Cysteine/serine-rich nuclear protein 1

Overview
NameCysteine/serine-rich nuclear protein 1
Smed IDSMED30011281
Length (bp)2316
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cysteine/serine-rich nuclear protein 1 (SMED30011281) t-SNE clustered cells

Violin plots show distribution of expression levels for Cysteine/serine-rich nuclear protein 1 (SMED30011281) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cysteine/serine-rich nuclear protein 1 (SMED30011281) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cysteine/serine-rich nuclear protein 1 (SMED30011281) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011281

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30011281SMESG000005048.1 dd_Smed_v4_9797_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30011281SMESG000005048.1 dd_Smed_v4_9797_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30011281SMESG000005048.1 dd_Smed_v6_9797_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Human
Match: CSRNP2 (cysteine and serine rich nuclear protein 2 [Source:HGNC Symbol;Acc:HGNC:16006])

HSP 1 Score: 142.51 bits (358), Expect = 4.012e-35
Identity = 95/241 (39.42%), Postives = 132/241 (54.77%), Query Frame = 2
Query:  356 SILKSTNHQKETLKQKHRIRFQDVEIFYFNRQQSFCSVPSIGGSALGMEMQH---------------------FLSEKFDLNNSSNNKGDLFKSSTKSNPDSYDIHKDG---------SYTNEGYSILQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRXXXXXXXXXXXXXXXLGRVEFNPIRVRTHFIHTIMRLQMQDQYQSEDP 988
            SILK    +++ L++K+ +RF  V ++YF R+Q F SVPS GGS+LGM  +H                      L E          K  L K+ T  + ++  +  D          +   + Y  LQP+  K RR LL+ SG+ RI+  +K+    IR SRE CGC C    C PE C+CSQ GI+CQVDR +FPCGC  + C N  GR+EFNPIRVRTH++HTIM+L+++ + Q   P
Sbjct:   53 SILK----RQKQLRRKN-VRFDQVTVYYFARRQGFTSVPSQGGSSLGMAQRHNSVRSYTLCEFAQEQEVNHREILREHLKEEKLHAKKMKLTKNGTVESVEADGLTLDDVSDEDIDVENVEVDDYFFLQPLPTKRRRALLRASGVHRIDAEEKQELRAIRLSREECGCDCRL-YCDPEACACSQAGIKCQVDRMSFPCGCSRDGCGNMAGRIEFNPIRVRTHYLHTIMKLELESKRQVSRP 287          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Human
Match: CSRNP3 (cysteine and serine rich nuclear protein 3 [Source:HGNC Symbol;Acc:HGNC:30729])

HSP 1 Score: 138.658 bits (348), Expect = 2.019e-34
Identity = 94/241 (39.00%), Postives = 129/241 (53.53%), Query Frame = 2
Query:  392 LKQKHRIR-----FQDVEIFYFNRQQSFCSVPSIGGSALGMEMQHFLSEKFDLNNSSNNKGDLFKS-------STKSNPDSYDIHKDGSYTNEG-----------------------YSILQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRXXXXXXXXXXXXXXXLGRVEFNPIRVRTHFIHTIMRLQMQDQYQSEDPQDN-CYS 1006
            LK++ R+R     F  V ++YF R+Q F SVPS GGS LGM  +H    ++ L   +  +  L +          K N     + K+G+  +E                        Y  LQP+  K RR LL+ SG+ +I+  +K     IR SRE CGC C    C P+TC+CS  GI+CQVDR +FPCGC    CSN  GR+EFNPIRVRTHF+HTIM+L+++   + + P  N C+S
Sbjct:   54 LKREKRLRTKNVHFSCVTVYYFTRRQGFTSVPSQGGSTLGMSSRHNSVRQYTLGEFAREQERLHREMLREHLREEKLNSLKLKMTKNGTVESEEASTLTLDDISDDDIDLDNTEVDEYFFLQPLPTKKRRALLRASGVKKIDVEEKHELRAIRLSREDCGCDCRV-FCDPDTCTCSLAGIKCQVDRMSFPCGCTKEGCSNTAGRIEFNPIRVRTHFLHTIMKLELEKNREQQIPTLNGCHS 293          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Human
Match: CSRNP3 (cysteine and serine rich nuclear protein 3 [Source:HGNC Symbol;Acc:HGNC:30729])

HSP 1 Score: 139.428 bits (350), Expect = 7.310e-34
Identity = 98/255 (38.43%), Postives = 136/255 (53.33%), Query Frame = 2
Query:  335 SSEIIQKSILKSTNHQKETLKQKHRIRFQDVEIFYFNRQQSFCSVPSIGGSALGMEMQHFLSEKFDLNNSSNNKGDLFKS-------STKSNPDSYDIHKDGSYTNEG-----------------------YSILQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRXXXXXXXXXXXXXXXLGRVEFNPIRVRTHFIHTIMRLQMQDQYQSEDPQDN-CYS 1006
            SS     SILK    +++ L+ K+ + F  V ++YF R+Q F SVPS GGS LGM  +H    ++ L   +  +  L +          K N     + K+G+  +E                        Y  LQP+  K RR LL+ SG+ +I+  +K     IR SRE CGC C    C P+TC+CS  GI+CQVDR +FPCGC    CSN  GR+EFNPIRVRTHF+HTIM+L+++   + + P  N C+S
Sbjct:   45 SSHFTPSSILK----REKRLRTKN-VHFSCVTVYYFTRRQGFTSVPSQGGSTLGMSSRHNSVRQYTLGEFAREQERLHREMLREHLREEKLNSLKLKMTKNGTVESEEASTLTLDDISDDDIDLDNTEVDEYFFLQPLPTKKRRALLRASGVKKIDVEEKHELRAIRLSREDCGCDCRV-FCDPDTCTCSLAGIKCQVDRMSFPCGCTKEGCSNTAGRIEFNPIRVRTHFLHTIMKLELEKNREQQIPTLNGCHS 293          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Human
Match: CSRNP3 (cysteine and serine rich nuclear protein 3 [Source:HGNC Symbol;Acc:HGNC:30729])

HSP 1 Score: 139.428 bits (350), Expect = 7.310e-34
Identity = 98/255 (38.43%), Postives = 136/255 (53.33%), Query Frame = 2
Query:  335 SSEIIQKSILKSTNHQKETLKQKHRIRFQDVEIFYFNRQQSFCSVPSIGGSALGMEMQHFLSEKFDLNNSSNNKGDLFKS-------STKSNPDSYDIHKDGSYTNEG-----------------------YSILQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRXXXXXXXXXXXXXXXLGRVEFNPIRVRTHFIHTIMRLQMQDQYQSEDPQDN-CYS 1006
            SS     SILK    +++ L+ K+ + F  V ++YF R+Q F SVPS GGS LGM  +H    ++ L   +  +  L +          K N     + K+G+  +E                        Y  LQP+  K RR LL+ SG+ +I+  +K     IR SRE CGC C    C P+TC+CS  GI+CQVDR +FPCGC    CSN  GR+EFNPIRVRTHF+HTIM+L+++   + + P  N C+S
Sbjct:   45 SSHFTPSSILK----REKRLRTKN-VHFSCVTVYYFTRRQGFTSVPSQGGSTLGMSSRHNSVRQYTLGEFAREQERLHREMLREHLREEKLNSLKLKMTKNGTVESEEASTLTLDDISDDDIDLDNTEVDEYFFLQPLPTKKRRALLRASGVKKIDVEEKHELRAIRLSREDCGCDCRV-FCDPDTCTCSLAGIKCQVDRMSFPCGCTKEGCSNTAGRIEFNPIRVRTHFLHTIMKLELEKNREQQIPTLNGCHS 293          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Human
Match: CSRNP3 (cysteine and serine rich nuclear protein 3 [Source:HGNC Symbol;Acc:HGNC:30729])

HSP 1 Score: 139.428 bits (350), Expect = 7.310e-34
Identity = 98/255 (38.43%), Postives = 136/255 (53.33%), Query Frame = 2
Query:  335 SSEIIQKSILKSTNHQKETLKQKHRIRFQDVEIFYFNRQQSFCSVPSIGGSALGMEMQHFLSEKFDLNNSSNNKGDLFKS-------STKSNPDSYDIHKDGSYTNEG-----------------------YSILQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRXXXXXXXXXXXXXXXLGRVEFNPIRVRTHFIHTIMRLQMQDQYQSEDPQDN-CYS 1006
            SS     SILK    +++ L+ K+ + F  V ++YF R+Q F SVPS GGS LGM  +H    ++ L   +  +  L +          K N     + K+G+  +E                        Y  LQP+  K RR LL+ SG+ +I+  +K     IR SRE CGC C    C P+TC+CS  GI+CQVDR +FPCGC    CSN  GR+EFNPIRVRTHF+HTIM+L+++   + + P  N C+S
Sbjct:   45 SSHFTPSSILK----REKRLRTKN-VHFSCVTVYYFTRRQGFTSVPSQGGSTLGMSSRHNSVRQYTLGEFAREQERLHREMLREHLREEKLNSLKLKMTKNGTVESEEASTLTLDDISDDDIDLDNTEVDEYFFLQPLPTKKRRALLRASGVKKIDVEEKHELRAIRLSREDCGCDCRV-FCDPDTCTCSLAGIKCQVDRMSFPCGCTKEGCSNTAGRIEFNPIRVRTHFLHTIMKLELEKNREQQIPTLNGCHS 293          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Celegans
Match: C41D11.3 (pep chromosome:WBcel235:I:4429547:4431916:-1 gene:WBGene00016562.1 transcript:C41D11.3a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C41D11.3)

HSP 1 Score: 77.7962 bits (190), Expect = 1.022e-14
Identity = 52/161 (32.30%), Postives = 79/161 (49.07%), Query Frame = 2
Query:  398 QKHRIRFQDVEIFYFNRQQSFCSVPSIGGSALGMEMQHFLSEKFDLNNSSN-------------NKGDLFKSSTKSNPDSYDIHKDGSYTNEGYSILQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVD 841
            ++ +IRF  + + YF+R+Q   +VP+ G  +L M  +H     F L+                 + G++       +PDS D  +D        SI + I  +HR  LLK SG+   +  D    D +R++R  CGC C  G C+PETC C+ +GI CQVD
Sbjct:  174 RRKKIRFSGLHVHYFDRRQGGSTVPTEGDISLDMHNKHHSHRYFSLSTGKRPILDLLLYADDDLSDGEVI------DPDS-DEDRDYDEYASAKSIPR-INQRHRIKLLKKSGVKVEKNTD--AIDSLRNTRVECGCSCENGVCLPETCQCAIDGIHCQVD 324          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Celegans
Match: C41D11.3 (pep chromosome:WBcel235:I:4428631:4431916:-1 gene:WBGene00016562.1 transcript:C41D11.3b.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C41D11.3)

HSP 1 Score: 77.7962 bits (190), Expect = 1.097e-14
Identity = 52/161 (32.30%), Postives = 79/161 (49.07%), Query Frame = 2
Query:  398 QKHRIRFQDVEIFYFNRQQSFCSVPSIGGSALGMEMQHFLSEKFDLNNSSN-------------NKGDLFKSSTKSNPDSYDIHKDGSYTNEGYSILQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVD 841
            ++ +IRF  + + YF+R+Q   +VP+ G  +L M  +H     F L+                 + G++       +PDS D  +D        SI + I  +HR  LLK SG+   +  D    D +R++R  CGC C  G C+PETC C+ +GI CQVD
Sbjct:  174 RRKKIRFSGLHVHYFDRRQGGSTVPTEGDISLDMHNKHHSHRYFSLSTGKRPILDLLLYADDDLSDGEVI------DPDS-DEDRDYDEYASAKSIPR-INQRHRIKLLKKSGVKVEKNTDA--IDSLRNTRVECGCSCENGVCLPETCQCAIDGIHCQVD 324          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Celegans
Match: C41D11.3 (pep chromosome:WBcel235:I:4428475:4431916:-1 gene:WBGene00016562.1 transcript:C41D11.3b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C41D11.3)

HSP 1 Score: 77.7962 bits (190), Expect = 1.097e-14
Identity = 52/161 (32.30%), Postives = 79/161 (49.07%), Query Frame = 2
Query:  398 QKHRIRFQDVEIFYFNRQQSFCSVPSIGGSALGMEMQHFLSEKFDLNNSSN-------------NKGDLFKSSTKSNPDSYDIHKDGSYTNEGYSILQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVD 841
            ++ +IRF  + + YF+R+Q   +VP+ G  +L M  +H     F L+                 + G++       +PDS D  +D        SI + I  +HR  LLK SG+   +  D    D +R++R  CGC C  G C+PETC C+ +GI CQVD
Sbjct:  174 RRKKIRFSGLHVHYFDRRQGGSTVPTEGDISLDMHNKHHSHRYFSLSTGKRPILDLLLYADDDLSDGEVI------DPDS-DEDRDYDEYASAKSIPR-INQRHRIKLLKKSGVKVEKNTDA--IDSLRNTRVECGCSCENGVCLPETCQCAIDGIHCQVD 324          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Celegans
Match: C41D11.3 (pep chromosome:WBcel235:I:4428631:4444342:-1 gene:WBGene00016562.1 transcript:C41D11.3c.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C41D11.3)

