Granulin precursor

Overview
NameGranulin precursor
Smed IDSMED30011250
Length (bp)1335
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Granulin precursor (SMED30011250) t-SNE clustered cells

Violin plots show distribution of expression levels for Granulin precursor (SMED30011250) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Granulin precursor (SMED30011250) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Granulin precursor (SMED30011250) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011250

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 20

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30011250h1SMcG0002769 Contig2381GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30011250h1SMcG0002769 Contig2381GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30011250h1SMcG0009313 PL06004A1G01smed_ncbi_20240424PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30011250h1SMcG0009313 PL06004A1G01smed_ncbi_20240424PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30011250h1SMcG0009313 Contig2381GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30011250h1SMcG0009313 Contig2381GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Smed sexual biotypeSMED30011250h1SMcG0002769 Contig2381GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30011250h1SMcG0009313 dd_Smed_v4_442_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30011250h1SMcG0009313 dd_Smed_v4_442_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011250h1SMcG0009313 dd_Smed_v4_442_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30011250h1SMcG0009313 dd_Smed_v4_442_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30011250h1SMcG0009313 dd_Smed_v4_442_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30011250h1SMcG0009313 dd_Smed_v4_442_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011250h1SMcG0009313 Contig2381GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011250h1SMcG0009313 Contig48299uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011250h1SMcG0009313 Contig48299newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30011250h1SMcG0009313 dd_Smed_v4_162_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30011250h1SMcG0009313 dd_Smed_v4_162_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30011250h1SMcG0009313 dd_Smed_v6_442_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30011250h1SMcG0009313 dd_Smed_v6_442_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Granulin precursor vs. Ensembl Human
Match: GRN (granulin precursor [Source:HGNC Symbol;Acc:HGNC:4601])

HSP 1 Score: 232.261 bits (591), Expect = 6.315e-71
Identity = 138/365 (37.81%), Postives = 189/365 (51.78%), Query Frame = 2
Query:  251 VTTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPD-QSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSK------LKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCD---HQAEALEIKISPI-------LVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKF 1294
             T  G+ SCCP+  AV C D  HCCP+   C+ +  +C             +   +S+ ++ CPD Q +C D S+CCVM DG++ CCP   A CC D+ HCCP    C+L    C +        K++  +   +  A+S+ S+ CPD  S C  G+TCC L  G YGCCP  NA CCSD L CCPQ+TVC+L    C SK    + L+     + V  V C D +  C DG TCC+L +G ++GCCP++ A CC D IHCCP    C+  KGTC+   HQ   +E   + +       L   + C N S C    TCC      ++CCPY   VCC+D  HCCP    C+     C +    ++
Sbjct:   75 FTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQ-----------RSGNNSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCITPTGTHPLAKKLPAQRTNRAVALSS-SVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGDVKC-DMEVSCPDGYTCCRLQSG-AWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQALKRDVPCDNVSSCPSSDTCCRDNRQGWACCPYRQGVCCADRRHCCPAGFRCAARGTKCLRREAPRW 425          

HSP 2 Score: 183.726 bits (465), Expect = 1.929e-52
Identity = 112/304 (36.84%), Postives = 150/304 (49.34%), Query Frame = 2
Query:  398 KLKVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNR-------VICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEA---LEIKISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKN 1279
            K     S  L   C   + C  G SC     G  +CCP+  AV C D  HCCP+   C+    +C  +               S  +I+CPD    C   +TCC++ DGS+GCCP   A CC D++ CCP    C+L    C + T     L K       NR       V+CPDA+ +C DG TCC+LP+G  YGCCP   ATCCSD +HCCPQ+TVC++ +  C  +  A   L  K+    V  +KC     C    TCC   + ++ CCP+  AVCC DH HCCP   +C     +C++ 
Sbjct:   48 KWPTTLSRHLGGPCQVDAHCSAGHSCIFTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQRSGNN-----------SVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCITPTGT-HPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELPSG-KYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGDVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQG 338          
BLAST of Granulin precursor vs. Ensembl Human
Match: GRN (granulin precursor [Source:HGNC Symbol;Acc:HGNC:4601])

HSP 1 Score: 234.572 bits (597), Expect = 3.424e-70
Identity = 140/350 (40.00%), Postives = 187/350 (53.43%), Query Frame = 2
Query:  251 VTTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPD-QSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSK------LKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCD---HQAEALEIKISPI-------LVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSC 1249
             T  G+ SCCP+  AV C D  HCCP+   C+ +  +C             +   +S+ ++ CPD Q +C D S+CCVM DG++ CCP   A CC D+ HCCP    C+L    C +        K++  +   +  A+S+ S+ CPD  S C  G+TCC L  G YGCCP  NA CCSD L CCPQ+TVC+L    C SK    + L+     + V  V C D +  C DG TCC+L +G ++GCCP++ A CC D IHCCP    C+  KGTC+   HQ   +E   + +       L   + C N S C    TCC   +  + CCP P AVCCSDH HCCP   +C
Sbjct:   75 FTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQ-----------RSGNNSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCITPTGTHPLAKKLPAQRTNRAVALSS-SVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGDVKC-DMEVSCPDGYTCCRLQSG-AWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQALKRDVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTC 410          

HSP 2 Score: 227.639 bits (579), Expect = 1.106e-67
Identity = 140/370 (37.84%), Postives = 193/370 (52.16%), Query Frame = 2
Query:  251 VTTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSI-------LSVVCPD-QSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTF------QPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALE-IKISPILVESIKCPNGSLCGQK------GTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFP 1297
            V  DGS+ CCP   A CC D+ HCCP    C+L    C  +       +  K+PA           SV+CPD +S+C DGS+CC +  G + CCP  +A CCSD  HCCPQ+TVC+L    C SK +   T +  K+PA +   ++C D   +C  G TCC L  G++GCCPF+ AVCC D + CCP    C+   GTC+    +   + K         P  + R +  D    C    TCC+L +G+ +GCCP   A CCSD  HCCPQ   C + +G C   +E +  ++  P    S+  P    C Q        TCCPS   S++CC  P+AVCC D  HCCP   +C++  +SC+K ++   P
Sbjct:  141 VMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRC--ITPTGTHPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSK-ENATTDLLTKLPAHTVGDVKC-DMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQALKRDVPCDNVSSCPSSDTCCQLTSGE-WGCCPIPEAVCCSDHQHCCPQGYTC-VAEGQCQRGSEIVAGLEKMPARRASLSHPRDIGCDQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARSCEKEVVSAQP 504          

HSP 3 Score: 210.69 bits (535), Expect = 2.870e-61
Identity = 126/361 (34.90%), Postives = 177/361 (49.03%), Query Frame = 2
Query:  263 GSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMK----LKIPAISNLSIECP-DGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRV-------ICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALE----IKISP-ILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKF 1294
            G Y CCP  +A CCSD  HCCPQ+T C+L +  C S  +   T +  K+PA ++  V C  +  C DG +CC +  G + CCP++ AVCC D  HCCP    C+   GTC+    +V    K    L +P    L  + P D  S+C +  TCC L+ G +GCCP   AVCCSD   CCPQ   C       + + ++ S ++   +  P  R        I  D    C  GQTCC    G S+ CC    A CC D+ HCCP    CN+   +C+ +  + +    +  SP + V+ ++C  G  C    TCC      ++CCPY   VCC+D  HCCP    C+     C +    ++
Sbjct:  227 GKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSK-ENATTDLLTKLPAHTVGDVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQALKRDVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTC-----VAEGQCQRGSEIVAGLEKMPARRASLSHPRDIGCDQHTSCPVGQTCCP-SLGGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARSCEKEVVSAQPATFLARSPHVGVKDVECGEGHFCHDNQTCCRDNRQGWACCPYRQGVCCADRRHCCPAGFRCAARGTKCLRREAPRW 580          

HSP 4 Score: 183.341 bits (464), Expect = 4.202e-51
Identity = 112/304 (36.84%), Postives = 150/304 (49.34%), Query Frame = 2
Query:  398 KLKVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNR-------VICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEA---LEIKISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKN 1279
            K     S  L   C   + C  G SC     G  +CCP+  AV C D  HCCP+   C+    +C  +               S  +I+CPD    C   +TCC++ DGS+GCCP   A CC D++ CCP    C+L    C + T     L K       NR       V+CPDA+ +C DG TCC+LP+G  YGCCP   ATCCSD +HCCPQ+TVC++ +  C  +  A   L  K+    V  +KC     C    TCC   + ++ CCP+  AVCC DH HCCP   +C     +C++ 
Sbjct:   48 KWPTTLSRHLGGPCQVDAHCSAGHSCIFTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQRSGN-----------NSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCITPTGT-HPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELPSG-KYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGDVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQG 338          
BLAST of Granulin precursor vs. Ensembl Human
Match: GRN (granulin precursor [Source:HGNC Symbol;Acc:HGNC:4601])

HSP 1 Score: 201.445 bits (511), Expect = 3.692e-59
Identity = 124/366 (33.88%), Postives = 175/366 (47.81%), Query Frame = 2
Query:  251 VTTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPD-QSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMK----LKIPAISNLSIECP-DGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRV-------ICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALE----IKISP-ILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKF 1294
             T  G+ SCCP+  AV C D  HCCP+   C+ +  +C             +   +S+ ++ CPD Q +C D S+CCVM DG++ CCP   AVCC D  HCCP    C+   GTC+    +V    K    L +P    L  + P D  S+C +  TCC L+ G +GCCP   AVCCSD   CCPQ   C       + + ++ S ++   +  P  R        I  D    C  GQTCC    G S+ CC    A CC D+ HCCP    CN+   +C+ +  + +    +  SP + V+ ++C  G  C    TCC      ++CCPY   VCC+D  HCCP    C+     C +    ++
Sbjct:   75 FTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQ-----------RSGNNSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQALKRDVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTC-----VAEGQCQRGSEIVAGLEKMPARRASLSHPRDIGCDQHTSCPVGQTCCPS-LGGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARSCEKEVVSAQPATFLARSPHVGVKDVECGEGHFCHDNQTCCRDNRQGWACCPYRQGVCCADRRHCCPAGFRCAARGTKCLRREAPRW 423          

HSP 2 Score: 167.548 bits (423), Expect = 1.767e-46
Identity = 106/313 (33.87%), Postives = 147/313 (46.96%), Query Frame = 2
Query:  398 KLKVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKT------FQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALE-IKISPILVESIKCPNGSLCGQK------GTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFP 1297
            K     S  L   C   + C  G SC     G  +CCP+  AV C D  HCCP+   C+    +C  +               S  +I+CPD    C   +TCC++ DGS+GCCP   AVCC D + CCP    C+   GTC+    +   + K         P  + R +  D    C    TCC+L +G+ +GCCP   A CCSD  HCCPQ   C + +G C   +E +  ++  P    S+  P    C Q        TCCPS   S++CC  P+AVCC D  HCCP   +C++  +SC+K ++   P
Sbjct:   48 KWPTTLSRHLGGPCQVDAHCSAGHSCIFTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQRSGN-----------NSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQALKRDVPCDNVSSCPSSDTCCQLTSGE-WGCCPIPEAVCCSDHQHCCPQGYTC-VAEGQCQRGSEIVAGLEKMPARRASLSHPRDIGCDQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARSCEKEVVSAQP 347          
BLAST of Granulin precursor vs. Ensembl Human
Match: GRN (granulin precursor [Source:HGNC Symbol;Acc:HGNC:4601])

HSP 1 Score: 197.978 bits (502), Expect = 1.809e-58
Identity = 119/304 (39.14%), Postives = 166/304 (54.61%), Query Frame = 2
Query:  428 SVVCPD-QSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKT------FQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALE-IKISPILVESIKCPNGSLCGQK------GTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFP 1297
            SV+CPD +S+C DGS+CC +  G + CCP  +A CCSD  HCCPQ+TVC+L    C SK +   T +  K+PA +   ++C D   +C  G TCC L  G++GCCPF+ AVCC D + CCP    C+   GTC+    +   + K         P  + R +  D    C    TCC+L +G+ +GCCP   A CCSD  HCCPQ   C + +G C   +E +  ++  P    S+  P    C Q        TCCPS   S++CC  P+AVCC D  HCCP   +C++  +SC+K ++   P
Sbjct:   19 SVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSK-ENATTDLLTKLPAHTVGDVKC-DMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQALKRDVPCDNVSSCPSSDTCCQLTSGE-WGCCPIPEAVCCSDHQHCCPQGYTC-VAEGQCQRGSEIVAGLEKMPARRASLSHPRDIGCDQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARSCEKEVVSAQP 318          

HSP 2 Score: 188.734 bits (478), Expect = 7.833e-55
Identity = 116/327 (35.47%), Postives = 162/327 (49.54%), Query Frame = 2
Query:  263 GSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMK----LKIPAISNLSIECP-DGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRV-------ICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALE----IKISP-ILVESIKCPNGSLCGQKGTCCPSANDSYSCCPY 1192
            G Y CCP  +A CCSD  HCCPQ+T C+L +  C S  +   T +  K+PA ++  V C  +  C DG +CC +  G + CCP++ AVCC D  HCCP    C+   GTC+    +V    K    L +P    L  + P D  S+C +  TCC L+ G +GCCP   AVCCSD   CCPQ   C       + + ++ S ++   +  P  R        I  D    C  GQTCC    G S+ CC    A CC D+ HCCP    CN+   +C+ +  + +    +  SP + V+ ++C  G  C    TCC      ++CCPY
Sbjct:   41 GKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSK-ENATTDLLTKLPAHTVGDVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQALKRDVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTC-----VAEGQCQRGSEIVAGLEKMPARRASLSHPRDIGCDQHTSCPVGQTCCPS-LGGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARSCEKEVVSAQPATFLARSPHVGVKDVECGEGHFCHDNQTCCRDNRQGWACCPY 360          

HSP 3 Score: 164.851 bits (416), Expect = 8.078e-46
Identity = 96/225 (42.67%), Postives = 125/225 (55.56%), Query Frame = 2
Query:  605 KEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCD---HQAEALEIKISPI-------LVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSC 1249
            K++  +   +  A+S+ S+ CPD  S C  G+TCC L  G YGCCP  NA CCSD L CCPQ+TVC+L    C SK    + L+     + V  V C D +  C DG TCC+L +G ++GCCP++ A CC D IHCCP    C+  KGTC+   HQ   +E   + +       L   + C N S C    TCC   +  + CCP P AVCCSDH HCCP   +C
Sbjct:    3 KKLPAQRTNRAVALSS-SVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGDVKC-DMEVSCPDGYTCCRLQSG-AWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQALKRDVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTC 224          

HSP 4 Score: 98.5969 bits (244), Expect = 5.534e-22
Identity = 61/172 (35.47%), Postives = 85/172 (49.42%), Query Frame = 2
Query:  257 TDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSI---LSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMK----LKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSN 751
            T G + CCP   AVCCSD QHCCPQ   C + +G C    + V    K+    +S+     + C   + C  G +CC    G++ACC    AVCC D+QHCCP    CN+ A +C+   KEVV+        + P +    +EC +G   C    TCC  +   + CCP+  
Sbjct:  196 TSGEWGCCPIPEAVCCSDHQHCCPQGYTC-VAEGQCQRGSEIVAGLEKMPARRASLSHPRDIGCDQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARSCE---KEVVSAQPATFLARSPHVGVKDVECGEG-HFCHDNQTCCRDNRQGWACCPYRQ 362          
BLAST of Granulin precursor vs. Ensembl Human
Match: GRN (granulin precursor [Source:HGNC Symbol;Acc:HGNC:4601])

HSP 1 Score: 74.7146 bits (182), Expect = 3.773e-15
Identity = 45/126 (35.71%), Postives = 59/126 (46.83%), Query Frame = 2
Query:  398 KLKVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSK------LKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAV 757
            K     S  L   C   + C  G SC     G  +CCP+  A CC D+ HCCP    C+L    C +        K++  +   +  A+S+ S+ CPD  S C  G+TCC L  G YGCCP  NA 
Sbjct:   48 KWPTTLSRHLGGPCQVDAHCSAGHSCIFTVSGTSSCCPFPEASCCEDRVHCCPHGAFCDLVHTRCITPTGTHPLAKKLPAQRTNRAVALSS-SVMCPDARSRCPDGSTCCELPSGKYGCCPMPNAT 172          

