMTMhelixcoord: 164..186
NoneNo IPR availableTMHMMTMhelixcoord: 361..383
NoneNo IPR availableTMHMMTMhelixcoord: 78..100
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 44..404