HSP 1 Score: 77.7962 bits (190), Expect = 1.846e-14
Identity = 52/161 (32.30%), Postives = 82/161 (50.93%), Query Frame = 2
Query:  398 QKHRIRFQDVEIFYFNRQQSFCSVPSIGGSALGMEMQHFLSEKFDLNNSSN-------------NKGDLFKSSTKSNPDSYDIHKDGSYTNEGYSILQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVD 841
            ++ +IRF  + + YF+R+Q   +VP+ G  +L M  +H     F L+                 + G++       +PDS D  +D        SI + I  +HR  LLK SG+ ++E  + +  D +R++R  CGC C  G C+PETC C+ +GI CQVD
Sbjct:  563 RRKKIRFSGLHVHYFDRRQGGSTVPTEGDISLDMHNKHHSHRYFSLSTGKRPILDLLLYADDDLSDGEVI------DPDS-DEDRDYDEYASAKSIPR-INQRHRIKLLKKSGV-KVEK-NTDAIDSLRNTRVECGCSCENGVCLPETCQCAIDGIHCQVD 713          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Celegans
Match: C41D11.3 (pep chromosome:WBcel235:I:4428467:4444342:-1 gene:WBGene00016562.1 transcript:C41D11.3c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C41D11.3)

HSP 1 Score: 77.7962 bits (190), Expect = 1.846e-14
Identity = 52/161 (32.30%), Postives = 82/161 (50.93%), Query Frame = 2
Query:  398 QKHRIRFQDVEIFYFNRQQSFCSVPSIGGSALGMEMQHFLSEKFDLNNSSN-------------NKGDLFKSSTKSNPDSYDIHKDGSYTNEGYSILQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVD 841
            ++ +IRF  + + YF+R+Q   +VP+ G  +L M  +H     F L+                 + G++       +PDS D  +D        SI + I  +HR  LLK SG+ ++E  + +  D +R++R  CGC C  G C+PETC C+ +GI CQVD
Sbjct:  563 RRKKIRFSGLHVHYFDRRQGGSTVPTEGDISLDMHNKHHSHRYFSLSTGKRPILDLLLYADDDLSDGEVI------DPDS-DEDRDYDEYASAKSIPR-INQRHRIKLLKKSGV-KVEK-NTDAIDSLRNTRVECGCSCENGVCLPETCQCAIDGIHCQVD 713          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Fly
Match: Axud1 (gene:FBgn0261647 transcript:FBtr0077762)

HSP 1 Score: 149.058 bits (375), Expect = 1.084e-36
Identity = 89/212 (41.98%), Postives = 117/212 (55.19%), Query Frame = 2
Query:  395 KQKHRIRFQDVEIFYFNRQQSFCSVPSIGGSALGMEMQHFLSEKFDLNNSSNNKGDLFKSSTKSNPD----------------SYDIHKDGSYTNEGY-SILQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRXXXXXXXXXXXXXXXLGRVEFNPIRVRTHFIHTIMRLQMQDQYQS 979
            + K  I F +V++FYF RQQ F  VP+ GG  LGM  +H     F     + +  +L ++    N +                 Y     GS   +G    LQP+  K RR LLK +G+ +I+  +K  C  IR+SRE CGC C    C PETC+CSQ GI+CQVDR  FPCGC    C N +GRVEFNP RVRTH+IHT+MRL ++ +  S
Sbjct:  299 RTKRSINFDEVKVFYFPRQQGFSCVPTAGGCTLGMGARHV---GFKTMTLAEHAAELRRAHRSQNQELQPRGSSSDDSEESEEDYLSEGSGSDAEDGSNGFLQPVTPKQRRALLKAAGVRKIDASEKSECRDIRNSREVCGCSCRE-FCDPETCACSQAGIKCQVDRAMFPCGCTREACGNTVGRVEFNPTRVRTHYIHTVMRLDLEQRQGS 506          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Fly
Match: Axud1 (gene:FBgn0261647 transcript:FBtr0077763)

HSP 1 Score: 149.058 bits (375), Expect = 1.084e-36
Identity = 89/212 (41.98%), Postives = 117/212 (55.19%), Query Frame = 2
Query:  395 KQKHRIRFQDVEIFYFNRQQSFCSVPSIGGSALGMEMQHFLSEKFDLNNSSNNKGDLFKSSTKSNPD----------------SYDIHKDGSYTNEGY-SILQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRXXXXXXXXXXXXXXXLGRVEFNPIRVRTHFIHTIMRLQMQDQYQS 979
            + K  I F +V++FYF RQQ F  VP+ GG  LGM  +H     F     + +  +L ++    N +                 Y     GS   +G    LQP+  K RR LLK +G+ +I+  +K  C  IR+SRE CGC C    C PETC+CSQ GI+CQVDR  FPCGC    C N +GRVEFNP RVRTH+IHT+MRL ++ +  S
Sbjct:  299 RTKRSINFDEVKVFYFPRQQGFSCVPTAGGCTLGMGARHV---GFKTMTLAEHAAELRRAHRSQNQELQPRGSSSDDSEESEEDYLSEGSGSDAEDGSNGFLQPVTPKQRRALLKAAGVRKIDASEKSECRDIRNSREVCGCSCRE-FCDPETCACSQAGIKCQVDRAMFPCGCTREACGNTVGRVEFNPTRVRTHYIHTVMRLDLEQRQGS 506          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Fly
Match: Axud1 (gene:FBgn0261647 transcript:FBtr0330665)

HSP 1 Score: 149.058 bits (375), Expect = 1.084e-36
Identity = 89/212 (41.98%), Postives = 117/212 (55.19%), Query Frame = 2
Query:  395 KQKHRIRFQDVEIFYFNRQQSFCSVPSIGGSALGMEMQHFLSEKFDLNNSSNNKGDLFKSSTKSNPD----------------SYDIHKDGSYTNEGY-SILQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRXXXXXXXXXXXXXXXLGRVEFNPIRVRTHFIHTIMRLQMQDQYQS 979
            + K  I F +V++FYF RQQ F  VP+ GG  LGM  +H     F     + +  +L ++    N +                 Y     GS   +G    LQP+  K RR LLK +G+ +I+  +K  C  IR+SRE CGC C    C PETC+CSQ GI+CQVDR  FPCGC    C N +GRVEFNP RVRTH+IHT+MRL ++ +  S
Sbjct:  299 RTKRSINFDEVKVFYFPRQQGFSCVPTAGGCTLGMGARHV---GFKTMTLAEHAAELRRAHRSQNQELQPRGSSSDDSEESEEDYLSEGSGSDAEDGSNGFLQPVTPKQRRALLKAAGVRKIDASEKSECRDIRNSREVCGCSCRE-FCDPETCACSQAGIKCQVDRAMFPCGCTREACGNTVGRVEFNPTRVRTHYIHTVMRLDLEQRQGS 506          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Fly
Match: Axud1 (gene:FBgn0261647 transcript:FBtr0330666)

HSP 1 Score: 149.058 bits (375), Expect = 1.084e-36
Identity = 89/212 (41.98%), Postives = 117/212 (55.19%), Query Frame = 2
Query:  395 KQKHRIRFQDVEIFYFNRQQSFCSVPSIGGSALGMEMQHFLSEKFDLNNSSNNKGDLFKSSTKSNPD----------------SYDIHKDGSYTNEGY-SILQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRXXXXXXXXXXXXXXXLGRVEFNPIRVRTHFIHTIMRLQMQDQYQS 979
            + K  I F +V++FYF RQQ F  VP+ GG  LGM  +H     F     + +  +L ++    N +                 Y     GS   +G    LQP+  K RR LLK +G+ +I+  +K  C  IR+SRE CGC C    C PETC+CSQ GI+CQVDR  FPCGC    C N +GRVEFNP RVRTH+IHT+MRL ++ +  S
Sbjct:  299 RTKRSINFDEVKVFYFPRQQGFSCVPTAGGCTLGMGARHV---GFKTMTLAEHAAELRRAHRSQNQELQPRGSSSDDSEESEEDYLSEGSGSDAEDGSNGFLQPVTPKQRRALLKAAGVRKIDASEKSECRDIRNSREVCGCSCRE-FCDPETCACSQAGIKCQVDRAMFPCGCTREACGNTVGRVEFNPTRVRTHYIHTVMRLDLEQRQGS 506          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Zebrafish
Match: CSRNP3 (cysteine-serine-rich nuclear protein 3 [Source:NCBI gene;Acc:100332048])

HSP 1 Score: 143.665 bits (361), Expect = 2.163e-35
Identity = 94/233 (40.34%), Postives = 128/233 (54.94%), Query Frame = 2
Query:  356 SILKSTNHQKETLKQKHRIRFQDVEIFYFNRQQSFCSVPSIGGSALGMEMQHFLSEKFDLNNSSNNKG----DLFKSSTKS---NPDSYDIHKDGSYTNEG-----------------------YSILQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRXXXXXXXXXXXXXXXLGRVEFNPIRVRTHFIHTIMRLQMQ 964
            SILK     +E   +  R+ F+ V ++YF+R+Q F SVPS GGS LGM  +H    ++ L   +  +     D+ +   K    N     + K+GS  +E                        Y  LQP+  K RR LL++SG+ +I+  +K     IR SRE CGC C    C PETC+CS  GI+CQVDR +FPCGC    CSN  GR+EFNPIRVRTHF+HTIM+L+++
Sbjct:   69 SILK-----REKRMRTRRVHFEKVTVYYFSRRQGFTSVPSQGGSTLGMSNRHSCIRQYTLGEFAMEQERIHRDMLRDHLKEEKLNSIRLRLTKNGSVESEEANALTLDDVSDDDLDIDNTEVDEYFFLQPLTTKKRRALLRSSGVKKIDVEEKHELRAIRVSREDCGCDCRLF-CDPETCTCSLAGIKCQVDRMSFPCGCTKEGCSNAAGRIEFNPIRVRTHFLHTIMKLELE 295          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Zebrafish
Match: CSRNP3 (cysteine-serine-rich nuclear protein 3 [Source:NCBI gene;Acc:100332048])

HSP 1 Score: 143.665 bits (361), Expect = 2.163e-35
Identity = 94/233 (40.34%), Postives = 128/233 (54.94%), Query Frame = 2
Query:  356 SILKSTNHQKETLKQKHRIRFQDVEIFYFNRQQSFCSVPSIGGSALGMEMQHFLSEKFDLNNSSNNKG----DLFKSSTKS---NPDSYDIHKDGSYTNEG-----------------------YSILQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRXXXXXXXXXXXXXXXLGRVEFNPIRVRTHFIHTIMRLQMQ 964
            SILK     +E   +  R+ F+ V ++YF+R+Q F SVPS GGS LGM  +H    ++ L   +  +     D+ +   K    N     + K+GS  +E                        Y  LQP+  K RR LL++SG+ +I+  +K     IR SRE CGC C    C PETC+CS  GI+CQVDR +FPCGC    CSN  GR+EFNPIRVRTHF+HTIM+L+++
Sbjct:   69 SILK-----REKRMRTRRVHFEKVTVYYFSRRQGFTSVPSQGGSTLGMSNRHSCIRQYTLGEFAMEQERIHRDMLRDHLKEEKLNSIRLRLTKNGSVESEEANALTLDDVSDDDLDIDNTEVDEYFFLQPLTTKKRRALLRSSGVKKIDVEEKHELRAIRVSREDCGCDCRLF-CDPETCTCSLAGIKCQVDRMSFPCGCTKEGCSNAAGRIEFNPIRVRTHFLHTIMKLELE 295          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Zebrafish
Match: CSRNP3 (cysteine-serine-rich nuclear protein 3 [Source:NCBI gene;Acc:100332048])

HSP 1 Score: 142.895 bits (359), Expect = 3.755e-35
Identity = 93/238 (39.08%), Postives = 128/238 (53.78%), Query Frame = 2
Query:  356 SILKSTNHQKETLKQKHRIRFQDVEIFYFNRQQSFCSVPSIGGSALGMEMQHFLSEKFDLNNSSNNKG----DLFKSSTKSNP--------DSYDIHKDGSYTNE-----------------------GYSILQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRXXXXXXXXXXXXXXXLGRVEFNPIRVRTHFIHTIMRLQMQ 964
            SILK     +E   +  R+ F+ V ++YF+R+Q F SVPS GGS LGM  +H    ++ L   +  +     D+ +   K             + + K+GS  +E                        Y  LQP+  K RR LL++SG+ +I+  +K     IR SRE CGC C    C PETC+CS  GI+CQVDR +FPCGC    CSN  GR+EFNPIRVRTHF+HTIM+L+++
Sbjct:   69 SILK-----REKRMRTRRVHFEKVTVYYFSRRQGFTSVPSQGGSTLGMSNRHSCIRQYTLGEFAMEQERIHRDMLRDHLKEEKLNSIRLRCSGFQLTKNGSVESEEANALTLDDVSDDDLDIDNTEVDEYFFLQPLTTKKRRALLRSSGVKKIDVEEKHELRAIRVSREDCGCDCRLF-CDPETCTCSLAGIKCQVDRMSFPCGCTKEGCSNAAGRIEFNPIRVRTHFLHTIMKLELE 300          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Zebrafish
Match: CSRNP3 (cysteine-serine-rich nuclear protein 3 [Source:NCBI gene;Acc:100332048])