HSP 2 Score: 74.3294 bits (181), Expect = 4.238e-15
Identity = 44/108 (40.74%), Postives = 55/108 (50.93%), Query Frame = 2
Query:  686 CKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNR-------VICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAAT 988
            C  G +C     G+  CCPF  A CC D++ CCP    C+L    C + T     L K       NR       V+CPDA+ +C DG TCC+LP+G  YGCCP   AT
Sbjct:   67 CSAGHSCIFTVSGTSSCCPFPEASCCEDRVHCCPHGAFCDLVHTRCITPTGT-HPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELPSGK-YGCCPMPNAT 172          

HSP 3 Score: 63.929 bits (154), Expect = 2.193e-11
Identity = 37/100 (37.00%), Postives = 51/100 (51.00%), Query Frame = 2
Query:  251 VTTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSI-------LSVVCPD-QSQCDDGSSCCVMADGNFACCPYSSAV 526
             T  G+ SCCP+  A CC D+ HCCP    C+L    C  +       +  K+PA           SV+CPD +S+C DGS+CC +  G + CCP  +A 
Sbjct:   75 FTVSGTSSCCPFPEASCCEDRVHCCPHGAFCDLVHTRC--ITPTGTHPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNAT 172          

HSP 4 Score: 56.225 bits (134), Expect = 8.401e-9
Identity = 36/108 (33.33%), Postives = 49/108 (45.37%), Query Frame = 2
Query:  911 QCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC---------DHQAEALEIKISPILVESIKCPNG-SLCGQKGTCCPSANDSYSCCPYPNAV 1204
             CS G +C    +G S  CCP+  A+CC D++HCCP    C++    C           +  A     +  L  S+ CP+  S C    TCC   +  Y CCP PNA 
Sbjct:   66 HCSAGHSCIFTVSGTS-SCCPFPEASCCEDRVHCCPHGAFCDLVHTRCITPTGTHPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNAT 172          
BLAST of Granulin precursor vs. Ensembl Celegans
Match: pgrn-1 (ProGRaNulin homolog [Source:UniProtKB/TrEMBL;Acc:Q7JKP2])

HSP 1 Score: 111.694 bits (278), Expect = 4.735e-27
Identity = 84/246 (34.15%), Postives = 106/246 (43.09%), Query Frame = 2
Query:  671 DGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDS--------KTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNIN---------------KGTCDHQAEALEIKISPIL----------------VESIKCPNGSLCGQKGTCC----PSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKN 1279
            D  + C    TCC L D ++GCCP  NAVCC D+  CCP  T C+     C          K KKP+   KT + N  N V+CPD   +C DG TCC L  G SYGCCP   A CC+D +HCCP    C+                   T  H+  A+E                       V+ I C  G  C  K TCC     +      CCP  NA+CC +   CCP    C ++   C+K+
Sbjct:   99 DAETECSDDETCCKLGDNTWGCCPMPNAVCCDDRSHCCPTGTTCDPQGARCIGADEKHVPMKKKKPAR--KTVERNQFNEVVCPDKASKCPDGSTCCLLEQG-SYGCCPVPNAVCCADMLHCCPNGFTCHGQFCSQNFAMIPHLRKFASTSIHRKPAVEFLSEEEEDDDDEESTSSEDPESDVDPIACGVGKTCPAKTTCCNVRGKNGEPKTMCCPLSNAICCEN--TCCPAGYHC-VDGGKCEKH 338          

HSP 2 Score: 108.612 bits (270), Expect = 5.698e-26
Identity = 83/268 (30.97%), Postives = 120/268 (44.78%), Query Frame = 2
Query:  395 IKLKVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLS------IECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVC-------------NLPAGTCDSKTKKPSLLIKTFQ---------------PNPVNRVICPDAKYQCSDGQTCCKLPTGDSY---GCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKI 1087
            + L V    + +  C  +++C D  +CC + D  + CCP  +AVCC D+ HCCP  T C+     C    ++ V  MK K PA   +       + CPD +S C  G+TCCLL  GSYGCCP  NAVCC+D L CCP    C             +L      S  +KP++   + +                + V+ + C   K  C    TCC +   +      CCP S A CC +   CCP    C ++ G C+  A+ +  + 
Sbjct:   84 LFLAVFLCRVTAHQCDAETECSDDETCCKLGDNTWGCCPMPNAVCCDDRSHCCPTGTTCDPQGARCIGADEKHVP-MKKKKPARKTVERNQFNEVVCPDKASKCPDGSTCCLLEQGSYGCCPVPNAVCCADMLHCCPNGFTCHGQFCSQNFAMIPHLRKFASTSIHRKPAVEFLSEEEEDDDDEESTSSEDPESDVDPIACGVGK-TCPAKTTCCNVRGKNGEPKTMCCPLSNAICCENT--CCPAGYHC-VDGGKCEKHAKTMRTRF 346          

HSP 3 Score: 94.3597 bits (233), Expect = 5.277e-21
Identity = 77/232 (33.19%), Postives = 107/232 (46.12%), Query Frame = 2
Query:  260 DGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSIL------SVVCPDQ-SQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSA----GTCDSKLKEVVTKMKLKIPAISNLS-----------------------IECPDGSSTCKTGATCCLLSDGSYG-----CCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTK 838
            D ++ CCP  +AVCC D+ HCCP  T C+     C    ++ V  +K K PA   +       VVCPD+ S+C DGS+CC++  G++ CCP  +AVCC+D  HCCP    C+             L++  +    + PA+  LS                       I C  G  TC    TCC +  G  G     CCP SNA+CC +  +CCP    C +  G C+   K
Sbjct:  115 DNTWGCCPMPNAVCCDDRSHCCPTGTTCDPQGARCIGADEKHVP-MKKKKPARKTVERNQFNEVVCPDKASKCPDGSTCCLLEQGSYGCCPVPNAVCCADMLHCCPNGFTCHGQFCSQNFAMIPHLRKFASTSIHRKPAVEFLSEEEEDDDDEESTSSEDPESDVDPIACGVG-KTCPAKTTCCNVR-GKNGEPKTMCCPLSNAICCEN--TCCPAGYHC-VDGGKCEKHAK 340          

HSP 4 Score: 87.8113 bits (216), Expect = 8.598e-19
Identity = 60/154 (38.96%), Postives = 79/154 (51.30%), Query Frame = 2
Query:  899 DAKYQCSDGQTCCKLPTGD-SYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC---DHQAEALEIK------ISPILVESIKCPN-GSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNI-----LLKFPIINFH 1312
            DA+ +CSD +TCCKL  GD ++GCCP   A CC D+ HCCP  T C+     C   D +   ++ K      +       + CP+  S C    TCC     SY CCP PNAVCC+D  HCCPN  +C  + + C +N      L KF   + H
Sbjct:   99 DAETECSDDETCCKL--GDNTWGCCPMPNAVCCDDRSHCCPTGTTCDPQGARCIGADEKHVPMKKKKPARKTVERNQFNEVVCPDKASKCPDGSTCCLLEQGSYGCCPVPNAVCCADMLHCCPNGFTC--HGQFCSQNFAMIPHLRKFASTSIH 248          

HSP 5 Score: 51.2174 bits (121), Expect = 7.438e-7
Identity = 24/57 (42.11%), Postives = 32/57 (56.14%), Query Frame = 2
Query: 1100 VESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSC 1270
            V + +C   + C    TCC   ++++ CCP PNAVCC D SHCCP  T+C      C
Sbjct:   93 VTAHQCDAETECSDDETCCKLGDNTWGCCPMPNAVCCDDRSHCCPTGTTCDPQGARC 149          
BLAST of Granulin precursor vs. Ensembl Celegans
Match: pgrn-1 (ProGRaNulin homolog [Source:UniProtKB/TrEMBL;Acc:Q7JKP2])

HSP 1 Score: 105.916 bits (263), Expect = 3.404e-25
Identity = 56/129 (43.41%), Postives = 73/129 (56.59%), Query Frame = 2
Query:  437 CPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLS------IECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCN 805
            C  +++C D  +CC + D  + CCP  +AVCC D+ HCCP  T C+     C    ++ V  MK K PA   +       + CPD +S C  G+TCCLL  GSYGCCP  NAVCC+D L CCP    C+
Sbjct:   98 CDAETECSDDETCCKLGDNTWGCCPMPNAVCCDDRSHCCPTGTTCDPQGARCIGADEKHV-PMKKKKPARKTVERNQFNEVVCPDKASKCPDGSTCCLLEQGSYGCCPVPNAVCCADMLHCCPNGFTCH 225          

HSP 2 Score: 105.531 bits (262), Expect = 5.128e-25
Identity = 58/130 (44.62%), Postives = 70/130 (53.85%), Query Frame = 2
Query:  671 DGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDS--------KTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCN 1036
            D  + C    TCC L D ++GCCP  NAVCC D+  CCP  T C+     C          K KKP+   KT + N  N V+CPD   +C DG TCC L  G SYGCCP   A CC+D +HCCP    C+
Sbjct:   99 DAETECSDDETCCKLGDNTWGCCPMPNAVCCDDRSHCCPTGTTCDPQGARCIGADEKHVPMKKKKPAR--KTVERNQFNEVVCPDKASKCPDGSTCCLLEQG-SYGCCPVPNAVCCADMLHCCPNGFTCH 225          

HSP 3 Score: 88.5817 bits (218), Expect = 3.738e-19
Identity = 60/154 (38.96%), Postives = 79/154 (51.30%), Query Frame = 2
Query:  899 DAKYQCSDGQTCCKLPTGD-SYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC---DHQAEALEIK------ISPILVESIKCPN-GSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNI-----LLKFPIINFH 1312
            DA+ +CSD +TCCKL  GD ++GCCP   A CC D+ HCCP  T C+     C   D +   ++ K      +       + CP+  S C    TCC     SY CCP PNAVCC+D  HCCPN  +C  + + C +N      L KF   + H
Sbjct:   99 DAETECSDDETCCKL--GDNTWGCCPMPNAVCCDDRSHCCPTGTTCDPQGARCIGADEKHVPMKKKKPARKTVERNQFNEVVCPDKASKCPDGSTCCLLEQGSYGCCPVPNAVCCADMLHCCPNGFTC--HGQFCSQNFAMIPHLRKFASTSIH 248          

HSP 4 Score: 87.0409 bits (214), Expect = 1.319e-18
Identity = 47/112 (41.96%), Postives = 64/112 (57.14%), Query Frame = 2
Query:  260 DGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSIL------SVVCPDQ-SQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCN 574
            D ++ CCP  +AVCC D+ HCCP  T C+     C     E    +K K PA   +       VVCPD+ S+C DGS+CC++  G++ CCP  +AVCC+D  HCCP    C+
Sbjct:  115 DNTWGCCPMPNAVCCDDRSHCCPTGTTCDPQGARCIGA-DEKHVPMKKKKPARKTVERNQFNEVVCPDKASKCPDGSTCCLLEQGSYGCCPVPNAVCCADMLHCCPNGFTCH 225          

HSP 5 Score: 51.6026 bits (122), Expect = 6.246e-7
Identity = 24/57 (42.11%), Postives = 32/57 (56.14%), Query Frame = 2
Query: 1100 VESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSC 1270
            V + +C   + C    TCC   ++++ CCP PNAVCC D SHCCP  T+C      C
Sbjct:   93 VTAHQCDAETECSDDETCCKLGDNTWGCCPMPNAVCCDDRSHCCPTGTTCDPQGARC 149          
BLAST of Granulin precursor vs. Ensembl Celegans
Match: T02B11.8 (pep chromosome:WBcel235:V:877530:878667:-1 gene:WBGene00044776.1 transcript:T02B11.8a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T02B11.8)

HSP 1 Score: 44.669 bits (104), Expect = 7.657e-6
Identity = 21/60 (35.00%), Postives = 29/60 (48.33%), Query Frame = 2
Query: 1133 CGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIINFH 1312
            C +   CCP  N+ Y CCP+    CC   +HCCP   SC+    +C +   L  P+  F 
Sbjct:   34 CDEYAVCCPIGNEQYGCCPFTGGTCCPGTNHCCPPGFSCT-TIGTCKRTTTLSNPVSPFR 92          
BLAST of Granulin precursor vs. Ensembl Zebrafish
Match: grnb (granulin b [Source:ZFIN;Acc:ZDB-GENE-030131-7393])

HSP 1 Score: 239.195 bits (609), Expect = 4.209e-71
Identity = 150/396 (37.88%), Postives = 207/396 (52.27%), Query Frame = 2
Query:  251 VTTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTC--DSVLKEVVTKIKLKVPASSILSVVCPD-QSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTC--------------DSKLKEVVTKMKLKIPAISN--LSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTC-------DSKTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKISPILVESI-----------KCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSC----DKNILLKFPIINFHP 1315
            +T  G Y CCP   A CCSD  HCC Q T C+L    C   + + + V K++ K+ A     VVCPD +S+C D ++CC M DG + CCP  +AVCC D++HCCPQ T C+L    C              D++ ++ + K  + +PA  N    + CPD  S C    TCCLL  GSYGCCP   AVCCSD+  CCP+ T C+L   TC       +  TK P++ +      P   V+  +    CS G TCCK P G S+ CCP   A CC D IHCCP+ T+CN+   +CD  A    + +S   +E +           KC   S C  + TCC  ++  + CCP P AVCC DH HCCP+ + C++  ++C    D  + +  P++   P
Sbjct:   36 LTPSGGYGCCPLPHAECCSDHLHCCYQGTLCDLEHSKCVNKTHVLDWVEKVEAKLQA-----VVCPDGESECPDDTTCCQMPDGGWGCCPMKNAVCCDDRKHCCPQGTTCDLVHSMCVSTTYGSSPFLRKFDARRRKPLEKNAVDLPAEVNNIREVICPDKISKCPEDTTCCLLETGSYGCCPMPKAVCCSDQKHCCPEGTTCDLIHSTCLSANGVSEMATKIPAVTVL----KPKEEVVPCNETVACSSGTTCCKTPEG-SWACCPLPKAVCCEDHIHCCPEGTLCNVAASSCDDPA---GLSVSVPWMEKVSTKPIAPPPNKKCDESSSCPGESTCCKLSSGDWGCCPLPEAVCCEDHVHCCPHGSVCNVAAETCETVSDSGLRISVPMVKKIP 418          

HSP 2 Score: 231.491 bits (589), Expect = 2.930e-68
Identity = 144/391 (36.83%), Postives = 207/391 (52.94%), Query Frame = 2
Query:  260 DGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTC--------------DSVLKEVVTKIKLKVPAS--SILSVVCPDQ-SQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLS-----IECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCD-------SKTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKISPILVESI----------KCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIINFHP 1315
            DG + CCP  +AVCC D++HCCPQ T C+L    C              D+  ++ + K  + +PA   +I  V+CPD+ S+C + ++CC++  G++ CCP   AVCCSD++HCCP+ T C+L   TC S     V++M  KIPA++ L      + C + +  C +G TCC   +GS+ CCP   AVCC D + CCP+ T+CN+ A +CD       S      +  K   P P  +    D    C    TCCKL +GD +GCCP   A CC D +HCCP  +VCN+   TC+  +++  ++IS  +V+ I           C   S C    TCC   + S++CCP P AVCC+D  HCCP   +C L   SC ++ L         P
Sbjct:  113 DGGWGCCPMKNAVCCDDRKHCCPQGTTCDLVHSMCVSTTYGSSPFLRKFDARRRKPLEKNAVDLPAEVNNIREVICPDKISKCPEDTTCCLLETGSYGCCPMPKAVCCSDQKHCCPEGTTCDLIHSTCLS--ANGVSEMATKIPAVTVLKPKEEVVPC-NETVACSSGTTCCKTPEGSWACCPLPKAVCCEDHIHCCPEGTLCNVAASSCDDPAGLSVSVPWMEKVSTKPIAPPPNKKC---DESSSCPGESTCCKLSSGD-WGCCPLPEAVCCEDHVHCCPHGSVCNVAAETCETVSDS-GLRISVPMVKKIPAVSVPSQKQNCDETSSCPTGTTCCKLTSGSWACCPMPQAVCCADQEHCCPQGYTCDLAQSSCVRSGLPSMAWFRKEP 495          

HSP 3 Score: 216.083 bits (549), Expect = 1.927e-62
Identity = 137/369 (37.13%), Postives = 194/369 (52.57%), Query Frame = 2
Query:  263 GSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILS-----VVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLS---IECP-----DGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAKYQCSD------GQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQA--EALEIKISPILVESIKCPNGSLCGQKGTCCPSAN--------DSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNI 1282
            GSY CCP   AVCCSD++HCCP+ T C+L   TC S     V+++  K+PA ++L      V C +   C  G++CC   +G++ACCP   AVCC D  HCCP+ T+CN++A +CD         + + +P +  +S   I  P     D SS+C   +TCC LS G +GCCP   AVCC D + CCP  +VCN+ A TC++ +    L I       +  V  P  K  C +      G TCCKL +G S+ CCP   A CC+D+ HCCPQ   C++ + +C           +  P L E+ +  +  +C  + T CP  +          + CCP P AVCC D  HCCP+  +C+    SC K +
Sbjct:  207 GSYGCCPMPKAVCCSDQKHCCPEGTTCDLIHSTCLSA--NGVSEMATKIPAVTVLKPKEEVVPCNETVACSSGTTCCKTPEGSWACCPLPKAVCCEDHIHCCPEGTLCNVAASSCDDP-----AGLSVSVPWMEKVSTKPIAPPPNKKCDESSSCPGESTCCKLSSGDWGCCPLPEAVCCEDHVHCCPHGSVCNVAAETCETVSDS-GLRISVPMVKKIPAVSVPSQKQNCDETSSCPTGTTCCKLTSG-SWACCPMPQAVCCADQEHCCPQGYTCDLAQSSCVRSGLPSMAWFRKEPALRETQRVEDRHMCDAQ-TSCPRDDTCCFINRIGKWGCCPLPKAVCCKDGDHCCPSGYTCNEEKTSCTKGL 565          

HSP 4 Score: 212.231 bits (539), Expect = 3.919e-61
Identity = 125/317 (39.43%), Postives = 166/317 (52.37%), Query Frame = 2
Query:  428 SVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSK--LKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTF-----------------QPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC--DHQAEALEIKISPILV-----ESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPI 1300
            +++CPD   C+DG++CC+   G + CCP   A CCSD  HCC Q T+C+L    C +K  + + V K++ K+ A+      CPDG S C    TCC + DG +GCCP  NAVCC D+  CCPQ T C+L    C S T   S  ++ F                 + N +  VICPD   +C +  TCC L TG SYGCCP   A CCSD+ HCCP+ T C++   TC   +    +  KI  + V     E + C     C    TCC +   S++CCP P AVCC DH HCCP  T C++   SCD    L   +
Sbjct:   19 ALICPDGGMCEDGNTCCLTPSGGYGCCPLPHAECCSDHLHCCYQGTLCDLEHSKCVNKTHVLDWVEKVEAKLQAVV-----CPDGESECPDDTTCCQMPDGGWGCCPMKNAVCCDDRKHCCPQGTTCDLVHSMCVSTTYGSSPFLRKFDARRRKPLEKNAVDLPAEVNNIREVICPDKISKCPEDTTCCLLETG-SYGCCPMPKAVCCSDQKHCCPEGTTCDLIHSTCLSANGVSEMATKIPAVTVLKPKEEVVPCNETVACSSGTTCCKTPEGSWACCPLPKAVCCEDHIHCCPEGTLCNVAASSCDDPAGLSVSV 329          

HSP 5 Score: 212.231 bits (539), Expect = 4.166e-61
Identity = 141/368 (38.32%), Postives = 190/368 (51.63%), Query Frame = 2
Query:  254 TTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCD-----SVLKEVVTKIKLKVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTC----DSKLKEVVTKMKLKIPAISNLSIECP-DGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQP------NPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCD---HQAEALEIKISPILV--------ESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDK 1276
            T +GS++CCP   AVCC D  HCCP+ T CN+   +CD     SV    + K+  K P +   +  C + S C   S+CC ++ G++ CCP   AVCC D  HCCP  +VCN++A TC    DS L+  V  +K KIPA+S  S +   D +S+C TG TCC L+ GS+ CCP   AVCC+D+  CCPQ   C+L   +C  ++  PS+     +P         +R +C DA+  C    TCC +     +GCCP   A CC D  HCCP    CN  K +C    HQ      K + +          E +KC + + C    TCC      + CCP   AVCC DH HCCP    C L   +C+K
Sbjct:  283 TPEGSWACCPLPKAVCCEDHIHCCPEGTLCNVAASSCDDPAGLSVSVPWMEKVSTK-PIAPPPNKKCDESSSCPGESTCCKLSSGDWGCCPLPEAVCCEDHVHCCPHGSVCNVAAETCETVSDSGLRISVPMVK-KIPAVSVPSQKQNCDETSSCPTGTTCCKLTSGSWACCPMPQAVCCADQEHCCPQGYTCDLAQSSC-VRSGLPSMAWFRKEPALRETQRVEDRHMC-DAQTSCPRDDTCCFINRIGKWGCCPLPKAVCCKDGDHCCPSGYTCNEEKTSCTKGLHQIPWFTKKTARVWKSSDELLGHEDVKCDSSTSCPSGSTCCILPTGQWGCCPLVKAVCCEDHEHCCPQGYICKLELGTCEK 646          

HSP 6 Score: 208.764 bits (530), Expect = 9.215e-60
Identity = 125/357 (35.01%), Postives = 182/357 (50.98%), Query Frame = 2
Query:  257 TDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSV----LKEVVTKIKLKVPASSILSVV--CPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECP---DGSSTCKTGATCCLLSD-GSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSK-------TKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDK 1276
            + G + CCP   AVCC D  HCCP  + CN+   TC++V    L+  V  +K K+PA S+ S    C + S C  G++CC +  G++ACCP   AVCC+D++HCCPQ   C+L+  +C       +   + +        +E     D  ++C    TCC ++  G +GCCP   AVCC D   CCP    CN    +C          TKK + + K+      +  +  D+   C  G TCC LPTG  +GCCP   A CC D  HCCPQ  +C +  GTC+  +  + + ++ + +  I+C   + C    +CC  A+ +++CCPY  AVCC D  HCCP    C    + C K
Sbjct:  364 SSGDWGCCPLPEAVCCEDHVHCCPHGSVCNVAAETCETVSDSGLRISVPMVK-KIPAVSVPSQKQNCDETSSCPTGTTCCKLTSGSWACCPMPQAVCCADQEHCCPQGYTCDLAQSSCVRSGLPSMAWFRKEPALRETQRVEDRHMCDAQTSCPRDDTCCFINRIGKWGCCPLPKAVCCKDGDHCCPSGYTCNEEKTSCTKGLHQIPWFTKKTARVWKSSDELLGHEDVKCDSSTSCPSGSTCCILPTG-QWGCCPLVKAVCCEDHEHCCPQGYICKLELGTCEKASADVSVSLTAVQMPEIQCDTFTRCAHTQSCCRLADSTWACCPYTQAVCCKDMKHCCPMGYKCDPKVQGCTK 718          
BLAST of Granulin precursor vs. Ensembl Zebrafish
Match: grna (granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434])

HSP 1 Score: 220.32 bits (560), Expect = 8.784e-63
Identity = 145/389 (37.28%), Postives = 195/389 (50.13%), Query Frame = 2
Query:  260 DGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEV----------VTKIKLKVPASSILS--VVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEV----------VTKMKLKIPAISNLS--IECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKT------KKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC--------DHQAEALEIKISPIL-VESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIINF 1309
            DG + CCP   AVCC D  HCCP   +CN+  G+CD     V          + K K+ V  +S  S  V C D + C DGS+CC   DG +ACCP   AVCC D  HCCP    C+++AG+C+     V          + K K+    +S +S  + C D +  C  G+TCC   DG +GCCP   AVCC D + CCP    CN+ AG+CD  +      +K  + ++  Q  P  +V C +A + C +  TCCK   G+ +GCCP+S A CC+D  HCCP +  CN++  +C         +   A E   +P L +  +KC   S C    TCC  + D   CCP+P AVCC D  HCCP    C L  +SC K   L   I   
Sbjct:  569 DGEWGCCPLPEAVCCEDFIHCCPHGKKCNVAAGSCDDPSGSVPWMDKVPVRPIKKQKVAVTQASSASSDVPCNDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDSSGSVPWVEKVPVRPIRKQKVANTKVSPVSSDVACND-TVACPDGSTCCKDKDGDWGCCPLPEAVCCEDFIHCCPHGKKCNVAAGSCDDPSGSVPWVEKVPVHLRAGQ-RPSGKVKC-NATHGCPESSTCCKNIAGE-WGCCPFSQAVCCTDGEHCCPAHYKCNLSSVSCIKGDVVIPWYNKIAAESTPAPKLDLGVVKCDEQSSCSADSTCCLLSKDETGCCPFPEAVCCPDQKHCCPEGYRCDLRRRSCVKTTRLYVEITQL 953          

HSP 2 Score: 218.779 bits (556), Expect = 2.836e-62
Identity = 139/394 (35.28%), Postives = 201/394 (51.02%), Query Frame = 2
Query:  254 TTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDS-------VLKEVVTKIKLKVPASSILS-----VVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEV----------VTKMKLKIPAISNLSIECP-DGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTC-DSKTKKPSLLIKTFQP-----------NPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEAL-EIKISPILVESIKCPNGSL-------CGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIIN 1306
            T DG ++CCP   AVCC D  HCCP   +C++  G+C+        V K  V  I+ +  A + +S     + C D   C DGS+CC   DG + CCP   AVCC D  HCCP    CN++AG+CD     V          + K K+ +   S+ S + P + ++ C  G+TCC   DG + CCP   AVCC D + CCP    C++ AG+C DS    P +     +P           +PV+  +  +    C DG TCCK   GD +GCCP   A CC D IHCCP    CN+  G+CD  + ++  ++  P+ + + + P+G +       C +  TCC +    + CCP+  AVCC+D  HCCP +  C+L++ SC K  ++  P  N
Sbjct:  479 TKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGSVPWVEKVPVRPIRKQKVAVTTVSPVSSDIACNDTVACPDGSTCCKDKDGEWGCCPLPEAVCCEDFIHCCPHGKKCNVAAGSCDDPSGSVPWMDKVPVRPIKKQKVAVTQASSASSDVPCNDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDSSGSVPWVEKVPVRPIRKQKVANTKVSPVSSDVACNDTVACPDGSTCCKDKDGD-WGCCPLPEAVCCEDFIHCCPHGKKCNVAAGSCDDPSGSVPWVEKVPVHLRAGQRPSGKVKCNATHGCPESSTCCKNIAGEWGCCPFSQAVCCTDGEHCCPAHYKCNLSSVSCIKGDVV-IPWYN 870          

HSP 3 Score: 206.068 bits (523), Expect = 9.715e-58
Identity = 132/393 (33.59%), Postives = 200/393 (50.89%), Query Frame = 2
Query:  254 TTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCD------SVLKEV----VTKIKLKVPASSILS--VVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKL---KEVVTKMKLKIPAISNL------SIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKT--------------KKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEAL----EIKISPILVESIK------------CPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKN 1279
            T DG ++CCP   AVCC D  HCCP   +C++  G+C+      S +++V    + K K+ V   S +S  V C D + C DG++CC   +G++ACCP   AVCC D  HCCP+   CN++A  C+  L   + +V +  ++     N+       + C D ++ C  G+TCC   DG + CCP   AVCC D + CCP    C++ AG+C+  +              +K  + + T   +PV+  I  +    C DG TCCK   G+ +GCCP   A CC D IHCCP    CN+  G+CD  + ++    ++ + PI  + +             C + + C    TCC + +  ++CCP P AVCC D  HCCP+   C +   SC+ +
Sbjct:  306 TKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGSVSWVEKVPVRPIRKQKVAVTQVSSVSSDVPCNDTAACADGTTCCKTKEGDWACCPLPEAVCCEDFVHCCPKGKKCNIAAMKCEDPLCTEEPLVKQTPVQSTTTPNVIGTQKSDVPCND-TAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGSVPWVEKVPVRPIRKQKVAVTTV--SPVSSDIACNDTVACPDGSTCCKDKDGE-WGCCPLPEAVCCEDFIHCCPHGKKCNVAAGSCDDPSGSVPWMDKVPVRPIKKQKVAVTQASSASSDVPCNDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDS 694          

HSP 4 Score: 205.297 bits (521), Expect = 1.458e-57
Identity = 135/395 (34.18%), Postives = 189/395 (47.85%), Query Frame = 2
Query:  254 TTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVL---KEVVTKIKLK------VPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEV----------VTKMKLKIPAISNLS--IECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKT-FQPNPVNRVICPDAK-----------YQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCD-----------------HQAEALEIKISPILV-----ESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCD 1273
            T +G ++CCP   AVCC D  HCCP+  +CN+    C+  L   + +V +  ++      V  +    V C D + C DGS+CC   DG +ACCP   AVCC D  HCCP    C+++AG+C+     V          + K K+ +  +S +S  I C D +  C  G+TCC   DG +GCCP   AVCC D + CCP    CN+ AG+CD  +     + K   +P    +V    A              C DG TCCK   G  + CCP   A CC D IHCCP    C++  G+C+                  + +    K+SP+       +++ CP+GS      TCC   +  + CCP P AVCC D  HCCP+   C++   SCD
Sbjct:  394 TKEGDWACCPLPEAVCCEDFVHCCPKGKKCNIAAMKCEDPLCTEEPLVKQTPVQSTTTPNVIGTQKSDVPCNDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGSVPWVEKVPVRPIRKQKVAVTTVSPVSSDIACND-TVACPDGSTCCKDKDGEWGCCPLPEAVCCEDFIHCCPHGKKCNVAAGSCDDPSGSVPWMDKVPVRPIKKQKVAVTQASSASSDVPCNDTAACPDGSTCCKTKDG-GWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDSSGSVPWVEKVPVRPIRKQKVANTKVSPVSSDVACNDTVACPDGS------TCCKDKDGDWGCCPLPEAVCCEDFIHCCPHGKKCNVAAGSCD 780          

HSP 5 Score: 194.512 bits (493), Expect = 9.255e-54
Identity = 132/367 (35.97%), Postives = 188/367 (51.23%), Query Frame = 2
Query:  254 TTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDS-------VLKEVVTKIKLKVPASSILS-----VVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEV--VTKMKLKIPAISNLS--IECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTC---DSKTKKPSLLIKTFQPNP---VNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKISP------------ILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCS 1252
            T DG ++CCP   AVCC D  HCCP   +C++  G+C+        V K  V  I+ +  A++ +S     V C D   C DGS+CC   DG++ CCP   AVCC D  HCCP    CN++AG+CD     V  V K+ + + A    S  ++C + +  C   +TCC    G +GCCPFS AVCC+D   CCP +  CNL + +C   D      + +     P P   +  V C D +  CS   TCC L + D  GCCP+  A CC D+ HCCP+   C++ + +C  +   L ++I+             ++V+ ++C  G  C    TCC ++  ++ CCP P AVCC D  HCCP    C 
Sbjct:  655 TKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDSSGSVPWVEKVPVRPIRKQKVANTKVSPVSSDVACNDTVACPDGSTCCKDKDGDWGCCPLPEAVCCEDFIHCCPHGKKCNVAAGSCDDPSGSVPWVEKVPVHLRAGQRPSGKVKC-NATHGCPESSTCCKNIAGEWGCCPFSQAVCCTDGEHCCPAHYKCNLSSVSCIKGDVVIPWYNKIAAESTPAPKLDLGVVKC-DEQSSCSADSTCCLL-SKDETGCCPFPEAVCCPDQKHCCPEGYRCDLRRRSC-VKTTRLYVEITQLTHIRSNKPQPSVVVKDVQCGGGFSCHDGETCCLTSQTTWGCCPSPKAVCCDDMQHCCPAGYKCG 1017          