HSP 1 Score: 141.739 bits (356), Expect = 8.230e-35
Identity = 92/235 (39.15%), Postives = 124/235 (52.77%), Query Frame = 2
Query:  368 STNHQKETLKQKHRIRFQDVEIFYFNRQQSFCSVPSIGGSALGMEMQHFLSEKFDLNNSSNN-------------KGDLFKSSTKSNPDSYDIHKDGSYTNEG-----------------------YSILQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRXXXXXXXXXXXXXXXLGRVEFNPIRVRTHFIHTIMRLQMQ 964
            ST   +E   +  R+ F+ V ++YF+R+Q F SVPS GGS LGM  +H    ++ L   +               K +   S  K       + K+GS  +E                        Y  LQP+  K RR LL++SG+ +I+  +K     IR SRE CGC C    C PETC+CS  GI+CQVDR +FPCGC    CSN  GR+EFNPIRVRTHF+HTIM+L+++
Sbjct:   54 STATAREKRMRTRRVHFEKVTVYYFSRRQGFTSVPSQGGSTLGMSNRHSCIRQYTLGEFAMEQERIHRDMLRDHLKEEKLNSIPKHKLTWVKLTKNGSVESEEANALTLDDVSDDDLDIDNTEVDEYFFLQPLTTKKRRALLRSSGVKKIDVEEKHELRAIRVSREDCGCDCRLF-CDPETCTCSLAGIKCQVDRMSFPCGCTKEGCSNAAGRIEFNPIRVRTHFLHTIMKLELE 287          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Zebrafish
Match: csrnp2 (cysteine-serine-rich nuclear protein 2 [Source:ZFIN;Acc:ZDB-GENE-090312-137])

HSP 1 Score: 134.806 bits (338), Expect = 6.747e-33
Identity = 94/240 (39.17%), Postives = 133/240 (55.42%), Query Frame = 2
Query:  335 SSEIIQKSILKSTNHQKETLKQKHRIRFQDVEIFYFNRQQSFCSVPSIGGSALGME-----MQHFLSEKFDLNNSSNNKGDLFK--SSTKSNPDSYDIHKDGSY-------------TNEGYSI----------LQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRXXXXXXXXXXXXXXXLGRVEFNPIRVRTHFIHTIMRLQMQ 964
            SS +   SIL+     K +L +K  +RF  V ++YF+R+Q F SVPS GGS+LGM      ++H+   +F     S++K  L +     K N     + ++G+              ++E   +          LQP+  K RR LL+ SGI+RI+  +K     IR SRE CGC C    C P  C CSQ GI+CQVDR +FPCGC  + C N  GR+EFNP+RVRTH++HTIM+L ++
Sbjct:   48 SSSLTPPSILR---RHKVSLGRKQ-VRFDAVTVYYFSRRQGFTSVPSQGGSSLGMARHHCAIRHYTLGEFAREQESSHKHVLRQHLRQEKLNARKLKLTRNGTVDCPEAELLTLDDISDEDLDVESVEVDDCFFLQPLPTKRRRALLRASGIARIDAREKAELRAIRLSREECGCDC-RFYCDPRHCGCSQAGIKCQVDRMSFPCGCTRDGCGNSAGRIEFNPLRVRTHYLHTIMKLDLE 282          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Xenopus
Match: csrnp2 (cysteine-serine-rich nuclear protein 2 [Source:NCBI gene;Acc:100145289])

HSP 1 Score: 147.902 bits (372), Expect = 3.943e-37
Identity = 109/303 (35.97%), Postives = 158/303 (52.15%), Query Frame = 2
Query:  335 SSEIIQKSILKSTNHQKETLKQKHRIRFQDVEIFYFNRQQSFCSVPSIGGSALGMEMQH---------------------FLSEKFDLNNSSNNKGDLFKSSTKSNPDSY----------DIHKDGSYTNEGYSILQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRXXXXXXXXXXXXXXXLGRVEFNPIRVRTHFIHTIMRLQMQDQYQSEDPQDNCYSNQRLKTIENNKSDPLNLKEFDITLCNSTNQGSCRDCQNDKYLQVLMNE 1150
            ++E++  SILK    +++ L+QK+ +RF  V ++YF+R+Q F SVPS GGS+LGM   H                      L E          K  L K+ T  + ++           DI  D S   + Y  LQP+  K RR LL+ +G+ RI+  +K+    IR SRE CGC C    C PE C CSQ GI+CQVDR +FPCGC  + CSN  GR+EFNPIRVRTH++HTIM+L+++ + Q    Q       R   +     +  + +EF     +  N+ + R  Q+ +  Q L++E
Sbjct:   49 TNELMPTSILK----RQKQLRQKN-VRFDQVTVYYFSRRQGFTSVPSQGGSSLGMAQHHNSVRKYTLCEFAEEQEVSHREILREHLKEEKLHTRKMKLTKNGTVESEEAEGLTLEDVSDEDIDVD-SVEVDDYFFLQPLPTKRRRALLRAAGVHRIDAEEKQELRAIRLSREECGCDCRL-YCDPEACPCSQAGIKCQVDRMSFPCGCSRDGCSNIAGRIEFNPIRVRTHYLHTIMKLELEKKRQQPKTQPVEEEVPRGSIVVPPHQETQDFQEFIAENYHLENEAAVRHLQSAEERQRLLDE 344          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Xenopus
Match: glt8d2 (glycosyltransferase 8 domain containing 2 [Source:Xenbase;Acc:XB-GENE-991092])

HSP 1 Score: 141.739 bits (356), Expect = 1.012e-34
Identity = 100/249 (40.16%), Postives = 136/249 (54.62%), Query Frame = 2
Query:  356 SILKSTNHQKETLKQKHRIRFQDVEIFYFNRQQSFCSVPSIGGSALGMEMQHFLSEKFDLNNSSNNKGDLFKS-------STKSNPDSYDIHKDGSYTNEGYSIL-----------------------QPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRXXXXXXXXXXXXXXXLGRVEFNPIRVRTHFIHTIMRLQMQDQYQSEDPQDN-CYSN 1009
            SILK    +++ L+ K+ +RF  V ++YF R+Q F SVPS GGS LGM  +H    ++ L   +  +  L K          K N     I K+G+  +E  SIL                       QP+  K RR LL+ SG+ +I+  +K     IR SRE CGC C    C PETC+CS  GI+CQVDR +FPCGC    CSN  GR+EFNPIRVRTHF+HTIM+L+++   + +    N C+S+
Sbjct:   52 SILK----REKRLRAKN-VRFNCVTVYYFTRRQGFTSVPSQGGSTLGMSSRHNSVRQYTLGEFALEQDRLHKEMLRDHLREEKLNSLKQKITKNGTVESEEASILTLDDISDDDIDLDNTEVDEYFFLQPLPTKKRRALLRASGVKKIDVEEKHELRAIRLSREDCGCDCRIF-CDPETCTCSLAGIKCQVDRMSFPCGCSKEGCSNTAGRIEFNPIRVRTHFLHTIMKLELEKNREQQATLGNGCHSD 294          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Xenopus
Match: csrnp1 (cysteine-serine-rich nuclear protein 1 [Source:NCBI gene;Acc:779916])

HSP 1 Score: 113.62 bits (283), Expect = 1.228e-25
Identity = 79/223 (35.43%), Postives = 112/223 (50.22%), Query Frame = 2
Query:  410 IRFQDVEIFYFNRQQSFCSVPSIGGSALGMEMQHFLSEKFDLNNSSNNKGDLFKSSTKSNPDSYDIHK-------------------------------DGSYTNEGYSILQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRXXXXXXXXXXXXXXXLGRVEFNPIRVRTHFIHTIMRLQMQDQYQSED 985
            + F  V +FYF R Q F SVPS GG  LGM+ +H  S ++ L   S  +    +   K       +                                 +G+   +G+S  +    + RR LLK  G+ +I+  +K   + IR SRE CGC C    C PETCSC+  GI+CQ D   FPCGC  + C N  GRVEFN  RV+THF+HT+MRL++++++Q+ D
Sbjct:   73 VLFDRVVVFYFQRCQGFTSVPSRGGCTLGMKRRHSYSRQYTLEEFSKEQLSRRREKLKERLKEEKLESLRNMLTLNGTIVSQKANNLSIDDICDEDIDMNGAEVEDGFSP-RMYPPRERRALLKREGVKKIDKSEKHELNEIRRSREDCGCNC-QDFCEPETCSCTIAGIKCQRDHSMFPCGCTKDGCGNRNGRVEFNSSRVQTHFLHTVMRLELEEKHQNND 293          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Mouse
Match: Csrnp2 (cysteine-serine-rich nuclear protein 2 [Source:MGI Symbol;Acc:MGI:2386852])

HSP 1 Score: 142.51 bits (358), Expect = 2.341e-35
Identity = 95/241 (39.42%), Postives = 132/241 (54.77%), Query Frame = 2
Query:  356 SILKSTNHQKETLKQKHRIRFQDVEIFYFNRQQSFCSVPSIGGSALGMEMQH---------------------FLSEKFDLNNSSNNKGDLFKSSTKSNPDSYDIHKDG---------SYTNEGYSILQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRXXXXXXXXXXXXXXXLGRVEFNPIRVRTHFIHTIMRLQMQDQYQSEDP 988
            SILK    +++ L++K+ +RF  V ++YF R+Q F SVPS GGS+LGM  +H                      L E          K  L K+ T  + ++  +  D          +   + Y  LQP+  K RR LL+ SG+ RI+  +K+    IR SRE CGC C    C PE C+CSQ GI+CQVDR +FPCGC  + C N  GR+EFNPIRVRTH++HTIM+L+++ + Q   P
Sbjct:   53 SILK----RQKQLRRKN-VRFDQVTVYYFARRQGFTSVPSQGGSSLGMAQRHNSVRSYTLCEFAQEQEVNHREILREHLKEEKLHAKKMKLTKNGTVESVEADGLTLDDVSDEDIDVENVEVDDYFFLQPLPTKRRRALLRASGVHRIDAEEKQELRAIRLSREECGCDCRL-YCDPEACACSQAGIKCQVDRMSFPCGCSRDGCGNMAGRIEFNPIRVRTHYLHTIMKLELESKRQVSRP 287          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Mouse
Match: Csrnp3 (cysteine-serine-rich nuclear protein 3 [Source:MGI Symbol;Acc:MGI:1925021])

HSP 1 Score: 140.198 bits (352), Expect = 2.416e-34
Identity = 93/237 (39.24%), Postives = 126/237 (53.16%), Query Frame = 2
Query:  392 LKQKHRIR-----FQDVEIFYFNRQQSFCSVPSIGGSALGMEMQHFLSEKFDLNNSSNNKGDLFKS-------STKSNPDSYDIHKDGSYTNEG-----------------------YSILQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRXXXXXXXXXXXXXXXLGRVEFNPIRVRTHFIHTIMRLQMQDQYQSEDPQDN 997
            LK++ R+R     F  V ++YF R+Q F SVPS GGS LGM  +H    ++ L   +  +  L +          K N     + K+G+  +E                        Y  LQP+  K RR LL+ SG+ +I+  +K     IR SRE CGC C    C PETC+CS  GI+CQVDR +FPCGC    CSN  GR+EFNPIRVRTHF+HTIM+L+++   + + P  N
Sbjct:   54 LKREKRLRTKNVHFSCVTVYYFTRRQGFTSVPSQGGSTLGMSSRHNSVRQYTLGEFAREQERLHREMLREHLREEKLNSLKLKMTKNGTVESEEASTLTVDDISDDDIDLDNTEVDEYFFLQPLPTKKRRALLRASGVKKIDVDEKHELRAIRLSREDCGCDCRV-FCDPETCTCSLAGIKCQVDRMSFPCGCTKEGCSNTAGRIEFNPIRVRTHFLHTIMKLELEKNREQQTPTLN 289          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Mouse
Match: Csrnp3 (cysteine-serine-rich nuclear protein 3 [Source:MGI Symbol;Acc:MGI:1925021])