HSP 6 Score: 192.971 bits (489), Expect = 2.921e-53
Identity = 134/418 (32.06%), Postives = 186/418 (44.50%), Query Frame = 2
Query:  260 DGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDS--------------VLKEVVTKIKLKVPASSILS-----------------------------VVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEV----------VTKMKLKIPAISNLSIECP-DGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIK------TFQPNPVNR----VICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEAL----EIKISPILVE------------SIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCD 1273
            DG + CCP   AVCC DK HCCP++T C++    C S               L+      K K P +   +                             V C D + C DGS+CC   DG +ACCP   AVCC D  HCCP    C+++AG+C+     V          + K K+ +  +S++S + P + ++ C  G TCC   +G + CCP   AVCC D + CCP+   CN+ A  C+        L+K      T  PN +      V C D    C DG TCCK   G  + CCP   A CC D IHCCP    C++  G+C+  + ++    ++ + PI  +             I C +   C    TCC   +  + CCP P AVCC D  HCCP+   C++   SCD
Sbjct:  189 DGQWGCCPMPKAVCCDDKIHCCPEDTVCDVKALKCVSSTNQELPMWDKFPARLRAEWEDHKQKRPETQRTTARPTGTTSTTTAANQMTTLPAEHQGVSSDVACNDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGSVSWVEKVPVRPIRKQKVAVTQVSSVSSDVPCNDTAACADGTTCCKTKEGDWACCPLPEAVCCEDFVHCCPKGKKCNIAAMKCEDPLCTEEPLVKQTPVQSTTTPNVIGTQKSDVPCNDT-AACPDGSTCCKTKDG-GWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGSVPWVEKVPVRPIRKQKVAVTTVSPVSSDIACNDTVACPDGSTCCKDKDGEWGCCPLPEAVCCEDFIHCCPHGKKCNVAAGSCD 604          

HSP 7 Score: 182.956 bits (463), Expect = 7.969e-50
Identity = 125/424 (29.48%), Postives = 188/424 (44.34%), Query Frame = 2
Query:  263 GSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSV-----LKEVVTKIKLKVPASSIL---------SVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTC-----------------------DSKTKKPSLLIKTFQP-------NPVNRVICPDAKYQ-------------CSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEAL----EIKISPILVESIK------------CPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIINFHP 1315
            G +SCCP+    CC D  HCCP+   C++   TC +      L +     K  +P S  +          + CPD S C    SC +M+  ++ CCP +  + CSD +HCCP +  C+  +  C         K K+K+      ++ C +G+S C    TCC   DG +GCCP   AVCC DK+ CCP++TVC++ A  C                       D K K+P     T +P          N++    A++Q             C DG TCCK   G  + CCP   A CC D IHCCP    C++  G+C+  + ++    ++ + PI  + +             C + + C    TCC +    ++CCP P AVCC D  HCCP    C++    C+  +  + P++   P
Sbjct:   37 GGFSCCPFHHGECCEDHLHCCPEGMLCSVKDLTCTNATHTQPLADRTLAKKPDLPKSFRMIFSMPASESDITCPDGSSCPAEFSCLLMST-SYGCCPVAQGLACSDGKHCCPNDHECSTDSSLC--------VKRKVKV-----QTVLCGNGTSECPADTTCCQADDGQWGCCPMPKAVCCDDKIHCCPEDTVCDVKALKCVSSTNQELPMWDKFPARLRAEWEDHKQKRPETQRTTARPTGTTSTTTAANQMTTLPAEHQGVSSDVACNDTAACPDGSTCCKTKDG-GWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGSVSWVEKVPVRPIRKQKVAVTQVSSVSSDVPCNDTAACADGTTCCKTKEGDWACCPLPEAVCCEDFVHCCPKGKKCNIAAMKCEDPLCTEEPLVKQTP 445          

HSP 8 Score: 140.969 bits (354), Expect = 1.676e-35
Identity = 107/358 (29.89%), Postives = 155/358 (43.30%), Query Frame = 2
Query:  395 IKLKVPASSILSVVC---PDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTC----------DSKLKEVVT-----KMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC-----------------------DHQAEALEIKISPI------------------------LVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCD 1273
            ++L V  + +  V+C   P+   C+ G SCC    G F+CCP+    CC D  HCCP+  +C++   TC          D  L +        +M   +PA S   I CPDGSS C    +C L+S  SYGCCP +  + CSD   CCP +  C+  +  C  +  K            V  V+C +   +C    TCC+   G  +GCCP   A CC DKIHCCP++TVC++    C                       DH+ +  E + +                          +   + C + + C    TCC + +  ++CCP P AVCC D  HCCP+   C +   SC+
Sbjct:    2 LRLTVCLAVVTLVICSQCPNNEVCEAGQSCCQDPTGGFSCCPFHHGECCEDHLHCCPEGMLCSVKDLTCTNATHTQPLADRTLAKKPDLPKSFRMIFSMPA-SESDITCPDGSS-CPAEFSCLLMST-SYGCCPVAQGLACSDGKHCCPNDHECSTDSSLCVKRKVK------------VQTVLCGNGTSECPADTTCCQADDG-QWGCCPMPKAVCCDDKIHCCPEDTVCDVKALKCVSSTNQELPMWDKFPARLRAEWEDHKQKRPETQRTTARPTGTTSTTTAANQMTTLPAEHQGVSSDVACNDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCE 343          

HSP 9 Score: 67.0106 bits (162), Expect = 2.788e-11
Identity = 60/229 (26.20%), Postives = 85/229 (37.12%), Query Frame = 2
Query:  782 CPQNTVCNL-------PAG-------------------------------TCDSKTKKPSLLIKTFQPNP--------VNRVICPDAKYQCSDGQTCCK----LPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKISPILVESIKCPNG-SLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIINFHP 1315
            CP N VC         P G                               TC + T    L  +T    P        +  +   ++   C DG +C      L    SYGCCP +    CSD  HCCP +  C+ +   C  +          + V+++ C NG S C    TCC + +  + CCP P AVCC D  HCCP +T C +    C  +   + P+ +  P
Sbjct:   19 CPNNEVCEAGQSCCQDPTGGFSCCPFHHGECCEDHLHCCPEGMLCSVKDLTCTNATHTQPLADRTLAKKPDLPKSFRMIFSMPASESDITCPDGSSCPAEFSCLLMSTSYGCCPVAQGLACSDGKHCCPNDHECSTDSSLCVKRK---------VKVQTVLCGNGTSECPADTTCCQADDGQWGCCPMPKAVCCDDKIHCCPEDTVCDVKALKCVSSTNQELPMWDKFP 238          
BLAST of Granulin precursor vs. Ensembl Zebrafish
Match: grna (granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434])

HSP 1 Score: 217.238 bits (552), Expect = 3.213e-62
Identity = 138/387 (35.66%), Postives = 196/387 (50.65%), Query Frame = 2
Query:  254 TTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVL---KEVVTKIKLK------VPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEV----------VTKMKLKIPAISNLSIECP-DGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKT------KKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC--------DHQAEALEIKISPIL-VESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIINF 1309
            T +G ++CCP   AVCC D  HCCP+  +CN+    C+  L   + +V +  ++      V  +    V C D + C DGS+CC   DG +ACCP   AVCC D  HCCP    C+++AG+C+     V          + K K+ +   S+ S + P + ++ C  G+TCC   DG + CCP   AVCC D + CCP    CN+ AG+CD  +      +K  + ++  Q  P  +V C +A + C +  TCCK   G+ +GCCP+S A CC+D  HCCP +  CN++  +C         +   A E   +P L +  +KC   S C    TCC  + D   CCP+P AVCC D  HCCP    C L  +SC K   L   I   
Sbjct:  394 TKEGDWACCPLPEAVCCEDFVHCCPKGKKCNIAAMKCEDPLCTEEPLVKQTPVQSTTTPNVIGTQKSDVPCNDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGSVPWVEKVPVRPIRKQKVAVTTASSASSDVPCNDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCNVAAGSCDDPSGSVPWVEKVPVHLRAGQ-RPSGKVKC-NATHGCPESSTCCKNIAGE-WGCCPFSQAVCCTDGEHCCPAHYKCNLSSVSCIKGDVVIPWYNKIAAESTPAPKLDLGVVKCDEQSSCSADSTCCLLSKDETGCCPFPEAVCCPDQKHCCPEGYRCDLRRRSCVKTTRLYVEITQL 777          

HSP 2 Score: 204.142 bits (518), Expect = 1.712e-57
Identity = 133/392 (33.93%), Postives = 201/392 (51.28%), Query Frame = 2
Query:  254 TTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCD------SVLKEV----VTKIKLKVPASSILS--VVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKL---KEVVTKMKLKIPAISNL------SIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKT-FQPNPVNRVICPDAK-----------YQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEAL-EIKISPILVESIKCPNGSL-------CGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIIN 1306
            T DG ++CCP   AVCC D  HCCP   +C++  G+C+      S +++V    + K K+ V   S +S  V C D + C DG++CC   +G++ACCP   AVCC D  HCCP+   CN++A  C+  L   + +V +  ++     N+       + C D ++ C  G+TCC   DG + CCP   AVCC D + CCP    C++ AG+C+  +     + K   +P    +V    A              C DG TCCK   G  + CCP   A CC D IHCCP    CN+  G+CD  + ++  ++  P+ + + + P+G +       C +  TCC +    + CCP+  AVCC+D  HCCP +  C+L++ SC K  ++  P  N
Sbjct:  306 TKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGSVSWVEKVPVRPIRKQKVAVTQVSSVSSDVPCNDTAACADGTTCCKTKEGDWACCPLPEAVCCEDFVHCCPKGKKCNIAAMKCEDPLCTEEPLVKQTPVQSTTTPNVIGTQKSDVPCND-TAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGSVPWVEKVPVRPIRKQKVAVTTASSASSDVPCNDTAACPDGSTCCKTKDG-GWACCPLPEAVCCEDFIHCCPHGKKCNVAAGSCDDPSGSVPWVEKVPVHLRAGQRPSGKVKCNATHGCPESSTCCKNIAGEWGCCPFSQAVCCTDGEHCCPAHYKCNLSSVSCIKGDVV-IPWYN 694          

HSP 3 Score: 196.438 bits (498), Expect = 9.288e-55
Identity = 133/367 (36.24%), Postives = 187/367 (50.95%), Query Frame = 2
Query:  254 TTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEV----------VTKIKLKVPASSILS--VVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEV--VTKMKLKIPAISNLS--IECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTC---DSKTKKPSLLIKTFQPNP---VNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKISP------------ILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCS 1252
            T DG ++CCP   AVCC D  HCCP   +C++  G+C+     V          + K K+ V  +S  S  V C D + C DGS+CC   DG +ACCP   AVCC D  HCCP    CN++AG+CD     V  V K+ + + A    S  ++C + +  C   +TCC    G +GCCPFS AVCC+D   CCP +  CNL + +C   D      + +     P P   +  V C D +  CS   TCC L + D  GCCP+  A CC D+ HCCP+   C++ + +C  +   L ++I+             ++V+ ++C  G  C    TCC ++  ++ CCP P AVCC D  HCCP    C 
Sbjct:  479 TKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGSVPWVEKVPVRPIRKQKVAVTTASSASSDVPCNDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCNVAAGSCDDPSGSVPWVEKVPVHLRAGQRPSGKVKC-NATHGCPESSTCCKNIAGEWGCCPFSQAVCCTDGEHCCPAHYKCNLSSVSCIKGDVVIPWYNKIAAESTPAPKLDLGVVKC-DEQSSCSADSTCCLL-SKDETGCCPFPEAVCCPDQKHCCPEGYRCDLRRRSC-VKTTRLYVEITQLTHIRSNKPQPSVVVKDVQCGGGFSCHDGETCCLTSQTTWGCCPSPKAVCCDDMQHCCPAGYKCG 841          

HSP 4 Score: 194.512 bits (493), Expect = 5.183e-54
Identity = 133/418 (31.82%), Postives = 189/418 (45.22%), Query Frame = 2
Query:  260 DGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDS--------------VLKEVVTKIKLKVPASSILS-----------------------------VVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEV----------VTKMKLKIPAISNLSIECP-DGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIK------TFQPNPVNR----VICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEAL----EIKISPILVESIK------------CPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCD 1273
            DG + CCP   AVCC DK HCCP++T C++    C S               L+      K K P +   +                             V C D + C DGS+CC   DG +ACCP   AVCC D  HCCP    C+++AG+C+     V          + K K+ +  +S++S + P + ++ C  G TCC   +G + CCP   AVCC D + CCP+   CN+ A  C+        L+K      T  PN +      V C D    C DG TCCK   G  + CCP   A CC D IHCCP    C++  G+C+  + ++    ++ + PI  + +             C + + C    TCC + +  ++CCP P AVCC D  HCCP+   C++   SCD
Sbjct:  189 DGQWGCCPMPKAVCCDDKIHCCPEDTVCDVKALKCVSSTNQELPMWDKFPARLRAEWEDHKQKRPETQRTTARPTGTTSTTTAANQMTTLPAEHQGVSSDVACNDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGSVSWVEKVPVRPIRKQKVAVTQVSSVSSDVPCNDTAACADGTTCCKTKEGDWACCPLPEAVCCEDFVHCCPKGKKCNIAAMKCEDPLCTEEPLVKQTPVQSTTTPNVIGTQKSDVPCNDT-AACPDGSTCCKTKDG-GWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGSVPWVEKVPVRPIRKQKVAVTTASSASSDVPCNDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCNVAAGSCD 604          

HSP 5 Score: 182.956 bits (463), Expect = 5.464e-50
Identity = 125/424 (29.48%), Postives = 188/424 (44.34%), Query Frame = 2
Query:  263 GSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSV-----LKEVVTKIKLKVPASSIL---------SVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTC-----------------------DSKTKKPSLLIKTFQP-------NPVNRVICPDAKYQ-------------CSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEAL----EIKISPILVESIK------------CPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIINFHP 1315
            G +SCCP+    CC D  HCCP+   C++   TC +      L +     K  +P S  +          + CPD S C    SC +M+  ++ CCP +  + CSD +HCCP +  C+  +  C         K K+K+      ++ C +G+S C    TCC   DG +GCCP   AVCC DK+ CCP++TVC++ A  C                       D K K+P     T +P          N++    A++Q             C DG TCCK   G  + CCP   A CC D IHCCP    C++  G+C+  + ++    ++ + PI  + +             C + + C    TCC +    ++CCP P AVCC D  HCCP    C++    C+  +  + P++   P
Sbjct:   37 GGFSCCPFHHGECCEDHLHCCPEGMLCSVKDLTCTNATHTQPLADRTLAKKPDLPKSFRMIFSMPASESDITCPDGSSCPAEFSCLLMST-SYGCCPVAQGLACSDGKHCCPNDHECSTDSSLC--------VKRKVKV-----QTVLCGNGTSECPADTTCCQADDGQWGCCPMPKAVCCDDKIHCCPEDTVCDVKALKCVSSTNQELPMWDKFPARLRAEWEDHKQKRPETQRTTARPTGTTSTTTAANQMTTLPAEHQGVSSDVACNDTAACPDGSTCCKTKDG-GWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGSVSWVEKVPVRPIRKQKVAVTQVSSVSSDVPCNDTAACADGTTCCKTKEGDWACCPLPEAVCCEDFVHCCPKGKKCNIAAMKCEDPLCTEEPLVKQTP 445          

HSP 6 Score: 141.354 bits (355), Expect = 1.177e-35
Identity = 107/358 (29.89%), Postives = 155/358 (43.30%), Query Frame = 2
Query:  395 IKLKVPASSILSVVC---PDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTC----------DSKLKEVVT-----KMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC-----------------------DHQAEALEIKISPI------------------------LVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCD 1273
            ++L V  + +  V+C   P+   C+ G SCC    G F+CCP+    CC D  HCCP+  +C++   TC          D  L +        +M   +PA S   I CPDGSS C    +C L+S  SYGCCP +  + CSD   CCP +  C+  +  C  +  K            V  V+C +   +C    TCC+   G  +GCCP   A CC DKIHCCP++TVC++    C                       DH+ +  E + +                          +   + C + + C    TCC + +  ++CCP P AVCC D  HCCP+   C +   SC+
Sbjct:    2 LRLTVCLAVVTLVICSQCPNNEVCEAGQSCCQDPTGGFSCCPFHHGECCEDHLHCCPEGMLCSVKDLTCTNATHTQPLADRTLAKKPDLPKSFRMIFSMPA-SESDITCPDGSS-CPAEFSCLLMST-SYGCCPVAQGLACSDGKHCCPNDHECSTDSSLCVKRKVK------------VQTVLCGNGTSECPADTTCCQADDG-QWGCCPMPKAVCCDDKIHCCPEDTVCDVKALKCVSSTNQELPMWDKFPARLRAEWEDHKQKRPETQRTTARPTGTTSTTTAANQMTTLPAEHQGVSSDVACNDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCE 343          

HSP 7 Score: 66.6254 bits (161), Expect = 2.735e-11
Identity = 60/229 (26.20%), Postives = 85/229 (37.12%), Query Frame = 2
Query:  782 CPQNTVCNL-------PAG-------------------------------TCDSKTKKPSLLIKTFQPNP--------VNRVICPDAKYQCSDGQTCCK----LPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKISPILVESIKCPNG-SLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIINFHP 1315
            CP N VC         P G                               TC + T    L  +T    P        +  +   ++   C DG +C      L    SYGCCP +    CSD  HCCP +  C+ +   C  +          + V+++ C NG S C    TCC + +  + CCP P AVCC D  HCCP +T C +    C  +   + P+ +  P
Sbjct:   19 CPNNEVCEAGQSCCQDPTGGFSCCPFHHGECCEDHLHCCPEGMLCSVKDLTCTNATHTQPLADRTLAKKPDLPKSFRMIFSMPASESDITCPDGSSCPAEFSCLLMSTSYGCCPVAQGLACSDGKHCCPNDHECSTDSSLCVKRK---------VKVQTVLCGNGTSECPADTTCCQADDGQWGCCPMPKAVCCDDKIHCCPEDTVCDVKALKCVSSTNQELPMWDKFP 238          
BLAST of Granulin precursor vs. Ensembl Zebrafish
Match: grna (granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434])

HSP 1 Score: 217.238 bits (552), Expect = 3.516e-62
Identity = 141/388 (36.34%), Postives = 197/388 (50.77%), Query Frame = 2
Query:  254 TTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVL---KEVVTKIKLK------VPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEV----------VTKMKLKIPAISNLS--IECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKT------KKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC--------DHQAEALEIKISPIL-VESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIINF 1309
            T +G ++CCP   AVCC D  HCCP+  +CN+    C+  L   + +V +  ++      V  +    V C D + C DGS+CC   DG +ACCP   AVCC D  HCCP    C+++AG+C+     V          + K K+ +  +S +S  I C D +  C  G+TCC   DG +GCCP   AVCC D + CCP    CN+ AG+CD  +      +K  + ++  Q  P  +V C +A + C +  TCCK   G+ +GCCP+S A CC+D  HCCP +  CN++  +C         +   A E   +P L +  +KC   S C    TCC  + D   CCP+P AVCC D  HCCP    C L  +SC K   L   I   
Sbjct:  394 TKEGDWACCPLPEAVCCEDFVHCCPKGKKCNIAAMKCEDPLCTEEPLVKQTPVQSTTTPNVIGTQKSDVPCNDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGSVPWVEKVPVRPIRKQKVAVTTVSPVSSDIACND-TVACPDGSTCCKDKDGEWGCCPLPEAVCCEDFIHCCPHGKKCNVAAGSCDDPSGSVPWVEKVPVHLRAGQ-RPSGKVKC-NATHGCPESSTCCKNIAGE-WGCCPFSQAVCCTDGEHCCPAHYKCNLSSVSCIKGDVVIPWYNKIAAESTPAPKLDLGVVKCDEQSSCSADSTCCLLSKDETGCCPFPEAVCCPDQKHCCPEGYRCDLRRRSCVKTTRLYVEITQL 777          

HSP 2 Score: 209.149 bits (531), Expect = 2.573e-59
Identity = 135/394 (34.26%), Postives = 207/394 (52.54%), Query Frame = 2
Query:  254 TTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCD------SVLKEV----VTKIKLKVPASSILS--VVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKL---KEVVTKMKLKIPAISNL------SIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKT--------------KKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEAL-EIKISPILVESIKCPNGSL-------CGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIIN 1306
            T DG ++CCP   AVCC D  HCCP   +C++  G+C+      S +++V    + K K+ V   S +S  V C D + C DG++CC   +G++ACCP   AVCC D  HCCP+   CN++A  C+  L   + +V +  ++     N+       + C D ++ C  G+TCC   DG + CCP   AVCC D + CCP    C++ AG+C+  +              +K  + + T   +PV+  I  +    C DG TCCK   G+ +GCCP   A CC D IHCCP    CN+  G+CD  + ++  ++  P+ + + + P+G +       C +  TCC +    + CCP+  AVCC+D  HCCP +  C+L++ SC K  ++  P  N
Sbjct:  306 TKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGSVSWVEKVPVRPIRKQKVAVTQVSSVSSDVPCNDTAACADGTTCCKTKEGDWACCPLPEAVCCEDFVHCCPKGKKCNIAAMKCEDPLCTEEPLVKQTPVQSTTTPNVIGTQKSDVPCND-TAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGSVPWVEKVPVRPIRKQKVAVTTV--SPVSSDIACNDTVACPDGSTCCKDKDGE-WGCCPLPEAVCCEDFIHCCPHGKKCNVAAGSCDDPSGSVPWVEKVPVHLRAGQRPSGKVKCNATHGCPESSTCCKNIAGEWGCCPFSQAVCCTDGEHCCPAHYKCNLSSVSCIKGDVV-IPWYN 694          

HSP 3 Score: 193.741 bits (491), Expect = 1.010e-53
Identity = 131/367 (35.69%), Postives = 186/367 (50.68%), Query Frame = 2
Query:  254 TTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDS-------VLKEVVTKIKLKVPASSILS-----VVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEV--VTKMKLKIPAISNLS--IECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTC---DSKTKKPSLLIKTFQPNP---VNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKISP------------ILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCS 1252
            T DG ++CCP   AVCC D  HCCP   +C++  G+C+        V K  V  I+ +  A + +S     + C D   C DGS+CC   DG + CCP   AVCC D  HCCP    CN++AG+CD     V  V K+ + + A    S  ++C + +  C   +TCC    G +GCCPFS AVCC+D   CCP +  CNL + +C   D      + +     P P   +  V C D +  CS   TCC L + D  GCCP+  A CC D+ HCCP+   C++ + +C  +   L ++I+             ++V+ ++C  G  C    TCC ++  ++ CCP P AVCC D  HCCP    C 
Sbjct:  479 TKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGSVPWVEKVPVRPIRKQKVAVTTVSPVSSDIACNDTVACPDGSTCCKDKDGEWGCCPLPEAVCCEDFIHCCPHGKKCNVAAGSCDDPSGSVPWVEKVPVHLRAGQRPSGKVKC-NATHGCPESSTCCKNIAGEWGCCPFSQAVCCTDGEHCCPAHYKCNLSSVSCIKGDVVIPWYNKIAAESTPAPKLDLGVVKC-DEQSSCSADSTCCLL-SKDETGCCPFPEAVCCPDQKHCCPEGYRCDLRRRSC-VKTTRLYVEITQLTHIRSNKPQPSVVVKDVQCGGGFSCHDGETCCLTSQTTWGCCPSPKAVCCDDMQHCCPAGYKCG 841          

HSP 4 Score: 192.971 bits (489), Expect = 1.601e-53
Identity = 134/418 (32.06%), Postives = 186/418 (44.50%), Query Frame = 2
Query:  260 DGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDS--------------VLKEVVTKIKLKVPASSILS-----------------------------VVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEV----------VTKMKLKIPAISNLSIECP-DGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIK------TFQPNPVNR----VICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEAL----EIKISPILVE------------SIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCD 1273
            DG + CCP   AVCC DK HCCP++T C++    C S               L+      K K P +   +                             V C D + C DGS+CC   DG +ACCP   AVCC D  HCCP    C+++AG+C+     V          + K K+ +  +S++S + P + ++ C  G TCC   +G + CCP   AVCC D + CCP+   CN+ A  C+        L+K      T  PN +      V C D    C DG TCCK   G  + CCP   A CC D IHCCP    C++  G+C+  + ++    ++ + PI  +             I C +   C    TCC   +  + CCP P AVCC D  HCCP+   C++   SCD
Sbjct:  189 DGQWGCCPMPKAVCCDDKIHCCPEDTVCDVKALKCVSSTNQELPMWDKFPARLRAEWEDHKQKRPETQRTTARPTGTTSTTTAANQMTTLPAEHQGVSSDVACNDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGSVSWVEKVPVRPIRKQKVAVTQVSSVSSDVPCNDTAACADGTTCCKTKEGDWACCPLPEAVCCEDFVHCCPKGKKCNIAAMKCEDPLCTEEPLVKQTPVQSTTTPNVIGTQKSDVPCNDT-AACPDGSTCCKTKDG-GWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGSVPWVEKVPVRPIRKQKVAVTTVSPVSSDIACNDTVACPDGSTCCKDKDGEWGCCPLPEAVCCEDFIHCCPHGKKCNVAAGSCD 604          

HSP 5 Score: 182.956 bits (463), Expect = 5.105e-50
Identity = 125/424 (29.48%), Postives = 188/424 (44.34%), Query Frame = 2
Query:  263 GSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSV-----LKEVVTKIKLKVPASSIL---------SVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTC-----------------------DSKTKKPSLLIKTFQP-------NPVNRVICPDAKYQ-------------CSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEAL----EIKISPILVESIK------------CPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIINFHP 1315
            G +SCCP+    CC D  HCCP+   C++   TC +      L +     K  +P S  +          + CPD S C    SC +M+  ++ CCP +  + CSD +HCCP +  C+  +  C         K K+K+      ++ C +G+S C    TCC   DG +GCCP   AVCC DK+ CCP++TVC++ A  C                       D K K+P     T +P          N++    A++Q             C DG TCCK   G  + CCP   A CC D IHCCP    C++  G+C+  + ++    ++ + PI  + +             C + + C    TCC +    ++CCP P AVCC D  HCCP    C++    C+  +  + P++   P
Sbjct:   37 GGFSCCPFHHGECCEDHLHCCPEGMLCSVKDLTCTNATHTQPLADRTLAKKPDLPKSFRMIFSMPASESDITCPDGSSCPAEFSCLLMST-SYGCCPVAQGLACSDGKHCCPNDHECSTDSSLC--------VKRKVKV-----QTVLCGNGTSECPADTTCCQADDGQWGCCPMPKAVCCDDKIHCCPEDTVCDVKALKCVSSTNQELPMWDKFPARLRAEWEDHKQKRPETQRTTARPTGTTSTTTAANQMTTLPAEHQGVSSDVACNDTAACPDGSTCCKTKDG-GWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGSVSWVEKVPVRPIRKQKVAVTQVSSVSSDVPCNDTAACADGTTCCKTKEGDWACCPLPEAVCCEDFVHCCPKGKKCNIAAMKCEDPLCTEEPLVKQTP 445          

HSP 6 Score: 141.354 bits (355), Expect = 1.082e-35
Identity = 107/358 (29.89%), Postives = 155/358 (43.30%), Query Frame = 2
Query:  395 IKLKVPASSILSVVC---PDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTC----------DSKLKEVVT-----KMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC-----------------------DHQAEALEIKISPI------------------------LVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCD 1273
            ++L V  + +  V+C   P+   C+ G SCC    G F+CCP+    CC D  HCCP+  +C++   TC          D  L +        +M   +PA S   I CPDGSS C    +C L+S  SYGCCP +  + CSD   CCP +  C+  +  C  +  K            V  V+C +   +C    TCC+   G  +GCCP   A CC DKIHCCP++TVC++    C                       DH+ +  E + +                          +   + C + + C    TCC + +  ++CCP P AVCC D  HCCP+   C +   SC+
Sbjct:    2 LRLTVCLAVVTLVICSQCPNNEVCEAGQSCCQDPTGGFSCCPFHHGECCEDHLHCCPEGMLCSVKDLTCTNATHTQPLADRTLAKKPDLPKSFRMIFSMPA-SESDITCPDGSS-CPAEFSCLLMST-SYGCCPVAQGLACSDGKHCCPNDHECSTDSSLCVKRKVK------------VQTVLCGNGTSECPADTTCCQADDG-QWGCCPMPKAVCCDDKIHCCPEDTVCDVKALKCVSSTNQELPMWDKFPARLRAEWEDHKQKRPETQRTTARPTGTTSTTTAANQMTTLPAEHQGVSSDVACNDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCE 343          

HSP 7 Score: 67.0106 bits (162), Expect = 2.664e-11
Identity = 60/229 (26.20%), Postives = 85/229 (37.12%), Query Frame = 2
Query:  782 CPQNTVCNL-------PAG-------------------------------TCDSKTKKPSLLIKTFQPNP--------VNRVICPDAKYQCSDGQTCCK----LPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKISPILVESIKCPNG-SLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIINFHP 1315
            CP N VC         P G                               TC + T    L  +T    P        +  +   ++   C DG +C      L    SYGCCP +    CSD  HCCP +  C+ +   C  +          + V+++ C NG S C    TCC + +  + CCP P AVCC D  HCCP +T C +    C  +   + P+ +  P
Sbjct:   19 CPNNEVCEAGQSCCQDPTGGFSCCPFHHGECCEDHLHCCPEGMLCSVKDLTCTNATHTQPLADRTLAKKPDLPKSFRMIFSMPASESDITCPDGSSCPAEFSCLLMSTSYGCCPVAQGLACSDGKHCCPNDHECSTDSSLCVKRK---------VKVQTVLCGNGTSECPADTTCCQADDGQWGCCPMPKAVCCDDKIHCCPEDTVCDVKALKCVSSTNQELPMWDKFP 238          
BLAST of Granulin precursor vs. Ensembl Zebrafish
Match: grna (granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434])

HSP 1 Score: 138.272 bits (347), Expect = 2.724e-37
Identity = 80/211 (37.91%), Postives = 112/211 (53.08%), Query Frame = 2
Query:  254 TTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVL---KEVVTKIKLK------VPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEV----------VTKMKLKIPAISNLSIECP-DGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCD 826
            T +G ++CCP   AVCC D  HCCP+  +CN+    C+  L   + +V +  ++      V  +    V C D + C DGS+CC   DG +ACCP   AVCC D  HCCP    CN++AG+CD     V          + K K+ +   S+ S + P + ++ C  G+TCC   DG + CCP   AVCC D + CCP    CN+ AG+CD
Sbjct:   60 TKEGDWACCPLPEAVCCEDFVHCCPKGKKCNIAAMKCEDPLCTEEPLVKQTPVQSTTTPNVIGTQKSDVPCNDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCNVAAGSCDDPSGSVPWMDKVPVRPIKKQKVAVTQASSASSDVPCNDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCNVAAGSCD 270          

HSP 2 Score: 137.887 bits (346), Expect = 4.425e-37
Identity = 89/253 (35.18%), Postives = 126/253 (49.80%), Query Frame = 2
Query:  386 VTKIKLKVPASSILS--VVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKL---KEVVTKMKLKIPAISNL------SIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKT-FQPNPVNRVICPDAK-----------YQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEAL 1075
            + K K+ V   S +S  V C D + C DG++CC   +G++ACCP   AVCC D  HCCP+   CN++A  C+  L   + +V +  ++     N+       + C D ++ C  G+TCC   DG + CCP   AVCC D + CCP    CN+ AG+CD  +     + K   +P    +V    A              C DG TCCK   G  + CCP   A CC D IHCCP    CN+  G+CD  + ++
Sbjct:   26 IRKQKVAVTQVSSVSSDVPCNDTAACADGTTCCKTKEGDWACCPLPEAVCCEDFVHCCPKGKKCNIAAMKCEDPLCTEEPLVKQTPVQSTTTPNVIGTQKSDVPCND-TAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCNVAAGSCDDPSGSVPWMDKVPVRPIKKQKVAVTQASSASSDVPCNDTAACPDGSTCCKTKDG-GWACCPLPEAVCCEDFIHCCPHGKKCNVAAGSCDDPSGSV 276          

HSP 3 Score: 131.724 bits (330), Expect = 9.016e-35
Identity = 87/271 (32.10%), Postives = 130/271 (47.97%), Query Frame = 2
Query:  572 NLSAGTCDSKLKEV----------VTKMKLKIPAISNLSIECP-DGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIK------TFQPNPVNR----VICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEAL----EIKISPILVESIK------------CPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCD 1273
            +++AG+C+     V          + K K+ +  +S++S + P + ++ C  G TCC   +G + CCP   AVCC D + CCP+   CN+ A  C+        L+K      T  PN +      V C D    C DG TCCK   G  + CCP   A CC D IHCCP    CN+  G+CD  + ++    ++ + PI  + +             C + + C    TCC + +  ++CCP P AVCC D  HCCP+   C++   SCD
Sbjct:    2 DVAAGSCEDPSGSVSWVEKVPVRPIRKQKVAVTQVSSVSSDVPCNDTAACADGTTCCKTKEGDWACCPLPEAVCCEDFVHCCPKGKKCNIAAMKCEDPLCTEEPLVKQTPVQSTTTPNVIGTQKSDVPCNDT-AACPDGSTCCKTKDG-GWACCPLPEAVCCEDFIHCCPHGKKCNVAAGSCDDPSGSVPWMDKVPVRPIKKQKVAVTQASSASSDVPCNDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCNVAAGSCD 270          