HSP 1 Score: 140.198 bits (352), Expect = 2.416e-34
Identity = 93/237 (39.24%), Postives = 126/237 (53.16%), Query Frame = 2
Query:  392 LKQKHRIR-----FQDVEIFYFNRQQSFCSVPSIGGSALGMEMQHFLSEKFDLNNSSNNKGDLFKS-------STKSNPDSYDIHKDGSYTNEG-----------------------YSILQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRXXXXXXXXXXXXXXXLGRVEFNPIRVRTHFIHTIMRLQMQDQYQSEDPQDN 997
            LK++ R+R     F  V ++YF R+Q F SVPS GGS LGM  +H    ++ L   +  +  L +          K N     + K+G+  +E                        Y  LQP+  K RR LL+ SG+ +I+  +K     IR SRE CGC C    C PETC+CS  GI+CQVDR +FPCGC    CSN  GR+EFNPIRVRTHF+HTIM+L+++   + + P  N
Sbjct:   54 LKREKRLRTKNVHFSCVTVYYFTRRQGFTSVPSQGGSTLGMSSRHNSVRQYTLGEFAREQERLHREMLREHLREEKLNSLKLKMTKNGTVESEEASTLTVDDISDDDIDLDNTEVDEYFFLQPLPTKKRRALLRASGVKKIDVDEKHELRAIRLSREDCGCDCRV-FCDPETCTCSLAGIKCQVDRMSFPCGCTKEGCSNTAGRIEFNPIRVRTHFLHTIMKLELEKNREQQTPTLN 289          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Mouse
Match: Csrnp3 (cysteine-serine-rich nuclear protein 3 [Source:MGI Symbol;Acc:MGI:1925021])

HSP 1 Score: 140.198 bits (352), Expect = 2.416e-34
Identity = 93/237 (39.24%), Postives = 126/237 (53.16%), Query Frame = 2
Query:  392 LKQKHRIR-----FQDVEIFYFNRQQSFCSVPSIGGSALGMEMQHFLSEKFDLNNSSNNKGDLFKS-------STKSNPDSYDIHKDGSYTNEG-----------------------YSILQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRXXXXXXXXXXXXXXXLGRVEFNPIRVRTHFIHTIMRLQMQDQYQSEDPQDN 997
            LK++ R+R     F  V ++YF R+Q F SVPS GGS LGM  +H    ++ L   +  +  L +          K N     + K+G+  +E                        Y  LQP+  K RR LL+ SG+ +I+  +K     IR SRE CGC C    C PETC+CS  GI+CQVDR +FPCGC    CSN  GR+EFNPIRVRTHF+HTIM+L+++   + + P  N
Sbjct:   54 LKREKRLRTKNVHFSCVTVYYFTRRQGFTSVPSQGGSTLGMSSRHNSVRQYTLGEFAREQERLHREMLREHLREEKLNSLKLKMTKNGTVESEEASTLTVDDISDDDIDLDNTEVDEYFFLQPLPTKKRRALLRASGVKKIDVDEKHELRAIRLSREDCGCDCRV-FCDPETCTCSLAGIKCQVDRMSFPCGCTKEGCSNTAGRIEFNPIRVRTHFLHTIMKLELEKNREQQTPTLN 289          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Mouse
Match: Csrnp3 (cysteine-serine-rich nuclear protein 3 [Source:MGI Symbol;Acc:MGI:1925021])

HSP 1 Score: 140.198 bits (352), Expect = 2.721e-34
Identity = 93/237 (39.24%), Postives = 126/237 (53.16%), Query Frame = 2
Query:  392 LKQKHRIR-----FQDVEIFYFNRQQSFCSVPSIGGSALGMEMQHFLSEKFDLNNSSNNKGDLFKS-------STKSNPDSYDIHKDGSYTNEG-----------------------YSILQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRXXXXXXXXXXXXXXXLGRVEFNPIRVRTHFIHTIMRLQMQDQYQSEDPQDN 997
            LK++ R+R     F  V ++YF R+Q F SVPS GGS LGM  +H    ++ L   +  +  L +          K N     + K+G+  +E                        Y  LQP+  K RR LL+ SG+ +I+  +K     IR SRE CGC C    C PETC+CS  GI+CQVDR +FPCGC    CSN  GR+EFNPIRVRTHF+HTIM+L+++   + + P  N
Sbjct:   66 LKREKRLRTKNVHFSCVTVYYFTRRQGFTSVPSQGGSTLGMSSRHNSVRQYTLGEFAREQERLHREMLREHLREEKLNSLKLKMTKNGTVESEEASTLTVDDISDDDIDLDNTEVDEYFFLQPLPTKKRRALLRASGVKKIDVDEKHELRAIRLSREDCGCDCRV-FCDPETCTCSLAGIKCQVDRMSFPCGCTKEGCSNTAGRIEFNPIRVRTHFLHTIMKLELEKNREQQTPTLN 301          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. UniProt/SwissProt
Match: sp|Q8BGQ2|CSRN2_MOUSE (Cysteine/serine-rich nuclear protein 2 OS=Mus musculus OX=10090 GN=Csrnp2 PE=2 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 1.637e-34
Identity = 95/241 (39.42%), Postives = 132/241 (54.77%), Query Frame = 2
Query:  356 SILKSTNHQKETLKQKHRIRFQDVEIFYFNRQQSFCSVPSIGGSALGMEMQH---------------------FLSEKFDLNNSSNNKGDLFKSSTKSNPDSYDIHKDG---------SYTNEGYSILQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRXXXXXXXXXXXXXXXLGRVEFNPIRVRTHFIHTIMRLQMQDQYQSEDP 988
            SILK    +++ L++K+ +RF  V ++YF R+Q F SVPS GGS+LGM  +H                      L E          K  L K+ T  + ++  +  D          +   + Y  LQP+  K RR LL+ SG+ RI+  +K+    IR SRE CGC C    C PE C+CSQ GI+CQVDR +FPCGC  + C N  GR+EFNPIRVRTH++HTIM+L+++ + Q   P
Sbjct:   53 SILK----RQKQLRRKN-VRFDQVTVYYFARRQGFTSVPSQGGSSLGMAQRHNSVRSYTLCEFAQEQEVNHREILREHLKEEKLHAKKMKLTKNGTVESVEADGLTLDDVSDEDIDVENVEVDDYFFLQPLPTKRRRALLRASGVHRIDAEEKQELRAIRLSREECGCDCRL-YCDPEACACSQAGIKCQVDRMSFPCGCSRDGCGNMAGRIEFNPIRVRTHYLHTIMKLELESKRQVSRP 287          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. UniProt/SwissProt
Match: sp|Q9H175|CSRN2_HUMAN (Cysteine/serine-rich nuclear protein 2 OS=Homo sapiens OX=9606 GN=CSRNP2 PE=1 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 1.927e-34
Identity = 95/241 (39.42%), Postives = 132/241 (54.77%), Query Frame = 2
Query:  356 SILKSTNHQKETLKQKHRIRFQDVEIFYFNRQQSFCSVPSIGGSALGMEMQH---------------------FLSEKFDLNNSSNNKGDLFKSSTKSNPDSYDIHKDG---------SYTNEGYSILQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRXXXXXXXXXXXXXXXLGRVEFNPIRVRTHFIHTIMRLQMQDQYQSEDP 988
            SILK    +++ L++K+ +RF  V ++YF R+Q F SVPS GGS+LGM  +H                      L E          K  L K+ T  + ++  +  D          +   + Y  LQP+  K RR LL+ SG+ RI+  +K+    IR SRE CGC C    C PE C+CSQ GI+CQVDR +FPCGC  + C N  GR+EFNPIRVRTH++HTIM+L+++ + Q   P
Sbjct:   53 SILK----RQKQLRRKN-VRFDQVTVYYFARRQGFTSVPSQGGSSLGMAQRHNSVRSYTLCEFAQEQEVNHREILREHLKEEKLHAKKMKLTKNGTVESVEADGLTLDDVSDEDIDVENVEVDDYFFLQPLPTKRRRALLRASGVHRIDAEEKQELRAIRLSREECGCDCRL-YCDPEACACSQAGIKCQVDRMSFPCGCSRDGCGNMAGRIEFNPIRVRTHYLHTIMKLELESKRQVSRP 287          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. UniProt/SwissProt
Match: sp|P59055|CSRN3_MOUSE (Cysteine/serine-rich nuclear protein 3 OS=Mus musculus OX=10090 GN=Csrnp3 PE=1 SV=2)

HSP 1 Score: 140.198 bits (352), Expect = 1.903e-33
Identity = 93/237 (39.24%), Postives = 126/237 (53.16%), Query Frame = 2
Query:  392 LKQKHRIR-----FQDVEIFYFNRQQSFCSVPSIGGSALGMEMQHFLSEKFDLNNSSNNKGDLFKS-------STKSNPDSYDIHKDGSYTNEG-----------------------YSILQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRXXXXXXXXXXXXXXXLGRVEFNPIRVRTHFIHTIMRLQMQDQYQSEDPQDN 997
            LK++ R+R     F  V ++YF R+Q F SVPS GGS LGM  +H    ++ L   +  +  L +          K N     + K+G+  +E                        Y  LQP+  K RR LL+ SG+ +I+  +K     IR SRE CGC C    C PETC+CS  GI+CQVDR +FPCGC    CSN  GR+EFNPIRVRTHF+HTIM+L+++   + + P  N
Sbjct:   66 LKREKRLRTKNVHFSCVTVYYFTRRQGFTSVPSQGGSTLGMSSRHNSVRQYTLGEFAREQERLHREMLREHLREEKLNSLKLKMTKNGTVESEEASTLTVDDISDDDIDLDNTEVDEYFFLQPLPTKKRRALLRASGVKKIDVDEKHELRAIRLSREDCGCDCRV-FCDPETCTCSLAGIKCQVDRMSFPCGCTKEGCSNTAGRIEFNPIRVRTHFLHTIMKLELEKNREQQTPTLN 301          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. UniProt/SwissProt
Match: sp|Q8WYN3|CSRN3_HUMAN (Cysteine/serine-rich nuclear protein 3 OS=Homo sapiens OX=9606 GN=CSRNP3 PE=2 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 3.511e-33
Identity = 98/255 (38.43%), Postives = 136/255 (53.33%), Query Frame = 2
Query:  335 SSEIIQKSILKSTNHQKETLKQKHRIRFQDVEIFYFNRQQSFCSVPSIGGSALGMEMQHFLSEKFDLNNSSNNKGDLFKS-------STKSNPDSYDIHKDGSYTNEG-----------------------YSILQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRXXXXXXXXXXXXXXXLGRVEFNPIRVRTHFIHTIMRLQMQDQYQSEDPQDN-CYS 1006
            SS     SILK    +++ L+ K+ + F  V ++YF R+Q F SVPS GGS LGM  +H    ++ L   +  +  L +          K N     + K+G+  +E                        Y  LQP+  K RR LL+ SG+ +I+  +K     IR SRE CGC C    C P+TC+CS  GI+CQVDR +FPCGC    CSN  GR+EFNPIRVRTHF+HTIM+L+++   + + P  N C+S
Sbjct:   45 SSHFTPSSILK----REKRLRTKN-VHFSCVTVYYFTRRQGFTSVPSQGGSTLGMSSRHNSVRQYTLGEFAREQERLHREMLREHLREEKLNSLKLKMTKNGTVESEEASTLTLDDISDDDIDLDNTEVDEYFFLQPLPTKKRRALLRASGVKKIDVEEKHELRAIRLSREDCGCDCRV-FCDPDTCTCSLAGIKCQVDRMSFPCGCTKEGCSNTAGRIEFNPIRVRTHFLHTIMKLELEKNREQQIPTLNGCHS 293          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. UniProt/SwissProt
Match: sp|P59054|CSRN1_MOUSE (Cysteine/serine-rich nuclear protein 1 OS=Mus musculus OX=10090 GN=Csrnp1 PE=2 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 1.120e-26
Identity = 91/244 (37.30%), Postives = 117/244 (47.95%), Query Frame = 2
Query:  356 SILKSTNHQKETLKQKHRIRFQDVEIFYFNRQQSFCSVPSIGGSALGMEMQHFLSEKFDLNNSSNNKGDL------------------FKSSTKSNPDS-------YDIHKDGSYTN-----------EGYSILQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRXXXXXXXXXXXXXXXLGRVEFNPIRVRTHFIHTIMRLQMQDQYQS 979
            SILK    ++        + F  + ++YF R Q F SVPS GG  LGM  +H     F L   +  +                     +K S    P+S        D   D S              E  + LQP   + RR LL+ SG+ RI+  +K    ++R SRE CGC C  G C PETCSCS  GI+CQ+D  +FPCGC    C NP GRVEFN  RV+THFIHT+ RLQM+   +S
Sbjct:   71 SILKRAPRER-----PGHVAFNGITVYYFPRCQGFTSVPSRGGCTLGMASRHSTCRLFSLAEFTQEQVRARREKLRRRLKEEKLEMLRWKFSVAGVPESGAGVPLTADAIDDASVEEDLAVAVANGRLEEANFLQPHPPRQRRALLRASGVRRIDREEKRELQVLRQSREDCGCHC-DGVCDPETCSCSLAGIKCQMDHTSFPCGCCREGCENPNGRVEFNQTRVQTHFIHTLTRLQMEQGAES 308          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. TrEMBL
Match: A0A2T7PYY5 (CSRNP_N domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_01223 PE=4 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 9.059e-41
Identity = 108/272 (39.71%), Postives = 153/272 (56.25%), Query Frame = 2
Query:  416 FQDVEIFYFNRQQSFCSVPSIGGSALGMEMQHFLSEKFDLNNSSNNK--------------GDLFKS-----STKSNPD-SYDIHKDGSYTNEGYSILQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRXXXXXXXXXXXXXXXLGRVEFNPIRVRTHFIHTIMRLQMQDQYQSEDPQ-------DNCYSNQRLKTIENNKSDPLNLKEFDITLCNSTNQGSCRDCQNDKYLQVLMNE 1150
            F DV ++YF R+Q F  VPS GGS LGM  QH   +KF L + +  K              G LF S     S++  P+ S     D  Y +  Y  LQP+  + RR+LL+++G+ +IE  +K+ C  IR SR  CGC+C    C PETC+CS  GI+CQVDR +FPCGC  + C+N  GR+EFNPIRVRTHFIHT+MRL+++ +    + +        +C       + ++ +      +  D+ L NS  +GSCRDCQN +   V+M +
Sbjct:   56 FTDVTVYYFPRKQGFTCVPSEGGSTLGMSCQHLHLQKFSLKDHAKEKKRIHRQILMEQRRQGKLFPSPLLAVSSEELPEVSSGSESDSDYDD--YYFLQPLPIRQRRMLLRSAGVKKIEGDEKDECRDIRMSRNLCGCECKV-FCDPETCTCSLAGIKCQVDRLSFPCGCTKDGCANTTGRIEFNPIRVRTHFIHTLMRLELERKDAESNSKRRMNNGGGSCGETLGCGSDDSGRGSAEEQEPIDLNLFNSNERGSCRDCQNTEVCNVMMQD 324          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. TrEMBL
Match: A0A0L8HEB8 (CSRNP_N domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22016651mg PE=4 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 1.426e-39
Identity = 113/305 (37.05%), Postives = 158/305 (51.80%), Query Frame = 2
Query:  395 KQKHRIRFQDVEIFYFNRQQSFCSVPSIGGSALGMEMQHFLSEKFDLNNSSNNKGDLFKSSTKSNPDSYDI--------------------HKDGSYTNEGYSILQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRXXXXXXXXXXXXXXXLGRVEFNPIRVRTHFIHTIMRLQMQDQYQSEDPQDNCYSNQRLKTIENNKSDPLNLK--EFDITLCNSTNQGSCRDCQNDKYLQVLMNEW-----------TNQLQKLNPVRQYPSNASL 1210
            +QK  + F  V +FYF R Q F  VPS GGS LGM   H   E F L   +  +  + K   K    +  I                      +     + Y  LQP+  + RR++L+ +G+ +I + +++ C  IR SRE CGCQC    C PETCSCS  GI+CQVDR +FPCGC  + C N  GR+EFNPIRV+THFIHT+MR++++++ +   P         + T ++N  D  ++K    D+T  NS  +GSCRDCQN +  QV+M+E             N +Q  N   QY    SL
Sbjct:   57 RQKKSVNFDKVTVFYFPRTQGFTCVPSEGGSTLGMSGNHSYVEDFTLPGYAKEQKRIHKLILKEQQQNGKIIPPSRVAFLRSVEEDSDSASESESDIEVDEYFFLQPVPIRQRRLMLRAAGVRKINSQERDECRQIRQSREICGCQCKVF-CDPETCSCSLAGIKCQVDRLSFPCGCSKDACGNIAGRIEFNPIRVQTHFIHTLMRIELENKEKELHP---------VLTHKSNSEDCSDIKNTNIDLTEFNSNERGSCRDCQNSEVCQVMMHEAQYASMEAEHHQQNAIQHFNHQHQYKDLESL 351          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. TrEMBL
Match: E9FX95 (CSRNP_N domain-containing protein OS=Daphnia pulex OX=6669 GN=DAPPUDRAFT_311563 PE=4 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 3.083e-39
Identity = 97/204 (47.55%), Postives = 127/204 (62.25%), Query Frame = 2
Query:  395 KQKHRIRFQDVEIFYFNRQQSFCSVPSIGGSALGMEMQHFLSEKFDLNNSSN----------NKGDLFKS-STKSNPDSYDIH--KDGSYTNEGYSILQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRXXXXXXXXXXXXXXXLGRVEFNPIRVRTHFIHTIMRLQMQD 967
            K K +I F  V  +YF R Q F  +PS GGS LGM ++H   E F L+  +N           K ++ +S S  S+ D   I    D     + Y  LQP+  + RR LL+ SGI +IET +K+ C  IR SRE CGC C  G C PE+CSC+Q+GIQCQVDR NFPCGC  + C NP GR+EFNP+RVRTHFIHT+MR+++++
Sbjct:  133 KPKKKISFSSVTAYYFPRAQGFTCIPSQGGSTLGMALKHSHEESFTLSEHANYQRRNHRRKNQKNEVKESESDDSDVDGQQISDISDSELEVDNYYFLQPVPTRQRRALLRESGIGKIETSEKDDCRQIRVSRESCGCSC-QGYCDPESCSCAQSGIQCQVDRLNFPCGCSRDACGNPSGRIEFNPVRVRTHFIHTLMRMELEN 335          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. TrEMBL
Match: A0A182H636 (CSRNP_N domain-containing protein OS=Aedes albopictus OX=7160 GN=RP20_CCG022499 PE=4 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 3.131e-39
Identity = 98/231 (42.42%), Postives = 136/231 (58.87%), Query Frame = 2
Query:  326 EIYSSEIIQKSILKSTNHQKETLKQKHRIRFQDVEIFYFNRQQSFCSVPSIGGSALGMEMQHFLSEKFDLNNSSNNKGDLFKSSTKS-NPDSYDI----------HKDGSYTNEGYSILQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRXXXXXXXXXXXXXXXLGRVEFNPIRVRTHFIHTIMRLQMQDQYQSED 985
            E+  S + ++S  ++T    E  + K  I F  V ++YF R Q F  VPS GG  LGME QH  S++F L   +  +  + ++  +  NP S                    +E Y  LQP+  + RR LLK +G+ +I++ +K+ C LIR+SRE CGC C  G C P+TCSCSQ GI+CQVDR +FPCGC  + C N +GRVEFNP RVRTHFIHTIMRL + ++   ++
Sbjct:  225 ELPKSNLKRRSAEETTGASTEK-RPKKGITFDGVTVYYFTRMQGFGCVPSQGGCTLGMEFQHMHSKRFTLAEHAAEQRKVHRAQLQELNPRSSSSEETDSDEEPSESGPEAESESYGFLQPVTTRQRRALLKAAGVRKIDSTEKDECRLIRTSREVCGCTC-RGYCDPDTCSCSQAGIKCQVDRPSFPCGCTQDGCGNVVGRVEFNPARVRTHFIHTIMRLNLDNKAGGDE 453          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. TrEMBL
Match: A0A1S4G802 (CSRNP_N domain-containing protein OS=Aedes aegypti OX=7159 PE=4 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 1.546e-38
Identity = 98/227 (43.17%), Postives = 136/227 (59.91%), Query Frame = 2
Query:  338 SEIIQKSILKSTNHQKETLKQKHRIRFQDVEIFYFNRQQSFCSVPSIGGSALGMEMQHFLSEKFDLNNSSNNKGDLFKSSTKS-NP----------DSYDIHKDGSYTNEGYSILQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRXXXXXXXXXXXXXXXLGRVEFNPIRVRTHFIHTIMRLQMQDQYQSED 985
            S + ++S  ++T    E  + K  I F  V ++YF R Q F  VPS GG  LGME QH  S++F L   +  +  + ++  +  NP          +           +E Y  LQP+  + RR LLK +G+ +I++ +K+ C LIR+SRE CGC C  G C P+TCSCSQ GI+CQVDR +FPCGC  + C+N +GRVEFNP RVRTHFIHTIMRL + ++  SE+
Sbjct:  232 SNLKRRSAEETTGASSEK-RPKKGITFDGVTVYYFTRMQGFGCVPSQGGCTLGMEFQHMHSKRFTLAEHAAEQRKVHRAQLQELNPRSSSSEETDSEDEPSESGSEAESESYGFLQPVTTRQRRALLKAAGVRKIDSTEKDECRLIRTSREVCGCTC-RGYCDPDTCSCSQAGIKCQVDRPSFPCGCTQDGCANVVGRVEFNPGRVRTHFIHTIMRLNLDNKTNSEE 456          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Cavefish
Match: CSRNP3 (cysteine and serine rich nuclear protein 3 [Source:NCBI gene;Acc:103045398])

HSP 1 Score: 149.828 bits (377), Expect = 1.728e-37
Identity = 100/251 (39.84%), Postives = 136/251 (54.18%), Query Frame = 2
Query:  335 SSEIIQKSILKSTNHQKETLKQKHRIRFQDVEIFYFNRQQSFCSVPSIGGSALGMEMQHFLSEKFDLNNSSNNKG----DLFKSSTKS---NPDSYDIHKDGSYTNE-----------------------GYSILQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRXXXXXXXXXXXXXXXLGRVEFNPIRVRTHFIHTIMRLQMQ---DQYQSEDP 988
            +S     SILK     +E   +  R+ F+ V ++YF+R+Q F SVPS GGS LGM  +H    ++ L   +N +     D+ +   K    N     + K+GS  +E                        Y  LQP+  K RR LL++SG+ +I+  +K     IR SRE CGC C    C PETC+CS  GI+CQVDR +FPCGC    CSN  GR+EFNPIRVRTHF+HTIM+L+++   +Q QS  P
Sbjct:   45 ASRFTPSSILK-----REKRMRTRRVHFEKVTVYYFSRRQGFTSVPSQGGSTLGMSSRHSSIRQYTLGEFANEQERIHRDMLRDHLKEEKLNSIKLRLTKNGSVESEEANALTLDDISDDDLDLDNTEVDEYFFLQPLTTKKRRALLRSSGVKKIDVEEKHELRAIRVSREDCGCDCRLF-CDPETCACSLAGIKCQVDRMSFPCGCTKEGCSNAAGRIEFNPIRVRTHFLHTIMKLELEKSREQQQSSAP 289          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Cavefish
Match: CSRNP3 (cysteine and serine rich nuclear protein 3 [Source:NCBI gene;Acc:103045398])

HSP 1 Score: 149.828 bits (377), Expect = 1.728e-37
Identity = 100/251 (39.84%), Postives = 136/251 (54.18%), Query Frame = 2
Query:  335 SSEIIQKSILKSTNHQKETLKQKHRIRFQDVEIFYFNRQQSFCSVPSIGGSALGMEMQHFLSEKFDLNNSSNNKG----DLFKSSTKS---NPDSYDIHKDGSYTNE-----------------------GYSILQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRXXXXXXXXXXXXXXXLGRVEFNPIRVRTHFIHTIMRLQMQ---DQYQSEDP 988
            +S     SILK     +E   +  R+ F+ V ++YF+R+Q F SVPS GGS LGM  +H    ++ L   +N +     D+ +   K    N     + K+GS  +E                        Y  LQP+  K RR LL++SG+ +I+  +K     IR SRE CGC C    C PETC+CS  GI+CQVDR +FPCGC    CSN  GR+EFNPIRVRTHF+HTIM+L+++   +Q QS  P
Sbjct:   45 ASRFTPSSILK-----REKRMRTRRVHFEKVTVYYFSRRQGFTSVPSQGGSTLGMSSRHSSIRQYTLGEFANEQERIHRDMLRDHLKEEKLNSIKLRLTKNGSVESEEANALTLDDISDDDLDLDNTEVDEYFFLQPLTTKKRRALLRSSGVKKIDVEEKHELRAIRVSREDCGCDCRLF-CDPETCACSLAGIKCQVDRMSFPCGCTKEGCSNAAGRIEFNPIRVRTHFLHTIMKLELEKSREQQQSSAP 289          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Cavefish
Match: csrnp2 (cysteine and serine rich nuclear protein 2 [Source:NCBI gene;Acc:103022181])

HSP 1 Score: 136.732 bits (343), Expect = 2.014e-33
Identity = 94/242 (38.84%), Postives = 134/242 (55.37%), Query Frame = 2
Query:  335 SSEIIQKSILKSTNHQKETLKQKHRIRFQDVEIFYFNRQQSFCSVPSIGGSALGME-----MQHFLSEKFDLNNSSNNKGDLFK--SSTKSNPDSYDIHKDGSY------------------TNEGYSI-----LQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRXXXXXXXXXXXXXXXLGRVEFNPIRVRTHFIHTIMRLQMQDQ 970
            S+ +   SIL+     K +L +K R+RF  V ++YF+R+Q F SVPS GGS+LGM      ++H+   +F     S+++  L +     K N     + ++G+                     EG  +     LQP+  K RR LL+ SGI+RI+  +K     IR SRE CGC C    C P  C CSQ GI+CQVDR +FPCGC  + C N  GR+EFNP+RVRTH++HTIM+L ++ +
Sbjct:   48 STSLTPTSILR---RHKTSLGRK-RVRFDAVTVYYFSRRQGFTSVPSQGGSSLGMARHHCAIRHYTLGEFAREQESSHRIILRQHLRQEKLNARKLKLTRNGTVECAQADLLTLDDVSDDDLDVEGVEVDDCFFLQPLPTKRRRALLRASGIARIDAREKTELRAIRLSREECGCDCRF-YCDPHQCGCSQAGIKCQVDRMSFPCGCSRDGCRNTAGRIEFNPLRVRTHYLHTIMKLDLEKR 284          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Cavefish
Match: csrnp1b (cysteine/serine-rich nuclear protein 1 [Source:NCBI gene;Acc:103042410])