HSP 4 Score: 51.6026 bits (122), Expect = 6.388e-7
Identity = 22/69 (31.88%), Postives = 35/69 (50.72%), Query Frame = 2
Query: 1109 IKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIINFHP 1315
            + C + + C    TCC +    ++CCP P AVCC D  HCCP    C++    C+  +  + P++   P
Sbjct:   43 VPCNDTAACADGTTCCKTKEGDWACCPLPEAVCCEDFVHCCPKGKKCNIAAMKCEDPLCTEEPLVKQTP 111          
BLAST of Granulin precursor vs. Ensembl Xenopus
Match: trappc11 (trafficking protein particle complex 11 [Source:Xenbase;Acc:XB-GENE-5931148])

HSP 1 Score: 202.986 bits (515), Expect = 1.973e-57
Identity = 132/336 (39.29%), Postives = 168/336 (50.00%), Query Frame = 2
Query:  266 SYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKL----KVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSI-ECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKISPILVES--IKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCS 1252
            S+ CCP   AVCC D  HCCP N+EC++ +G C S    +    KL    K        V C D + C DGS+CC   D  + CC   SAVCCSD  HCCP  T C+L    C S+  E    +  ++PAI   S  + P  ++T K   TCC L  G +GCCP   AVCC+D L CCP+   C+   G C           KT       R +  D  Y C DGQTCC+L +GD +GCCP + A CC D  HCCP    C+  +      +  L  K   +  E+  +KC +   C    TCC  A+  + CCP   AVCC DH HCCP   +CS
Sbjct:  142 SWGCCPMPQAVCCDDHMHCCPHNSECDVQQGRCISNQDHIPWMSKLPARVKSEGDEERRVPCLDGTFCPDGSTCCEQVDHTYGCCSILSAVCCSDHLHCCPGGTTCDLVHKKCVSQTGE--GPLLPQMPAIREESANQVPCDATTKK--ETCCRLVSGKWGCCPVVKAVCCNDHLHCCPEGYTCS--QGECSKMEHSIPWFTKTPALTHEARDVECDDMYSCPDGQTCCRLASGD-WGCCPIAQAVCCDDHEHCCPPGYTCSGGQCQKGEHSIPLFSKTPALRQETKYVKCDDTHSCADGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCS 470          

HSP 2 Score: 184.496 bits (467), Expect = 9.085e-51
Identity = 132/362 (36.46%), Postives = 176/362 (48.62%), Query Frame = 2
Query:  260 DGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPDQSQCD---DGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLS--IECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKISPIL---VESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNI----LLKFPIINF 1309
            D +Y CC   SAVCCSD  HCCP  T C+L    C S   E    +  ++PA    S    +Q  CD      +CC +  G + CCP   AVCC+D  HCCP+   C  S G C SK++  +     K PA+++ +  +EC D  S C  G TCC L+ G +GCCP + AVCC D   CCP    C+   G C        L  KT       + +  D  + C+DGQTCC+L +GD +GCCP + A CC D  HCCP    C+ ++      +     K +P L    + ++C +   C    TCC  A+  + CCP   AVCCSDH HCCP   +C               L K P + F
Sbjct:  220 DHTYGCCSILSAVCCSDHLHCCPGGTTCDLVHKKCVSQTGE--GPLLPQMPAIREESA---NQVPCDATTKKETCCRLVSGKWGCCPVVKAVCCNDHLHCCPEGYTC--SQGEC-SKMEHSIPWFT-KTPALTHEARDVECDDMYS-CPDGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCS--GGQCQKGEHSIPLFSKTPALRQETKYVKCDDTHSCADGQTCCRLASGD-WGCCPIAQAVCCDDHEHCCPPGYTCSGSQCMIGEHSIPWFSK-TPALKQKAKDVQCDDMYSCADGQTCCRLASGDWGCCPIAQAVCCSDHWHCCPQGFTCDARGTCVLGQFSIPWLTKVPALPF 567          

HSP 3 Score: 181.03 bits (458), Expect = 1.699e-49
Identity = 125/345 (36.23%), Postives = 176/345 (51.01%), Query Frame = 2
Query:  254 TTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPD-QSQCDDGSSCCVMAD-GNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKL----KIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLL--IKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEAL-EIKISPIL---VESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCS 1252
            T +G  +CCP +    C D  HCC   + C+ +   C              +PAS+  +VVCPD +S+C   ++CC+M+D  ++ CCP   AVCC D  HCCP N+ C++  G C S    +    KL    K        + C DG + C  G+TCC   D +YGCC   +AVCCSD L CCP  T C+L    C S+T +  LL  +   +    N+V C DA    +  +TCC+L +G  +GCCP   A CC+D +HCCP+   C  ++G C     ++     +P L      ++C +   C    TCC  A+  + CCP   AVCC DH HCCP   +CS
Sbjct:   74 TPEGGTACCPLAEGKSCQDGHHCCSVGSYCSDDGHYC--------------IPASNQSAVVCPDGRSECPTLTTCCMMSDMSSWGCCPMPQAVCCDDHMHCCPHNSECDVQQGRCISNQDHIPWMSKLPARVKSEGDEERRVPCLDG-TFCPDGSTCCEQVDHTYGCCSILSAVCCSDHLHCCPGGTTCDLVHKKCVSQTGEGPLLPQMPAIREESANQVPC-DAT---TKKETCCRLVSG-KWGCCPVVKAVCCNDHLHCCPEGYTC--SQGECSKMEHSIPWFTKTPALTHEARDVECDDMYSCPDGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCS 396          

HSP 4 Score: 173.711 bits (439), Expect = 5.864e-47
Identity = 113/319 (35.42%), Postives = 154/319 (48.28%), Query Frame = 2
Query:  263 GSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLS--IECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAK----YQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEAL----EIKISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCP 1189
            G + CCP   AVCC+D  HCCP+   C+  +G C  +   +    K          V C D   C DG +CC +A G++ CCP + AVCC D +HCCP    C  S G C  +  E    +  K PA+   +  ++C D + +C  G TCC L+ G +GCCP + AVCC D   CCP    C+       S+       I  F   P  +    D +    Y C+DGQTCC+L +GD +GCCP + A CCSD  HCCPQ   C+  +GTC     ++    ++   P       C +   C    TCCP     + CCP
Sbjct:  295 GKWGCCPVVKAVCCNDHLHCCPEGYTCS--QGECSKMEHSIPWFTKTPALTHEARDVECDDMYSCPDGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTC--SGGQC--QKGEHSIPLFSKTPALRQETKYVKC-DDTHSCADGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCS------GSQCMIGEHSIPWFSKTPALKQKAKDVQCDDMYSCADGQTCCRLASGD-WGCCPIAQAVCCSDHWHCCPQGFTCDA-RGTCVLGQFSIPWLTKVPALPFDGTHSICDDTHTCPSGTTCCPGEGGGWRCCP 598          

HSP 5 Score: 147.132 bits (370), Expect = 1.345e-37
Identity = 113/360 (31.39%), Postives = 153/360 (42.50%), Query Frame = 2
Query:  263 GSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLS--IECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDK--IHCCPQNTVCNINKGTCDH-------QAEALEIKISPILVESIK-----CPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKF 1294
            G + CCP + AVCC D +HCCP    C+   G C      +    K          V C D   C DG +CC +A G++ CCP + AVCC D +HCCP    C+ S       + E       K PA+   +  ++C D  S C  G TCC L+ G +GCCP + AVCCSD   CCPQ   C+        +   P L      P      IC D  + C  G TCC    G  + CCP    +    +  I       V  ++   C         Q EA+E   S   V+ ++     C +   C    TCC      ++CC Y   VCC D  HCCP    C  +  SC ++   ++
Sbjct:  369 GDWGCCPIAQAVCCDDHEHCCPPGYTCS--GGQCQKGEHSIPLFSKTPALRQETKYVKCDDTHSCADGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCSGS----QCMIGEHSIPWFSKTPALKQKAKDVQCDDMYS-CADGQTCCRLASGDWGCCPIAQAVCCSDHWHCCPQGFTCDARGTCVLGQFSIPWLTKVPALPFDGTHSIC-DDTHTCPSGTTCCP-GEGGGWRCCPVEEVSKMVKRTVILLATACIVTLVSFSFCPDIIIYYALQKEAIETSPSDTSVQGLRLDYVWCDSQYACFDGQTCCRGLGGVWNCCVYTQGVCCPDMVHCCPYGYVCLNHGTSCSRSGSPRW 719          

HSP 6 Score: 146.747 bits (369), Expect = 1.740e-37
Identity = 101/276 (36.59%), Postives = 132/276 (47.83%), Query Frame = 2
Query:  449 SQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSD-GSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIK-----TFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEA--LEIKISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCS 1252
            S C D  SC    +G  ACCP +    C D  HCC   + C+     C              IPA +  ++ CPDG S C T  TCC++SD  S+GCCP   AVCC D + CCP N+ C++  G C S       + K       + +   RV C D  + C DG TCC+     +YGCC   +A CCSD +HCCP  T C++    C  Q     L  ++  I  ES          +K TCC   +  + CCP   AVCC+DH HCCP   +CS
Sbjct:   63 SGCPDEYSCVNTPEGGTACCPLAEGKSCQDGHHCCSVGSYCSDDGHYC--------------IPASNQSAVVCPDGRSECPTLTTCCMMSDMSSWGCCPMPQAVCCDDHMHCCPHNSECDVQQGRCISNQDHIPWMSKLPARVKSEGDEERRVPCLDGTF-CPDGSTCCEQ-VDHTYGCCSILSAVCCSDHLHCCPGGTTCDLVHKKCVSQTGEGPLLPQMPAIREESANQVPCDATTKKETCCRLVSGKWGCCPVVKAVCCNDHLHCCPEGYTCS 322          

HSP 7 Score: 113.235 bits (282), Expect = 3.614e-26
Identity = 90/316 (28.48%), Postives = 134/316 (42.41%), Query Frame = 2
Query:  401 LKVPASSILSVVCPDQSQCDDGSSCCVM-ADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC-DHQAEALEIKISPILVES-------IKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSC-----DKNILLKFPIIN 1306
            L +  S++ + +CPD S C + S CC +     + CCP +                              EVV++    I + ++ S  CPD  S       C    +G   CCP +    C D   CC   + C+     C   + +             + V+CPD + +C    TCC +    S+GCCP   A CC D +HCCP N+ C++ +G C  +Q     +   P  V+S       + C +G+ C    TCC   + +Y CC   +AVCCSDH HCCP  T+C L  K C     +  +L + P I 
Sbjct:    7 LLLVVSTVSATLCPDGSTCGEKSLCCELPGKKGYGCCPAA------------------------------EVVSRSLPMILSQTSCS-GCPDEYS-------CVNTPEGGTACCPLAEGKSCQDGHHCCSVGSYCSDDGHYCIPASNQ-------------SAVVCPDGRSECPTLTTCCMMSDMSSWGCCPMPQAVCCDDHMHCCPHNSECDVQQGRCISNQDHIPWMSKLPARVKSEGDEERRVPCLDGTFCPDGSTCCEQVDHTYGCCSILSAVCCSDHLHCCPGGTTCDLVHKKCVSQTGEGPLLPQMPAIR 271          
BLAST of Granulin precursor vs. Ensembl Xenopus
Match: trappc11 (trafficking protein particle complex 11 [Source:Xenbase;Acc:XB-GENE-5931148])

HSP 1 Score: 203.371 bits (516), Expect = 1.991e-57
Identity = 132/336 (39.29%), Postives = 168/336 (50.00%), Query Frame = 2
Query:  266 SYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKL----KVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSI-ECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKISPILVES--IKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCS 1252
            S+ CCP   AVCC D  HCCP N+EC++ +G C S    +    KL    K        V C D + C DGS+CC   D  + CC   SAVCCSD  HCCP  T C+L    C S+  E    +  ++PAI   S  + P  ++T K   TCC L  G +GCCP   AVCC+D L CCP+   C+   G C           KT       R +  D  Y C DGQTCC+L +GD +GCCP + A CC D  HCCP    C+  +      +  L  K   +  E+  +KC +   C    TCC  A+  + CCP   AVCC DH HCCP   +CS
Sbjct:  162 SWGCCPMPQAVCCDDHMHCCPHNSECDVQQGRCISNQDHIPWMSKLPARVKSEGDEERRVPCLDGTFCPDGSTCCEQVDHTYGCCSILSAVCCSDHLHCCPGGTTCDLVHKKCVSQTGE--GPLLPQMPAIREESANQVPCDATTKK--ETCCRLVSGKWGCCPVVKAVCCNDHLHCCPEGYTCS--QGECSKMEHSIPWFTKTPALTHEARDVECDDMYSCPDGQTCCRLASGD-WGCCPIAQAVCCDDHEHCCPPGYTCSGGQCQKGEHSIPLFSKTPALRQETKYVKCDDTHSCADGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCS 490          

HSP 2 Score: 184.882 bits (468), Expect = 9.260e-51
Identity = 132/362 (36.46%), Postives = 176/362 (48.62%), Query Frame = 2
Query:  260 DGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPDQSQCD---DGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLS--IECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKISPIL---VESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNI----LLKFPIINF 1309
            D +Y CC   SAVCCSD  HCCP  T C+L    C S   E    +  ++PA    S    +Q  CD      +CC +  G + CCP   AVCC+D  HCCP+   C  S G C SK++  +     K PA+++ +  +EC D  S C  G TCC L+ G +GCCP + AVCC D   CCP    C+   G C        L  KT       + +  D  + C+DGQTCC+L +GD +GCCP + A CC D  HCCP    C+ ++      +     K +P L    + ++C +   C    TCC  A+  + CCP   AVCCSDH HCCP   +C               L K P + F
Sbjct:  240 DHTYGCCSILSAVCCSDHLHCCPGGTTCDLVHKKCVSQTGE--GPLLPQMPAIREESA---NQVPCDATTKKETCCRLVSGKWGCCPVVKAVCCNDHLHCCPEGYTC--SQGEC-SKMEHSIPWFT-KTPALTHEARDVECDDMYS-CPDGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCS--GGQCQKGEHSIPLFSKTPALRQETKYVKCDDTHSCADGQTCCRLASGD-WGCCPIAQAVCCDDHEHCCPPGYTCSGSQCMIGEHSIPWFSK-TPALKQKAKDVQCDDMYSCADGQTCCRLASGDWGCCPIAQAVCCSDHWHCCPQGFTCDARGTCVLGQFSIPWLTKVPALPF 587          

HSP 3 Score: 181.415 bits (459), Expect = 1.522e-49
Identity = 125/345 (36.23%), Postives = 176/345 (51.01%), Query Frame = 2
Query:  254 TTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPD-QSQCDDGSSCCVMAD-GNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKL----KIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLL--IKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEAL-EIKISPIL---VESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCS 1252
            T +G  +CCP +    C D  HCC   + C+ +   C              +PAS+  +VVCPD +S+C   ++CC+M+D  ++ CCP   AVCC D  HCCP N+ C++  G C S    +    KL    K        + C DG + C  G+TCC   D +YGCC   +AVCCSD L CCP  T C+L    C S+T +  LL  +   +    N+V C DA    +  +TCC+L +G  +GCCP   A CC+D +HCCP+   C  ++G C     ++     +P L      ++C +   C    TCC  A+  + CCP   AVCC DH HCCP   +CS
Sbjct:   94 TPEGGTACCPLAEGKSCQDGHHCCSVGSYCSDDGHYC--------------IPASNQSAVVCPDGRSECPTLTTCCMMSDMSSWGCCPMPQAVCCDDHMHCCPHNSECDVQQGRCISNQDHIPWMSKLPARVKSEGDEERRVPCLDG-TFCPDGSTCCEQVDHTYGCCSILSAVCCSDHLHCCPGGTTCDLVHKKCVSQTGEGPLLPQMPAIREESANQVPC-DAT---TKKETCCRLVSG-KWGCCPVVKAVCCNDHLHCCPEGYTC--SQGECSKMEHSIPWFTKTPALTHEARDVECDDMYSCPDGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCS 416          

HSP 4 Score: 174.096 bits (440), Expect = 6.030e-47
Identity = 113/319 (35.42%), Postives = 154/319 (48.28%), Query Frame = 2
Query:  263 GSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLS--IECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAK----YQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEAL----EIKISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCP 1189
            G + CCP   AVCC+D  HCCP+   C+  +G C  +   +    K          V C D   C DG +CC +A G++ CCP + AVCC D +HCCP    C  S G C  +  E    +  K PA+   +  ++C D + +C  G TCC L+ G +GCCP + AVCC D   CCP    C+       S+       I  F   P  +    D +    Y C+DGQTCC+L +GD +GCCP + A CCSD  HCCPQ   C+  +GTC     ++    ++   P       C +   C    TCCP     + CCP
Sbjct:  315 GKWGCCPVVKAVCCNDHLHCCPEGYTCS--QGECSKMEHSIPWFTKTPALTHEARDVECDDMYSCPDGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTC--SGGQC--QKGEHSIPLFSKTPALRQETKYVKC-DDTHSCADGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCS------GSQCMIGEHSIPWFSKTPALKQKAKDVQCDDMYSCADGQTCCRLASGD-WGCCPIAQAVCCSDHWHCCPQGFTCDA-RGTCVLGQFSIPWLTKVPALPFDGTHSICDDTHTCPSGTTCCPGEGGGWRCCP 618          

HSP 5 Score: 147.132 bits (370), Expect = 1.159e-37
Identity = 113/355 (31.83%), Postives = 151/355 (42.54%), Query Frame = 2
Query:  263 GSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLS--IECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDK--IHCCPQNTVCNINKGTCDH-------QAEALEIKISPILVESIK-----CPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKN 1279
            G + CCP + AVCC D +HCCP    C+   G C      +    K          V C D   C DG +CC +A G++ CCP + AVCC D +HCCP    C+ S       + E       K PA+   +  ++C D  S C  G TCC L+ G +GCCP + AVCCSD   CCPQ   C+        +   P L      P      IC D  + C  G TCC    G  + CCP    +    +  I       V  ++   C         Q EA+E   S   V+ ++     C +   C    TCC      ++CC Y   VCC D  HCCP    C  +  SC ++
Sbjct:  389 GDWGCCPIAQAVCCDDHEHCCPPGYTCS--GGQCQKGEHSIPLFSKTPALRQETKYVKCDDTHSCADGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCSGS----QCMIGEHSIPWFSKTPALKQKAKDVQCDDMYS-CADGQTCCRLASGDWGCCPIAQAVCCSDHWHCCPQGFTCDARGTCVLGQFSIPWLTKVPALPFDGTHSICDDT-HTCPSGTTCCP-GEGGGWRCCPVEEVSKMVKRTVILLATACIVTLVSFSFCPDIIIYYALQKEAIETSPSDTSVQGLRLDYVWCDSQYACFDGQTCCRGLGGVWNCCVYTQGVCCPDMVHCCPYGYVCLNHGTSCSRS 734          

HSP 6 Score: 147.132 bits (370), Expect = 1.388e-37
Identity = 101/276 (36.59%), Postives = 132/276 (47.83%), Query Frame = 2
Query:  449 SQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSD-GSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIK-----TFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEA--LEIKISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCS 1252
            S C D  SC    +G  ACCP +    C D  HCC   + C+     C              IPA +  ++ CPDG S C T  TCC++SD  S+GCCP   AVCC D + CCP N+ C++  G C S       + K       + +   RV C D  + C DG TCC+     +YGCC   +A CCSD +HCCP  T C++    C  Q     L  ++  I  ES          +K TCC   +  + CCP   AVCC+DH HCCP   +CS
Sbjct:   83 SGCPDEYSCVNTPEGGTACCPLAEGKSCQDGHHCCSVGSYCSDDGHYC--------------IPASNQSAVVCPDGRSECPTLTTCCMMSDMSSWGCCPMPQAVCCDDHMHCCPHNSECDVQQGRCISNQDHIPWMSKLPARVKSEGDEERRVPCLDGTF-CPDGSTCCEQ-VDHTYGCCSILSAVCCSDHLHCCPGGTTCDLVHKKCVSQTGEGPLLPQMPAIREESANQVPCDATTKKETCCRLVSGKWGCCPVVKAVCCNDHLHCCPEGYTCS 342          

HSP 7 Score: 113.235 bits (282), Expect = 3.281e-26
Identity = 90/316 (28.48%), Postives = 134/316 (42.41%), Query Frame = 2
Query:  401 LKVPASSILSVVCPDQSQCDDGSSCCVM-ADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC-DHQAEALEIKISPILVES-------IKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSC-----DKNILLKFPIIN 1306
            L +  S++ + +CPD S C + S CC +     + CCP +                              EVV++    I + ++ S  CPD  S   T        +G   CCP +    C D   CC   + C+     C   + +             + V+CPD + +C    TCC +    S+GCCP   A CC D +HCCP N+ C++ +G C  +Q     +   P  V+S       + C +G+ C    TCC   + +Y CC   +AVCCSDH HCCP  T+C L  K C     +  +L + P I 
Sbjct:   27 LLLVVSTVSATLCPDGSTCGEKSLCCELPGKKGYGCCPAA------------------------------EVVSRSLPMILSQTSCS-GCPDEYSCVNT-------PEGGTACCPLAEGKSCQDGHHCCSVGSYCSDDGHYCIPASNQ-------------SAVVCPDGRSECPTLTTCCMMSDMSSWGCCPMPQAVCCDDHMHCCPHNSECDVQQGRCISNQDHIPWMSKLPARVKSEGDEERRVPCLDGTFCPDGSTCCEQVDHTYGCCSILSAVCCSDHLHCCPGGTTCDLVHKKCVSQTGEGPLLPQMPAIR 291          
BLAST of Granulin precursor vs. Ensembl Xenopus
Match: trappc11 (trafficking protein particle complex 11 [Source:Xenbase;Acc:XB-GENE-5931148])

HSP 1 Score: 193.741 bits (491), Expect = 2.109e-53
Identity = 128/347 (36.89%), Postives = 178/347 (51.30%), Query Frame = 2
Query:  266 SYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEV--VTKIKLKVPASSI---------LSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSI-ECP-DGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTF-QPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEAL-EIKISPILVES---IKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCS 1252
            S+ CCP   AVCC D  HCCP N+EC++ +G C S    +  ++K+  +V +  +           V C D + C DGS+CC   D  + CC   SAVCCSD  HCCP  T C+L    C S+  E    +  ++PAI   S  + P D +++C    TCC LS   +GCCP++ AVCC D + CCP    C+   G+C         + KT  Q     RV C D    C + +TCC+L +G  +GCCP   A CC+D +HCCP+   C  ++G C     ++     +P L      ++C +   C    TCC  A+  + CCP   AVCC DH HCCP   +CS
Sbjct:  142 SWGCCPMPQAVCCDDHMHCCPHNSECDVQQGRCISNQDHIPWMSKLPARVKSEGLKLVGLGDEERRVPCLDGTFCPDGSTCCEQVDHTYGCCSILSAVCCSDHLHCCPGGTTCDLVHKKCVSQTGE--GPLLPQMPAIREESANQVPCDATTSCPDKNTCCHLSSEKWGCCPYAQAVCCDDHIHCCPSGFTCS--GGSCVLAEHSIPWMRKTLAQGLKTTRVQCDDTA-SCPEKETCCRLVSG-KWGCCPVVKAVCCNDHLHCCPEGYTC--SQGECSKMEHSIPWFTKTPALTHEARDVECDDMYSCPDGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCS 480          

HSP 2 Score: 190.274 bits (482), Expect = 3.139e-52
Identity = 130/352 (36.93%), Postives = 183/352 (51.99%), Query Frame = 2
Query:  254 TTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPD-QSQCDDGSSCCVMAD-GNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTC---------DSKLKEVVTKMKLKIPAISN--LSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLL--IKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC---DHQAEALEIKISPIL-VESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCS 1252
            T +G  +CCP +    C D  HCC   + C+ +   C              +PAS+  +VVCPD +S+C   ++CC+M+D  ++ CCP   AVCC D  HCCP N+ C++  G C          SKL   V    LK+  + +    + C DG + C  G+TCC   D +YGCC   +AVCCSD L CCP  T C+L    C S+T +  LL  +   +    N+V C DA   C D  TCC L + + +GCCPY+ A CC D IHCCP    C  + G+C   +H    +   ++  L    ++C + + C +K TCC   +  + CCP   AVCC+DH HCCP   +CS
Sbjct:   74 TPEGGTACCPLAEGKSCQDGHHCCSVGSYCSDDGHYC--------------IPASNQSAVVCPDGRSECPTLTTCCMMSDMSSWGCCPMPQAVCCDDHMHCCPHNSECDVQQGRCISNQDHIPWMSKLPARVKSEGLKLVGLGDEERRVPCLDG-TFCPDGSTCCEQVDHTYGCCSILSAVCCSDHLHCCPGGTTCDLVHKKCVSQTGEGPLLPQMPAIREESANQVPC-DATTSCPDKNTCCHL-SSEKWGCCPYAQAVCCDDHIHCCPSGFTC--SGGSCVLAEHSIPWMRKTLAQGLKTTRVQCDDTASCPEKETCCRLVSGKWGCCPVVKAVCCNDHLHCCPEGYTCS 406          

HSP 3 Score: 168.703 bits (426), Expect = 7.796e-45
Identity = 127/410 (30.98%), Postives = 171/410 (41.71%), Query Frame = 2
Query:  263 GSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLS--IECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAK----YQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEAL-EIKISPILVES---IKCPNGSLCGQKGTCCPSANDSYSCCPYPN-----------------------------------------------AVCCSDHSHCCPNNTSCSLNTKSCDKNI----LLKFPIINF 1309
            G + CCP   AVCC+D  HCCP+   C+  +G C  +   +    K          V C D   C DG +CC +A G++ CCP + AVCC D +HCCP    C  S G C  +  E    +  K PA+   +  ++C D + +C  G TCC L+ G +GCCP + AVCC D   CCP    C+       S+       I  F   P  +    D +    Y C+DGQTCC+L +GD +GCCP + A CC D  HCCP    C  + G C     ++     +P L +    +KC +   C    TCC   +  + CCP                                                  AVCCSDH HCCP   +C               L K P + F
Sbjct:  379 GKWGCCPVVKAVCCNDHLHCCPEGYTCS--QGECSKMEHSIPWFTKTPALTHEARDVECDDMYSCPDGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTC--SGGQC--QKGEHSIPLFSKTPALRQETKYVKC-DDTHSCADGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCS------GSQCMIGEHSIPWFSKTPALKQKAKDVQCDDMYSCADGQTCCRLASGD-WGCCPIAQAVCCDDHEHCCPPGYTC--SGGQCQKGEHSIPWYSKTPALKQEGNIVKCDDSFACKDGYTCCRMVSGVWGCCPIEKCCQTHTPLLPLQKCCPSLPILALATCHVQDSVQDSCTRLQSTHWCRTAVCCSDHWHCCPQGFTCDARGTCVLGQFSIPWLTKVPALPF 772          

HSP 4 Score: 152.14 bits (383), Expect = 3.284e-39
Identity = 104/287 (36.24%), Postives = 138/287 (48.08%), Query Frame = 2
Query:  449 SQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSD-GSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDS-------------KTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQ-AEALEIKISPILVES----IKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCS 1252
            S C D  SC    +G  ACCP +    C D  HCC   + C+     C              IPA +  ++ CPDG S C T  TCC++SD  S+GCCP   AVCC D + CCP N+ C++  G C S             + K   L +     +   RV C D  + C DG TCC+     +YGCC   +A CCSD +HCCP  T C++    C  Q  E   +   P + E     + C   + C  K TCC  +++ + CCPY  AVCC DH HCCP+  +CS
Sbjct:   63 SGCPDEYSCVNTPEGGTACCPLAEGKSCQDGHHCCSVGSYCSDDGHYC--------------IPASNQSAVVCPDGRSECPTLTTCCMMSDMSSWGCCPMPQAVCCDDHMHCCPHNSECDVQQGRCISNQDHIPWMSKLPARVKSEGLKLVGLG-DEERRVPCLDGTF-CPDGSTCCEQ-VDHTYGCCSILSAVCCSDHLHCCPGGTTCDLVHKKCVSQTGEGPLLPQMPAIREESANQVPCDATTSCPDKNTCCHLSSEKWGCCPYAQAVCCDDHIHCCPSGFTCS 332          

HSP 5 Score: 123.635 bits (309), Expect = 1.508e-29
Identity = 116/409 (28.36%), Postives = 156/409 (38.14%), Query Frame = 2
Query:  263 GSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPA--SSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLS--IECPDGSSTCKTGATCCLLSDGSYGCCPFSN-----------------------------------------------AVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDK--IHCCPQNTVCNINKGTCDH-------QAEALEIKISPILVESIK-----CPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKF 1294
            G + CCP + AVCC D +HCCP    C+ ++     ++ E       K PA       V C D   C DG +CC +A G++ CCP + AVCC D +HCCP    C  S G C  +  E       K PA+      ++C D S  CK G TCC +  G +GCCP                                                  AVCCSD   CCPQ   C+        +   P L      P      IC D  + C  G TCC    G  + CCP    +    +  I       V  ++   C         Q EA+E   S   V+ ++     C +   C    TCC      ++CC Y   VCC D  HCCP    C  +  SC ++   ++
Sbjct:  527 GDWGCCPIAQAVCCDDHEHCCPPGYTCSGSQ----CMIGEHSIPWFSKTPALKQKAKDVQCDDMYSCADGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTC--SGGQC--QKGEHSIPWYSKTPALKQEGNIVKC-DDSFACKDGYTCCRMVSGVWGCCPIEKCCQTHTPLLPLQKCCPSLPILALATCHVQDSVQDSCTRLQSTHWCRTAVCCSDHWHCCPQGFTCDARGTCVLGQFSIPWLTKVPALPFDGTHSICDDT-HTCPSGTTCCP-GEGGGWRCCPVEEVSKMVKRTVILLATACIVTLVSFSFCPDIIIYYALQKEAIETSPSDTSVQGLRLDYVWCDSQYACFDGQTCCRGLGGVWNCCVYTQGVCCPDMVHCCPYGYVCLNHGTSCSRSGSPRW 924          

HSP 6 Score: 112.849 bits (281), Expect = 5.362e-26
Identity = 90/323 (27.86%), Postives = 135/323 (41.80%), Query Frame = 2
Query:  401 LKVPASSILSVVCPDQSQCDDGSSCCVM-ADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC----DH-----------QAEALEIKISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSC-----DKNILLKFPIIN 1306
            L +  S++ + +CPD S C + S CC +     + CCP +                              EVV++    I + ++ S  CPD  S   T        +G   CCP +    C D   CC   + C+     C   + +             + V+CPD + +C    TCC +    S+GCCP   A CC D +HCCP N+ C++ +G C    DH           ++E L++         + C +G+ C    TCC   + +Y CC   +AVCCSDH HCCP  T+C L  K C     +  +L + P I 
Sbjct:    7 LLLVVSTVSATLCPDGSTCGEKSLCCELPGKKGYGCCPAA------------------------------EVVSRSLPMILSQTSCS-GCPDEYSCVNT-------PEGGTACCPLAEGKSCQDGHHCCSVGSYCSDDGHYCIPASNQ-------------SAVVCPDGRSECPTLTTCCMMSDMSSWGCCPMPQAVCCDDHMHCCPHNSECDVQQGRCISNQDHIPWMSKLPARVKSEGLKLVGLGDEERRVPCLDGTFCPDGSTCCEQVDHTYGCCSILSAVCCSDHLHCCPGGTTCDLVHKKCVSQTGEGPLLPQMPAIR 278          
BLAST of Granulin precursor vs. Ensembl Xenopus
Match: trappc11 (trafficking protein particle complex 11 [Source:Xenbase;Acc:XB-GENE-5931148])