HSP 1 Score: 120.939 bits (302), Expect = 3.987e-28
Identity = 86/238 (36.13%), Postives = 123/238 (51.68%), Query Frame = 2
Query:  356 SILKSTNHQKETLKQKHRIRFQDVEIFYFNRQQSFCSVPSIGGSALGMEMQHFLSEKFDLNNSSNN---------------------KGDLFKSSTKSNPDSYDIHKD----------GSYTNEGYSILQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRXXXXXXXXXXXXXXXLGRVEFNPIRVRTHFIHTIMRLQMQDQYQ 976
            SILK     K    ++  ++F  V +F+F R Q F SVPS GG  LGM  +H    K+ L   +                       K  L K+ T+ + ++  +  D          G   + G S L P  +K R  +LK +G+ +I+  +K     +R SRE CGC C  G C PETCSCS  GI+CQ+D  +FPCGC  + C N  GR+EFNP RV+TH+IHTIM+L+++ + +
Sbjct:   64 SILK-----KSKRPRRGNVQFDQVTVFFFPRCQGFTSVPSRGGCTLGMMQRHSAQRKYTLAEFAIEQRHLRQEKLINRLREEKLEALKQKLTKNGTQDSEEADRLTVDDIPEEEIDITGVNLDSG-SFLHPYPSKRRHAILKAAGVKKIDKEEKRQLHALRMSREDCGCSC-QGFCEPETCSCSLAGIKCQMDHSSFPCGCTKDGCGNTEGRIEFNPSRVQTHYIHTIMKLELEKRLE 294          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Sea Lamprey
Match: csrnp2 (cysteine-serine-rich nuclear protein 2 [Source:ZFIN;Acc:ZDB-GENE-090312-137])

HSP 1 Score: 138.272 bits (347), Expect = 9.861e-37
Identity = 90/231 (38.96%), Postives = 123/231 (53.25%), Query Frame = 2
Query:  377 HQKETLKQKHR---IRFQDVEIFYFNRQQSFCSVPSIGGSALGMEM---------------------QHFLSEKFDLNNSSNNKGDLFKSSTKSNPDSYDIHKDG---------SYTNEGYSILQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRXXXXXXXXXXXXXXXLGRVEFNPIRVRTHFIHTIMRLQMQDQ 970
            H  +T  ++ R   +RF  V ++YF+R+Q F SVPS GGS LGM                       QH L +       +  +  L +S       ++ +  D          +   + Y  LQP+  + RR +L+ SG+ RI+  +K+    IR SRE CGC C +  C PETC CSQ GI CQVDR +FPCGC  + C N  GRVEFNP+RVRTHFIHTIMRL+++ +
Sbjct:   52 HSIQTASKRARGKNVRFDQVTVYYFSRRQGFTSVPSQGGSTLGMASRHDRVAVYSLGEFAQERERAHQHMLRQHLKEERLNALRLQLMQSGAPEPEHTHGLTVDDIPDEEVDARALDVDDYFFLQPLPTRKRRAMLRASGVRRIDGDEKQQLRAIRVSREECGCDCRS-HCDPETCGCSQAGISCQVDRLSFPCGCTLDGCGNASGRVEFNPVRVRTHFIHTIMRLELEKK 281          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Sea Lamprey
Match: csrnp2 (cysteine-serine-rich nuclear protein 2 [Source:ZFIN;Acc:ZDB-GENE-090312-137])

HSP 1 Score: 137.502 bits (345), Expect = 3.397e-36
Identity = 87/217 (40.09%), Postives = 117/217 (53.92%), Query Frame = 2
Query:  410 IRFQDVEIFYFNRQQSFCSVPSIGGSALGMEM---------------------QHFLSEKFDLNNSSNNKGDLFKSSTKSNPDSYDIHKDG---------SYTNEGYSILQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRXXXXXXXXXXXXXXXLGRVEFNPIRVRTHFIHTIMRLQMQDQ 970
            +RF  V ++YF+R+Q F SVPS GGS LGM                       QH L +       +  +  L +S       ++ +  D          +   + Y  LQP+  + RR +L+ SG+ RI+  +K+    IR SRE CGC C +  C PETC CSQ GI CQVDR +FPCGC  + C N  GRVEFNP+RVRTHFIHTIMRL+++ +
Sbjct:   84 VRFDQVTVYYFSRRQGFTSVPSQGGSTLGMASRHDRVAVYSLGEFAQERERAHQHMLRQHLKEERLNALRLQLMQSGAPEPEHTHGLTVDDIPDEEVDARALDVDDYFFLQPLPTRKRRAMLRASGVRRIDGDEKQQLRAIRVSREECGCDCRS-HCDPETCGCSQAGISCQVDRLSFPCGCTLDGCGNASGRVEFNPVRVRTHFIHTIMRLELEKK 299          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Nematostella
Match: EDO29869 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2E7])

HSP 1 Score: 110.153 bits (274), Expect = 3.511e-27
Identity = 77/190 (40.53%), Postives = 104/190 (54.74%), Query Frame = 2
Query:  395 KQKHRIRFQDVEIFYFNRQQSFCSVPSIGGSALGMEMQHFLSEKFDLNNSSNNKGDLFKSSTKSNPDSYDIHKDGSYTNEGYSILQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRXXXXXXXXXXXXXXXLGRVEFNPIRVRTHFIHTIMRLQMQ 964
            K   R+RF +  +F+F R Q    VPS GG  LGM+ +H   E F   +   N    F+S +  + +  D H              PI  K R+ +LK++G+ +I   +   C  IR SR+ CGC C    C P TCSCS NGI CQVDR +FPCGC  + C NP GR E++PI VR HFI T+++L+ Q
Sbjct:   31 KLPRRVRFYERTVFHFPRTQGSSCVPSNGGYTLGMKRKHSFVESFKFTDYDENLELCFQSESDEDEEDDDDHS-----------FLPIPQKTRKAILKDAGVKKINKQEASECMEIRYSRQICGCDC-KTFCDPATCSCSLNGINCQVDRDSFPCGCTRDACRNPQGRHEYDPISVRRHFIDTVLKLRGQ 208          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Nematostella
Match: EDO43879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXP2])

HSP 1 Score: 100.138 bits (248), Expect = 1.063e-22
Identity = 75/201 (37.31%), Postives = 99/201 (49.25%), Query Frame = 2
Query:  368 STNHQKETLKQKHR-----IRFQDVEIFYFNRQQSFCSVPSIGGSALGMEMQHFLSEKFDLNNSSNNKGDLFKSSTKSNPDSYDIHKDGSYTNEGYSILQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRXXXXXXXXXXXXXXXLGRVEFNPIRVRTHFIHTIMRL 955
            ST  +++ L  + R     +RF +V +FYF R+Q F SVPS GGS LGM   H   E   L                S PD      +        S   P+  K R+ LL+ SG+ RI   + + C  +R SR  CGC C   +C PETC C  NGI CQVD GNFPC C  + C N  GR +++P  V+ H+  T  +L
Sbjct:    7 STESEEDDLPYRKRLRERNVRFGEVTVFYFPRKQGFVSVPSSGGSTLGMARTHCFVETLKLC---------------STPD------EDFLCERKVSTAIPVPQKRRKALLRTSGVKRIYKKEAQDCMELRLSRILCGCSC-EDECYPETCECILNGIGCQVDYGNFPCSCSISNCQNSNGRKQYDPKIVQQHYCDTFTKL 185          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Medaka
Match: CSRNP3 (cysteine and serine rich nuclear protein 3 [Source:NCBI gene;Acc:101155731])

HSP 1 Score: 147.902 bits (372), Expect = 5.588e-37
Identity = 94/233 (40.34%), Postives = 129/233 (55.36%), Query Frame = 2
Query:  356 SILKSTNHQKETLKQKHRIRFQDVEIFYFNRQQSFCSVPSIGGSALGMEMQHFLSEKFDLNNSSNNKGDLFK-------SSTKSNPDSYDIHKDGSYTNEG-----------------------YSILQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRXXXXXXXXXXXXXXXLGRVEFNPIRVRTHFIHTIMRLQMQ 964
            SILK     +E   +  R+ F++V ++YF R+Q F SVPS GGS LGM  +H    ++ L   +  +  + K          K N    ++ K+G+  +E                        Y  LQP+  K RR LL++SG+ +I+  +K     IR SRE CGC+C    C PETC+CS  GI+CQVDR +FPCGC    CSN  GRVEFNPIRVRTHF+HTIM+L+++
Sbjct:   55 SILK-----REKRLRTRRVHFENVTVYYFTRRQGFTSVPSQGGSTLGMSSRHTWVRQYSLGEFALEQERIHKDMLRDHLKEEKLNSIKLELTKNGTVESEEASTLTAEDISDDDIDLDNTDVDEYFFLQPLTTKKRRALLRSSGVKKIDVEEKHELRAIRVSREDCGCECRV-FCDPETCACSIAGIKCQVDRMSFPCGCTKEGCSNTAGRVEFNPIRVRTHFLHTIMKLELE 281          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Medaka
Match: CSRNP3 (cysteine and serine rich nuclear protein 3 [Source:NCBI gene;Acc:101155731])

HSP 1 Score: 147.517 bits (371), Expect = 1.187e-36
Identity = 94/233 (40.34%), Postives = 129/233 (55.36%), Query Frame = 2
Query:  356 SILKSTNHQKETLKQKHRIRFQDVEIFYFNRQQSFCSVPSIGGSALGMEMQHFLSEKFDLNNSSNNKGDLFK-------SSTKSNPDSYDIHKDGSYTNEG-----------------------YSILQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRXXXXXXXXXXXXXXXLGRVEFNPIRVRTHFIHTIMRLQMQ 964
            SILK     +E   +  R+ F++V ++YF R+Q F SVPS GGS LGM  +H    ++ L   +  +  + K          K N    ++ K+G+  +E                        Y  LQP+  K RR LL++SG+ +I+  +K     IR SRE CGC+C    C PETC+CS  GI+CQVDR +FPCGC    CSN  GRVEFNPIRVRTHF+HTIM+L+++
Sbjct:   97 SILK-----REKRLRTRRVHFENVTVYYFTRRQGFTSVPSQGGSTLGMSSRHTWVRQYSLGEFALEQERIHKDMLRDHLKEEKLNSIKLELTKNGTVESEEASTLTAEDISDDDIDLDNTDVDEYFFLQPLTTKKRRALLRSSGVKKIDVEEKHELRAIRVSREDCGCECRVF-CDPETCACSIAGIKCQVDRMSFPCGCTKEGCSNTAGRVEFNPIRVRTHFLHTIMKLELE 323          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Medaka
Match: csrnp2 (cysteine and serine rich nuclear protein 2 [Source:NCBI gene;Acc:101158023])

HSP 1 Score: 134.806 bits (338), Expect = 7.421e-33
Identity = 94/240 (39.17%), Postives = 132/240 (55.00%), Query Frame = 2
Query:  335 SSEIIQKSILKSTNHQKETLKQKHRIRFQDVEIFYFNRQQSFCSVPSIGGSALGME-----MQHFLSEKFDLNNSSNNKGDLFK--SSTKSNPDSYDIHKDGSY-------------TNEGYSI----------LQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRXXXXXXXXXXXXXXXLGRVEFNPIRVRTHFIHTIMRLQMQ 964
            S+     SIL+    +K +L  K R+RF  V ++YF R+Q F SVPS GGS+LGM      ++H+   +F     S+++  L +     K N     + ++G+              ++E   +          LQP+  K RR LL+ SGI+RI+  +K     IR SRE CGC C    C P  C CSQ GI+CQVDR +FPCGC  + C N  GRVEFNP+RVRTH++HTIM+L ++
Sbjct:   49 STTFTPTSILR---QKKPSLGGK-RVRFDLVTVYYFPRRQGFTSVPSQGGSSLGMARHHCSIRHYTLGEFAREQESSHRHTLRQHMRQEKLNARKMKLTRNGTVECAQADLLTLDDVSDEDLDVEAVEVDDCFFLQPLPTKRRRALLRASGIARIDAREKAELRAIRLSREECGCDCRL-YCDPRHCGCSQAGIKCQVDRMSFPCGCSRDGCGNMAGRVEFNPLRVRTHYLHTIMKLDLE 283          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Medaka
Match: csrnp2 (cysteine and serine rich nuclear protein 2 [Source:NCBI gene;Acc:101158023])

HSP 1 Score: 134.806 bits (338), Expect = 7.421e-33
Identity = 94/240 (39.17%), Postives = 132/240 (55.00%), Query Frame = 2
Query:  335 SSEIIQKSILKSTNHQKETLKQKHRIRFQDVEIFYFNRQQSFCSVPSIGGSALGME-----MQHFLSEKFDLNNSSNNKGDLFK--SSTKSNPDSYDIHKDGSY-------------TNEGYSI----------LQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRXXXXXXXXXXXXXXXLGRVEFNPIRVRTHFIHTIMRLQMQ 964
            S+     SIL+    +K +L  K R+RF  V ++YF R+Q F SVPS GGS+LGM      ++H+   +F     S+++  L +     K N     + ++G+              ++E   +          LQP+  K RR LL+ SGI+RI+  +K     IR SRE CGC C    C P  C CSQ GI+CQVDR +FPCGC  + C N  GRVEFNP+RVRTH++HTIM+L ++
Sbjct:   49 STTFTPTSILR---QKKPSLGGK-RVRFDLVTVYYFPRRQGFTSVPSQGGSSLGMARHHCSIRHYTLGEFAREQESSHRHTLRQHMRQEKLNARKMKLTRNGTVECAQADLLTLDDVSDEDLDVEAVEVDDCFFLQPLPTKRRRALLRASGIARIDAREKAELRAIRLSREECGCDCRL-YCDPRHCGCSQAGIKCQVDRMSFPCGCSRDGCGNMAGRVEFNPLRVRTHYLHTIMKLDLE 283          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Medaka
Match: csrnp2 (cysteine and serine rich nuclear protein 2 [Source:NCBI gene;Acc:101158023])

HSP 1 Score: 134.806 bits (338), Expect = 7.421e-33
Identity = 94/240 (39.17%), Postives = 132/240 (55.00%), Query Frame = 2
Query:  335 SSEIIQKSILKSTNHQKETLKQKHRIRFQDVEIFYFNRQQSFCSVPSIGGSALGME-----MQHFLSEKFDLNNSSNNKGDLFK--SSTKSNPDSYDIHKDGSY-------------TNEGYSI----------LQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRXXXXXXXXXXXXXXXLGRVEFNPIRVRTHFIHTIMRLQMQ 964
            S+     SIL+    +K +L  K R+RF  V ++YF R+Q F SVPS GGS+LGM      ++H+   +F     S+++  L +     K N     + ++G+              ++E   +          LQP+  K RR LL+ SGI+RI+  +K     IR SRE CGC C    C P  C CSQ GI+CQVDR +FPCGC  + C N  GRVEFNP+RVRTH++HTIM+L ++
Sbjct:   49 STTFTPTSILR---QKKPSLGGK-RVRFDLVTVYYFPRRQGFTSVPSQGGSSLGMARHHCSIRHYTLGEFAREQESSHRHTLRQHMRQEKLNARKMKLTRNGTVECAQADLLTLDDVSDEDLDVEAVEVDDCFFLQPLPTKRRRALLRASGIARIDAREKAELRAIRLSREECGCDCRL-YCDPRHCGCSQAGIKCQVDRMSFPCGCSRDGCGNMAGRVEFNPLRVRTHYLHTIMKLDLE 283          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Planmine SMEST
Match: SMESG000005048.1 (SMESG000005048.1)

HSP 1 Score: 1352.81 bits (3500), Expect = 0.000e+0
Identity = 698/700 (99.71%), Postives = 699/700 (99.86%), Query Frame = 2
Query:  107 MSIENFFSNPKRLKLDDDMGEINVKTLYINNSNHNCEELIDSPMNSCEQVXXXXXXXXXXXXXXXXXXXXXNCEIYSSEIIQKSILKSTNHQKETLKQKHRIRFQDVEIFYFNRQQSFCSVPSIGGSALGMEMQHFLSEKFDLNNSSNNKGDLFKSSTKSNPDSYDIHKDGSYTNEGYSILQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRXXXXXXXXXXXXXXXLGRVEFNPIRVRTHFIHTIMRLQMQDQYQSEDPQDNCYSNQRLKTIENNKSDPLNLKEFDITLCNSTNQGSCRDCQNDKYLQVLMNEWTNQLQKLNPVRQYPSNASLPYESWTYSPEMFCSSIYYSKDFSTVSFLPYSNYTINSLSGLNVGTQHINNYHHNQPQVQYRQNPPVYHAECVEQNMLNFNTKSKHSDFSLTNDTDRLLDYTKHNSIGGSSPKHFHISSDQPLMIHENPDTQVQSSSYMPRNGNFHSFSMAKCEPVEHFPYQSRNPKMITSTKDVCKYDVGFVENLNASTSKLLCYNTSDFVNTIHYSLSKSNESNNVNSHCDESIISNVTSNISWSDDEETVGVNDDHLNPRIATASNGQLYTVLQPVSQSRIVSTFYQNSQAIDSCKICKFKSPDTRQRLNSFCVSDFSISTDIYHQTPPIKCTEKSEVCA 2206
            MSIENFFSNPKRLKLDDDMGEINVKTLYINNSNHNCEELIDSPMNSCEQVSISSAFDQDSSSILSGSLCESNCEIYSSEIIQKSILKSTNHQKETL+QKHRIRFQDVEIFYFNRQQSFCSVPSIGGSALGMEMQHFLSEKFDLNNSSNNKGDLFKSSTKSNPDSYDIHKDGSYTNEGYSILQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRGNFPCGCGPNPCSNPLGRVEFNPIRVRTHFIHTIMRLQMQDQYQSEDPQDNCYSNQRLKTIENNKSDPLN KEFDITLCNSTNQGSCRDCQNDKYLQVLMNEWTNQLQKLNPVRQYPSNASLPYESWTYSPEMFCSSIYYSKDFSTVSFLPYSNYTINSLSGLNVGTQHINNYHHNQPQVQYRQNPPVYHAECVEQNMLNFNTKSKHSDFSLTNDTDRLLDYTKHNSIGGSSPKHFHISSDQPLMIHENPDTQVQSSSYMPRNGNFHSFSMAKCEPVEHFPYQSRNPKMITSTKDVCKYDVGFVENLNASTSKLLCYNTSDFVNTIHYSLSKSNESNNVNSHCDESIISNVTSNISWSDDEETVGVNDDHLNPRIATASNGQLYTVLQPVSQSRIVSTFYQNSQAIDSCKICKFKSPDTRQRLNSFCVSDFSISTDIYHQTPPIKCTEKSEVCA
Sbjct:    1 MSIENFFSNPKRLKLDDDMGEINVKTLYINNSNHNCEELIDSPMNSCEQVSISSAFDQDSSSILSGSLCESNCEIYSSEIIQKSILKSTNHQKETLRQKHRIRFQDVEIFYFNRQQSFCSVPSIGGSALGMEMQHFLSEKFDLNNSSNNKGDLFKSSTKSNPDSYDIHKDGSYTNEGYSILQPIVAKHRRILLKNSGISRIETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRGNFPCGCGPNPCSNPLGRVEFNPIRVRTHFIHTIMRLQMQDQYQSEDPQDNCYSNQRLKTIENNKSDPLNSKEFDITLCNSTNQGSCRDCQNDKYLQVLMNEWTNQLQKLNPVRQYPSNASLPYESWTYSPEMFCSSIYYSKDFSTVSFLPYSNYTINSLSGLNVGTQHINNYHHNQPQVQYRQNPPVYHAECVEQNMLNFNTKSKHSDFSLTNDTDRLLDYTKHNSIGGSSPKHFHISSDQPLMIHENPDTQVQSSSYMPRNGNFHSFSMAKCEPVEHFPYQSRNPKMITSTKDVCKYDVGFVENLNASTSKLLCYNTSDFVNTIHYSLSKSNESNNVNSHCDESIISNVTSNISWSDDEETVGVNDDHLNPRIATASNGQLYTVLQPVSQSRIVSTFYQNSQAIDSCKICKFKSPDTRQRLNSFCVSDFSISTDIYHQTPPIKCTEKSEVCA 700          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Planmine SMEST
Match: SMESG000071075.1 (SMESG000071075.1)

HSP 1 Score: 76.6406 bits (187), Expect = 3.978e-14
Identity = 51/161 (31.68%), Postives = 84/161 (52.17%), Query Frame = 2
Query:  392 LKQKHRIRFQDVEIFYFNRQQSFCSVPSIGGSALGMEMQHFLSEKFDLN----NSSNNKGDLFKSSTKSNPDSYDIHKDGS--YTNEGYSILQPIVAKHRRILLKNSGISRIETVD----KEICDLIRSSRERCGCQCI-AGQCVPETCSCSQNGIQCQVD 841
            +K+ +R+RF+ V+++YF+R      VP  G + LGME  HF  E FD+      S    GD    +++ + D+  +H   S  YT +    LQP+    R+  L+ SG+   ++ D     ++   +R +R++ GC+C  +G+C    C CS  GI CQ D
Sbjct:    1 MKKDYRVRFKFVDVYYFSRCVGIDKVPERGNNPLGMEWIHFNFENFDITKRKLKSVQLYGDGDNINSQGDEDNESVHSVISIDYTPKS---LQPMNPMQRKKCLEGSGVVSADSDDISKNPKLLSKLRENRKQVGCKCSNSGKCDSNKCVCSSEGISCQSD 158          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Planmine SMEST
Match: SMESG000071075.1 (SMESG000071075.1)

HSP 1 Score: 71.633 bits (174), Expect = 1.380e-12
Identity = 53/175 (30.29%), Postives = 83/175 (47.43%), Query Frame = 2
Query:  392 LKQKHRIRFQDVEIFYFNRQQSFCSVPSIGGSALGMEMQHFLSEKFDLNNSSNNKGDLF---------KSSTKSNPDSYDIH-KDGSYTNEG-YSI---------LQPIVAKHRRILLKNSGISRIETVD----KEICDLIRSSRERCGCQCI-AGQCVPETCSCSQNGIQCQVD 841
            +K+ +R+RF+ V+++YF+R      VP  G + LGME  HF  E FD+         L+         K  T +   S  IH   G   NE  +S+         LQP+    R+  L+ SG+   ++ D     ++   +R +R++ GC+C  +G+C    C CS  GI CQ D
Sbjct:    1 MKKDYRVRFKFVDVYYFSRCVGIDKVPERGNNPLGMEWIHFNFENFDITKRKLKSVQLYGDGDNINSAKLCTSTPISSKHIHLGQGDEDNESVHSVISIDYTPKSLQPMNPMQRKKCLEGSGVVSADSDDISKNPKLLSKLRENRKQVGCKCSNSGKCDSNKCVCSSEGISCQSD 175          
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Planmine SMEST
Match: SMESG000071075.1 (SMESG000071075.1)

HSP 1 Score: 71.633 bits (174), Expect = 1.481e-12
Identity = 53/175 (30.29%), Postives = 83/175 (47.43%), Query Frame = 2
Query:  392 LKQKHRIRFQDVEIFYFNRQQSFCSVPSIGGSALGMEMQHFLSEKFDLNNSSNNKGDLF---------KSSTKSNPDSYDIH-KDGSYTNEG-YSI---------LQPIVAKHRRILLKNSGISRIETVD----KEICDLIRSSRERCGCQCI-AGQCVPETCSCSQNGIQCQVD 841
            +K+ +R+RF+ V+++YF+R      VP  G + LGME  HF  E FD+         L+         K  T +   S  IH   G   NE  +S+         LQP+    R+  L+ SG+   ++ D     ++   +R +R++ GC+C  +G+C    C CS  GI CQ D
Sbjct:    1 MKKDYRVRFKFVDVYYFSRCVGIDKVPERGNNPLGMEWIHFNFENFDITKRKLKSVQLYGDGDNINSAKLCTSTPISSKHIHLGQGDEDNESVHSVISIDYTPKSLQPMNPMQRKKCLEGSGVVSADSDDISKNPKLLSKLRENRKQVGCKCSNSGKCDSNKCVCSSEGISCQSD 175          
The following BLAST results are available for this feature:
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CSRNP24.012e-3539.42cysteine and serine rich nuclear protein 2 [Source... [more]
CSRNP32.019e-3439.00cysteine and serine rich nuclear protein 3 [Source... [more]
CSRNP37.310e-3438.43cysteine and serine rich nuclear protein 3 [Source... [more]
CSRNP37.310e-3438.43cysteine and serine rich nuclear protein 3 [Source... [more]
CSRNP37.310e-3438.43cysteine and serine rich nuclear protein 3 [Source... [more]
back to top
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
C41D11.31.022e-1432.30pep chromosome:WBcel235:I:4429547:4431916:-1 gene:... [more]
C41D11.31.097e-1432.30pep chromosome:WBcel235:I:4428631:4431916:-1 gene:... [more]
C41D11.31.097e-1432.30pep chromosome:WBcel235:I:4428475:4431916:-1 gene:... [more]
C41D11.31.846e-1432.30pep chromosome:WBcel235:I:4428631:4444342:-1 gene:... [more]
C41D11.31.846e-1432.30pep chromosome:WBcel235:I:4428467:4444342:-1 gene:... [more]
back to top
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Axud11.084e-3641.98gene:FBgn0261647 transcript:FBtr0077762[more]
Axud11.084e-3641.98gene:FBgn0261647 transcript:FBtr0077763[more]
Axud11.084e-3641.98gene:FBgn0261647 transcript:FBtr0330665[more]
Axud11.084e-3641.98gene:FBgn0261647 transcript:FBtr0330666[more]
back to top
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CSRNP32.163e-3540.34cysteine-serine-rich nuclear protein 3 [Source:NCB... [more]
CSRNP32.163e-3540.34cysteine-serine-rich nuclear protein 3 [Source:NCB... [more]
CSRNP33.755e-3539.08cysteine-serine-rich nuclear protein 3 [Source:NCB... [more]
CSRNP38.230e-3539.15cysteine-serine-rich nuclear protein 3 [Source:NCB... [more]
csrnp26.747e-3339.17cysteine-serine-rich nuclear protein 2 [Source:ZFI... [more]
back to top
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
csrnp23.943e-3735.97cysteine-serine-rich nuclear protein 2 [Source:NCB... [more]
glt8d21.012e-3440.16glycosyltransferase 8 domain containing 2 [Source:... [more]
csrnp11.228e-2535.43cysteine-serine-rich nuclear protein 1 [Source:NCB... [more]
back to top
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Csrnp22.341e-3539.42cysteine-serine-rich nuclear protein 2 [Source:MGI... [more]
Csrnp32.416e-3439.24cysteine-serine-rich nuclear protein 3 [Source:MGI... [more]
Csrnp32.416e-3439.24cysteine-serine-rich nuclear protein 3 [Source:MGI... [more]
Csrnp32.416e-3439.24cysteine-serine-rich nuclear protein 3 [Source:MGI... [more]
Csrnp32.721e-3439.24cysteine-serine-rich nuclear protein 3 [Source:MGI... [more]
back to top
BLAST of Cysteine/serine-rich nuclear protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8BGQ2|CSRN2_MOUSE1.637e-3439.42Cysteine/serine-rich nuclear protein 2 OS=Mus musc... [more]
sp|Q9H175|CSRN2_HUMAN1.927e-3439.42Cysteine/serine-rich nuclear protein 2 OS=Homo sap... [more]
sp|P59055|CSRN3_MOUSE1.903e-3339.24Cysteine/serine-rich nuclear protein 3 OS=Mus musc... [more]
sp|Q8WYN3|CSRN3_HUMAN3.511e-3338.43Cysteine/serine-rich nuclear protein 3 OS=Homo sap... [more]
sp|P59054|CSRN1_MOUSE1.120e-2637.30Cysteine/serine-rich nuclear protein 1 OS=Mus musc... [more]
back to top
BLAST of Cysteine/serine-rich nuclear protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7PYY59.059e-4139.71CSRNP_N domain-containing protein OS=Pomacea canal... [more]
A0A0L8HEB81.426e-3937.05CSRNP_N domain-containing protein OS=Octopus bimac... [more]
E9FX953.083e-3947.55CSRNP_N domain-containing protein OS=Daphnia pulex... [more]
A0A182H6363.131e-3942.42CSRNP_N domain-containing protein OS=Aedes albopic... [more]
A0A1S4G8021.546e-3843.17CSRNP_N domain-containing protein OS=Aedes aegypti... [more]
back to top
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CSRNP31.728e-3739.84cysteine and serine rich nuclear protein 3 [Source... [more]
CSRNP31.728e-3739.84cysteine and serine rich nuclear protein 3 [Source... [more]
csrnp22.014e-3338.84cysteine and serine rich nuclear protein 2 [Source... [more]
csrnp1b3.987e-2836.13cysteine/serine-rich nuclear protein 1 [Source:NCB... [more]
back to top
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
csrnp29.861e-3738.96cysteine-serine-rich nuclear protein 2 [Source:ZFI... [more]
csrnp23.397e-3640.09cysteine-serine-rich nuclear protein 2 [Source:ZFI... [more]
back to top
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO298693.511e-2740.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO438791.063e-2237.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CSRNP35.588e-3740.34cysteine and serine rich nuclear protein 3 [Source... [more]
CSRNP31.187e-3640.34cysteine and serine rich nuclear protein 3 [Source... [more]
csrnp27.421e-3339.17cysteine and serine rich nuclear protein 2 [Source... [more]
csrnp27.421e-3339.17cysteine and serine rich nuclear protein 2 [Source... [more]
csrnp27.421e-3339.17cysteine and serine rich nuclear protein 2 [Source... [more]
back to top
BLAST of Cysteine/serine-rich nuclear protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000005048.10.000e+099.71SMESG000005048.1[more]
SMESG000071075.13.978e-1431.68SMESG000071075.1[more]
SMESG000071075.11.380e-1230.29SMESG000071075.1[more]
SMESG000071075.11.481e-1230.29SMESG000071075.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011281 ID=SMED30011281|Name=Cysteine/serine-rich nuclear protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2316bp
CACAAAATTTAACGAATTTCATTGGTTATTGTATGCAGTTATTTAAATCA
TGATTTTGAAAAATTCTATTTACTGCTCTAAAGTTAAAATAAACTGATTT
TTTTTAATGTCCATCGAAAATTTCTTCAGTAATCCTAAGAGACTGAAGCT
GGACGATGACATGGGCGAAATTAATGTCAAAACATTGTATATAAACAATT
CTAATCATAACTGCGAAGAGTTGATAGATTCCCCAATGAATTCTTGTGAA
CAAGTTTCAATTAGTTCGGCTTTCGACCAAGACTCTTCATCTATTTTAAG
TGGTTCTTTATGCGAAAGCAATTGTGAAATTTACTCATCGGAGATTATTC
AGAAAAGCATTTTAAAATCAACAAACCACCAGAAAGAGACCTTGAAACAA
AAACACCGGATCCGATTTCAAGATGTAGAAATATTTTATTTTAATCGTCA
GCAAAGTTTCTGCTCAGTCCCAAGCATTGGCGGATCTGCGCTGGGAATGG
AAATGCAACATTTTCTTTCGGAGAAATTTGATTTGAATAATAGCAGCAAC
AATAAAGGAGATTTGTTTAAATCGTCTACGAAATCTAATCCCGATTCCTA
TGATATTCACAAAGATGGCAGCTACACAAATGAAGGATATTCAATTCTAC
AGCCGATAGTTGCAAAGCACAGGCGGATATTGCTTAAAAATTCAGGAATA
TCAAGAATAGAAACAGTTGATAAAGAAATTTGTGATCTAATAAGATCGAG
TAGAGAACGATGTGGCTGCCAGTGTATAGCTGGGCAATGTGTTCCAGAGA
CTTGCAGTTGTTCTCAAAATGGAATACAATGCCAAGTAGATCGTGGTAAT
TTTCCTTGCGGTTGTGGTCCTAATCCTTGCAGTAATCCATTGGGTCGAGT
GGAATTTAACCCTATTCGTGTCAGAACACATTTTATACACACTATAATGA
GACTTCAAATGCAAGACCAGTATCAATCAGAGGACCCTCAAGATAATTGT
TACTCGAATCAAAGGCTGAAAACCATTGAAAATAATAAATCAGATCCGTT
AAATTTGAAAGAGTTTGATATTACCTTATGCAACAGCACCAATCAAGGAT
CGTGTAGAGATTGTCAGAACGATAAATATTTACAAGTTCTCATGAATGAA
TGGACAAACCAACTTCAAAAACTTAATCCAGTGCGGCAATATCCCTCAAA
TGCATCTTTACCTTATGAATCTTGGACTTACAGTCCAGAGATGTTTTGCT
CCAGCATTTACTATTCTAAAGATTTTTCTACTGTATCTTTTTTACCATAT
TCAAATTACACAATTAACTCTCTGTCGGGCCTCAACGTCGGAACGCAACA
TATAAATAATTATCATCACAATCAACCACAAGTTCAGTATCGTCAAAACC
CACCAGTTTATCATGCAGAATGTGTTGAACAGAATATGCTGAACTTCAAT
ACGAAATCAAAACATTCTGATTTTTCCCTAACAAATGACACAGACCGATT
GCTGGATTACACCAAACATAATTCTATAGGTGGTTCTTCGCCTAAACATT
TTCATATTTCATCAGATCAGCCCTTGATGATACACGAGAACCCCGATACT
CAGGTGCAGTCATCATCCTATATGCCACGTAATGGTAATTTTCATTCATT
CTCCATGGCAAAATGTGAACCCGTTGAGCATTTTCCATATCAGTCTCGCA
ATCCGAAGATGATTACTAGTACGAAAGATGTATGTAAATACGATGTTGGG
TTTGTTGAGAATCTCAATGCCAGCACATCTAAACTGTTGTGCTATAATAC
GTCAGACTTTGTAAATACCATTCATTATTCTTTATCAAAGTCCAATGAGA
GTAATAACGTAAACAGTCATTGTGACGAATCCATTATATCAAATGTGACT
TCGAACATTTCTTGGTCAGACGATGAAGAGACCGTTGGTGTTAATGATGA
CCACCTCAATCCGAGAATCGCAACGGCATCTAATGGTCAATTGTACACTG
TTCTGCAGCCAGTGTCCCAGTCAAGAATCGTTTCTACATTCTATCAGAAT
TCTCAGGCAATTGACTCATGCAAAATTTGCAAATTTAAATCGCCTGACAC
AAGGCAGCGATTGAACAGTTTCTGTGTTTCAGATTTTTCTATTTCTACAG
ATATTTACCATCAGACACCGCCGATAAAGTGCACCGAAAAGTCTGAGGTT
TGCGCTTGAATGATCTGTGATATATTTTCATGATAATTGTCGTCACATAT
TTTATTAACTTATCCAATCGTAGTTTGCAAGACTTAGAGATAATGTAAAA
ATTATTAATAAATACC
back to top

protein sequence of SMED30011281-orf-1

>SMED30011281-orf-1 ID=SMED30011281-orf-1|Name=SMED30011281-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=701bp
MSIENFFSNPKRLKLDDDMGEINVKTLYINNSNHNCEELIDSPMNSCEQV
SISSAFDQDSSSILSGSLCESNCEIYSSEIIQKSILKSTNHQKETLKQKH
RIRFQDVEIFYFNRQQSFCSVPSIGGSALGMEMQHFLSEKFDLNNSSNNK
GDLFKSSTKSNPDSYDIHKDGSYTNEGYSILQPIVAKHRRILLKNSGISR
IETVDKEICDLIRSSRERCGCQCIAGQCVPETCSCSQNGIQCQVDRGNFP
CGCGPNPCSNPLGRVEFNPIRVRTHFIHTIMRLQMQDQYQSEDPQDNCYS
NQRLKTIENNKSDPLNLKEFDITLCNSTNQGSCRDCQNDKYLQVLMNEWT
NQLQKLNPVRQYPSNASLPYESWTYSPEMFCSSIYYSKDFSTVSFLPYSN
YTINSLSGLNVGTQHINNYHHNQPQVQYRQNPPVYHAECVEQNMLNFNTK
SKHSDFSLTNDTDRLLDYTKHNSIGGSSPKHFHISSDQPLMIHENPDTQV
QSSSYMPRNGNFHSFSMAKCEPVEHFPYQSRNPKMITSTKDVCKYDVGFV
ENLNASTSKLLCYNTSDFVNTIHYSLSKSNESNNVNSHCDESIISNVTSN
ISWSDDEETVGVNDDHLNPRIATASNGQLYTVLQPVSQSRIVSTFYQNSQ
AIDSCKICKFKSPDTRQRLNSFCVSDFSISTDIYHQTPPIKCTEKSEVCA
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR023260Cys/Ser-rich_nuc_prot
IPR031972CSRNP_N
Vocabulary: molecular function
TermDefinition
GO:0001228transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003677DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0019902phosphatase binding
GO:0043565sequence-specific DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0006366transcription from RNA polymerase II promoter
GO:0006915apoptotic process
GO:0010923negative regulation of phosphatase activity
GO:0045944positive regulation of transcription from RNA polymerase II promoter
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR023260Cysteine/serine-rich nuclear protein familyPRINTSPR02031CYSSERRICHNPcoord: 228..244
score: 71.34
coord: 212..223
score: 70.94
coord: 187..200
score: 47.8
IPR023260Cysteine/serine-rich nuclear protein familyPANTHERPTHR13580TGF-BETA INDUCED APOPTOSIS PROTEINcoord: 44..657
IPR031972Cysteine/serine-rich nuclear protein, N-terminal domainPFAMPF16019CSRNP_Ncoord: 162..286
e-value: 3.8E-49
score: 167.6
coord: 98..151
e-value: 2.2E-14
score: 53.9
NoneNo IPR availablePANTHERPTHR13580:SF9AXIN1 UP-REGULATED 1, ISOFORM Acoord: 44..657