HSP 1 Score: 190.66 bits (483), Expect = 1.689e-52
Identity = 134/374 (35.83%), Postives = 192/374 (51.34%), Query Frame = 2
Query:  254 TTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPD-QSQCDDGSSCCVMAD-GNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTC---------DSKLKEVVTKMKLKIPAISN--LSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLL--IKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC---DHQAEALEIKISPIL-VESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKF---PIINF 1309
            T +G  +CCP +    C D  HCC   + C+ +   C              +PAS+  +VVCPD +S+C   ++CC+M+D  ++ CCP   AVCC D  HCCP N+ C++  G C          SKL   V    LK+  + +    + C DG + C  G+TCC   D +YGCC   +AVCCSD L CCP  T C+L    C S+T +  LL  +   +    N+V C DA   C D  TCC L + + +GCCPY+ A CC D IHCCP    C  + G+C   +H    +   ++  L    ++C + + C +K TCC   +  + CCP   AVCC+DH HCCP   +CS    S  ++ +  F   P++ F
Sbjct:   74 TPEGGTACCPLAEGKSCQDGHHCCSVGSYCSDDGHYC--------------IPASNQSAVVCPDGRSECPTLTTCCMMSDMSSWGCCPMPQAVCCDDHMHCCPHNSECDVQQGRCISNQDHIPWMSKLPARVKSEGLKLVGLGDEERRVPCLDG-TFCPDGSTCCEQVDHTYGCCSILSAVCCSDHLHCCPGGTTCDLVHKKCVSQTGEGPLLPQMPAIREESANQVPC-DATTSCPDKNTCCHL-SSEKWGCCPYAQAVCCDDHIHCCPSGFTC--SGGSCVLAEHSIPWMRKTLAQGLKTTRVQCDDTASCPEKETCCRLVSGKWGCCPVVKAVCCNDHLHCCPEGYTCSQGECSKMEHSIPWFTKTPMVFF 428          

HSP 2 Score: 188.348 bits (477), Expect = 1.426e-51
Identity = 127/360 (35.28%), Postives = 177/360 (49.17%), Query Frame = 2
Query:  266 SYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEV--VTKIKLKVPASSI---------LSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSI-ECP-DGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTF-QPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKISPILV-----------------ESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCS 1252
            S+ CCP   AVCC D  HCCP N+EC++ +G C S    +  ++K+  +V +  +           V C D + C DGS+CC   D  + CC   SAVCCSD  HCCP  T C+L    C S+  E    +  ++PAI   S  + P D +++C    TCC LS   +GCCP++ AVCC D + CCP    C+   G+C         + KT  Q     RV C D    C + +TCC+L +G  +GCCP   A CC+D +HCCP+   C  ++G C     ++       +V                   ++C +   C    TCC  A+  + CCP   AVCC DH HCCP   +CS
Sbjct:  142 SWGCCPMPQAVCCDDHMHCCPHNSECDVQQGRCISNQDHIPWMSKLPARVKSEGLKLVGLGDEERRVPCLDGTFCPDGSTCCEQVDHTYGCCSILSAVCCSDHLHCCPGGTTCDLVHKKCVSQTGE--GPLLPQMPAIREESANQVPCDATTSCPDKNTCCHLSSEKWGCCPYAQAVCCDDHIHCCPSGFTCS--GGSCVLAEHSIPWMRKTLAQGLKTTRVQCDDTA-SCPEKETCCRLVSG-KWGCCPVVKAVCCNDHLHCCPEGYTC--SQGECSKMEHSIPWFTKTPMVFFLSLSLLSILPVVSVARDVECDDMYSCPDGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCS 493          

HSP 3 Score: 176.792 bits (447), Expect = 1.371e-47
Identity = 129/378 (34.13%), Postives = 168/378 (44.44%), Query Frame = 2
Query:  257 TDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKL-KVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSK-------TKKPSLLIKTFQPN------PVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCP---------------------------QNTVCNINKGTCDHQAEALEIKISPIL-----VESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCS 1252
             D +Y CC   SAVCCSD  HCCP  T C+L    C S   E     ++  +   S   V C   + C D ++CC ++   + CCPY+ AVCC D  HCCP    C  S G+C      +    K     +    ++C D +++C    TCC L  G +GCCP   AVCC+D L CCP+   C+   G C          TK P +   +           V R +  D  Y C DGQTCC+L +GD +GCCP + A CC D  HCCP                           Q T C    G  D     L +  SP +      + +KC +   C    TCC  A+  + CCP   AVCC DH HCCP   +CS
Sbjct:  226 VDHTYGCCSILSAVCCSDHLHCCPGGTTCDLVHKKCVSQTGEGPLLPQMPAIREESANQVPCDATTSCPDKNTCCHLSSEKWGCCPYAQAVCCDDHIHCCPSGFTC--SGGSCVLAEHSIPWMRKTLAQGLKTTRVQC-DDTASCPEKETCCRLVSGKWGCCPVVKAVCCNDHLHCCPEGYTCS--QGECSKMEHSIPWFTKTPMVFFLSLSLLSILPVVSVARDVECDDMYSCPDGQTCCRLASGD-WGCCPIAQAVCCDDHEHCCPPGYTCSGGQCQKGEHSIPLFSKTPALRQETACARRCGD-DEYPFPLCLLFSPFICPFSVAKYVKCDDTHSCADGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCS 596          

HSP 4 Score: 172.555 bits (436), Expect = 3.316e-46
Identity = 129/374 (34.49%), Postives = 174/374 (46.52%), Query Frame = 2
Query:  269 YSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVV---TKMKLKI----------PAIS-NLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSK-------TKKPSLLIKTF---------QPNPV----NRVICP---------DAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKISPIL---VESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCS 1252
            + CCPY+ AVCC D  HCCP    C+   G+C      +    K          V C D + C +  +CC +  G + CCP   AVCC+D  HCCP+   C  S G C SK++  +   TK  +            P +S    +EC D  S C  G TCC L+ G +GCCP + AVCC D   CCP    C+   G C          +K P+L  +T           P P+    +  ICP         D  + C+DGQTCC+L +GD +GCCP + A CC D  HCCP    C+ ++      +     K +P L    + ++C +   C    TCC  A+  + CCP   AVCC DH HCCP   +CS
Sbjct:  307 WGCCPYAQAVCCDDHIHCCPSGFTCS--GGSCVLAEHSIPWMRKTLAQGLKTTRVQCDDTASCPEKETCCRLVSGKWGCCPVVKAVCCNDHLHCCPEGYTC--SQGEC-SKMEHSIPWFTKTPMVFFLSLSLLSILPVVSVARDVECDDMYS-CPDGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCS--GGQCQKGEHSIPLFSKTPALRQETACARRCGDDEYPFPLCLLFSPFICPFSVAKYVKCDDTHSCADGQTCCRLASGD-WGCCPIAQAVCCDDHEHCCPPGYTCSGSQCMIGEHSIPWFSK-TPALKQKAKDVQCDDMYSCADGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCS 670          

HSP 5 Score: 168.703 bits (426), Expect = 6.942e-45
Identity = 130/416 (31.25%), Postives = 175/416 (42.07%), Query Frame = 2
Query:  263 GSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKV------------PASSILS-VVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLS---------------------IECP---------DGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAK----YQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCN-------------INKGTCDHQAEALEIKISPILVES---IKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNI----LLKFPIINF 1309
            G + CCP   AVCC+D  HCCP+   C+  +G C  +   +    K  +            P  S+   V C D   C DG +CC +A G++ CCP + AVCC D +HCCP    C  S G C  +  E    +  K PA+   +                       CP         D + +C  G TCC L+ G +GCCP + AVCC D   CCP    C+       S+       I  F   P  +    D +    Y C+DGQTCC+L +GD +GCCP + A CC D  HCCP    C+              +K     Q     +  +P+ V +   +KC +   C    TCC   +  + CCP   AVCCSDH HCCP   +C               L K P + F
Sbjct:  379 GKWGCCPVVKAVCCNDHLHCCPEGYTCS--QGECSKMEHSIPWFTKTPMVFFLSLSLLSILPVVSVARDVECDDMYSCPDGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTC--SGGQC--QKGEHSIPLFSKTPALRQETACARRCGDDEYPFPLCLLFSPFICPFSVAKYVKCDDTHSCADGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCS------GSQCMIGEHSIPWFSKTPALKQKAKDVQCDDMYSCADGQTCCRLASGD-WGCCPIAQAVCCDDHEHCCPPGYTCSGGQCQKGEHSIPWYSKTPALKQEGKCNLANTPVNVFAGNIVKCDDSFACKDGYTCCRMVSGVWGCCPIEKAVCCSDHWHCCPQGFTCDARGTCVLGQFSIPWLTKVPALPF 781          

HSP 6 Score: 153.68 bits (387), Expect = 1.192e-39
Identity = 128/441 (29.02%), Postives = 174/441 (39.46%), Query Frame = 2
Query:  263 GSYSCCPYSSAVCCSDKQHCCP---------------------------QNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLS--IECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSK-------TKKPSLLIK---TFQPNPVN----RVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC-------------------------------------------------DHQAEALEIKISPILVESIK-----CPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKF 1294
            G + CCP + AVCC D +HCCP                           Q T C    G  +      +       P S    V C D   C DG +CC +A G++ CCP + AVCC D +HCCP    C+ S       + E       K PA+   +  ++C D  S C  G TCC L+ G +GCCP + AVCC D   CCP    C+   G C          +K P+L  +        PVN     ++  D  + C DG TCC++ +G  +GCCP   A CCSD  HCCPQ   C+  +GTC                                                   + EA+E   S   V+ ++     C +   C    TCC      ++CC Y   VCC D  HCCP    C  +  SC ++   ++
Sbjct:  466 GDWGCCPIAQAVCCDDHEHCCPPGYTCSGGQCQKGEHSIPLFSKTPALRQETACARRCGDDEYPFPLCLLFSPFICPFSVAKYVKCDDTHSCADGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCSGS----QCMIGEHSIPWFSKTPALKQKAKDVQCDDMYS-CADGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCS--GGQCQKGEHSIPWYSKTPALKQEGKCNLANTPVNVFAGNIVKCDDSFACKDGYTCCRMVSG-VWGCCPIEKAVCCSDHWHCCPQGFTCDA-RGTCVLGQFSIPWLTKVPALPFDGTHSICDDTHTCPSGTTCCPGEGGGWRCCPVEEKEAIETSPSDTSVQGLRLDYVWCDSQYACFDGQTCCRGLGGVWNCCVYTQGVCCPDMVHCCPYGYVCLNHGTSCSRSGSPRW 897          

HSP 7 Score: 151.754 bits (382), Expect = 4.660e-39
Identity = 104/287 (36.24%), Postives = 138/287 (48.08%), Query Frame = 2
Query:  449 SQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSD-GSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDS-------------KTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQ-AEALEIKISPILVES----IKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCS 1252
            S C D  SC    +G  ACCP +    C D  HCC   + C+     C              IPA +  ++ CPDG S C T  TCC++SD  S+GCCP   AVCC D + CCP N+ C++  G C S             + K   L +     +   RV C D  + C DG TCC+     +YGCC   +A CCSD +HCCP  T C++    C  Q  E   +   P + E     + C   + C  K TCC  +++ + CCPY  AVCC DH HCCP+  +CS
Sbjct:   63 SGCPDEYSCVNTPEGGTACCPLAEGKSCQDGHHCCSVGSYCSDDGHYC--------------IPASNQSAVVCPDGRSECPTLTTCCMMSDMSSWGCCPMPQAVCCDDHMHCCPHNSECDVQQGRCISNQDHIPWMSKLPARVKSEGLKLVGLG-DEERRVPCLDGTF-CPDGSTCCEQ-VDHTYGCCSILSAVCCSDHLHCCPGGTTCDLVHKKCVSQTGEGPLLPQMPAIREESANQVPCDATTSCPDKNTCCHLSSEKWGCCPYAQAVCCDDHIHCCPSGFTCS 332          

HSP 8 Score: 112.464 bits (280), Expect = 7.753e-26
Identity = 90/323 (27.86%), Postives = 135/323 (41.80%), Query Frame = 2
Query:  401 LKVPASSILSVVCPDQSQCDDGSSCCVM-ADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC----DH-----------QAEALEIKISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSC-----DKNILLKFPIIN 1306
            L +  S++ + +CPD S C + S CC +     + CCP +                              EVV++    I + ++ S  CPD  S   T        +G   CCP +    C D   CC   + C+     C   + +             + V+CPD + +C    TCC +    S+GCCP   A CC D +HCCP N+ C++ +G C    DH           ++E L++         + C +G+ C    TCC   + +Y CC   +AVCCSDH HCCP  T+C L  K C     +  +L + P I 
Sbjct:    7 LLLVVSTVSATLCPDGSTCGEKSLCCELPGKKGYGCCPAA------------------------------EVVSRSLPMILSQTSCS-GCPDEYSCVNT-------PEGGTACCPLAEGKSCQDGHHCCSVGSYCSDDGHYCIPASNQ-------------SAVVCPDGRSECPTLTTCCMMSDMSSWGCCPMPQAVCCDDHMHCCPHNSECDVQQGRCISNQDHIPWMSKLPARVKSEGLKLVGLGDEERRVPCLDGTFCPDGSTCCEQVDHTYGCCSILSAVCCSDHLHCCPGGTTCDLVHKKCVSQTGEGPLLPQMPAIR 278          
BLAST of Granulin precursor vs. Ensembl Mouse
Match: Grn (granulin [Source:MGI Symbol;Acc:MGI:95832])

HSP 1 Score: 229.18 bits (583), Expect = 3.037e-68
Identity = 141/371 (38.01%), Postives = 197/371 (53.10%), Query Frame = 2
Query:  251 VTTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDS-----VLKEVVTKIKLKVPASSILSVVCPD-QSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPN--PVNRVICPDAK----YQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC---DHQAEALE----IKISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNI-LLKFPII 1303
            +  DGS+ CCP   A CC D+ HCCP    C+L    C S      L +     K     S   SVVCPD ++QC D S+CC +  G + CCP  +A+CCSD  HCCPQ+TVC+L    C SK     T +  K+P      ++C D   +C  G TCC L+ G++GCCPF+ AVCC D + CCP    C+   GTC+    +   + K   P   P  +++  D       +C    TCCKL +GD +GCCP   A CCSD  HCCPQ   C + +G C   D     LE     + +P+ +  I C   + C    TCCPS   S++CC  P+AVCC D  HCCP   +C++  ++C+K++  ++ P++
Sbjct:  153 IMVDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHTRCVSPTGTHTLLKKFPAQKTNRAVSLPFSVVCPDAKTQCPDDSTCCELPTGKYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCLSK--NYTTDLLTKLPGYPVKEVKC-DMEVSCPEGYTCCRLNTGAWGCCPFAKAVCCEDHIHCCPAGFQCHTEKGTCEMGILQVPWMKKVIAPLRLPDPQILKSDTPCDDFTRCPTNNTCCKLNSGD-WGCCPIPEAVCCSDNQHCCPQGFTC-LAQGYCQKGDTMVAGLEKIPARQTTPLQIGDIGCDQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTCEKDVDFIQPPVL 518          

HSP 2 Score: 223.016 bits (567), Expect = 5.956e-66
Identity = 141/363 (38.84%), Postives = 186/363 (51.24%), Query Frame = 2
Query:  251 VTTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPD-QSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDS---------KLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDH---QAEALEIKISP-------ILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKN 1279
            +T  G+ SCCP+S  V C D  HCCPQ   C+ +  +C             ++  + + +V CP  Q +C D ++CC+M DG++ CCP   A CC D+ HCCP    C+L    C S         K     T   + +P     S+ CPD  + C   +TCC L  G YGCCP  NA+CCSD L CCPQ+TVC+L    C SK     LL K     PV  V C D +  C +G TCC+L TG ++GCCP++ A CC D IHCCP    C+  KGTC+    Q   ++  I+P       IL     C + + C    TCC   +  + CCP P AVCCSD+ HCCP   +C L    C K 
Sbjct:   88 LTVSGTSSCCPFSKGVSCGDGYHCCPQGFHCSADGKSC------------FQMSDNPLGAVQCPGSQFECPDSATCCIMVDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHTRCVSPTGTHTLLKKFPAQKTNRAVSLP----FSVVCPDAKTQCPDDSTCCELPTGKYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCLSKNYTTDLLTK-LPGYPVKEVKC-DMEVSCPEGYTCCRLNTG-AWGCCPFAKAVCCEDHIHCCPAGFQCHTEKGTCEMGILQVPWMKKVIAPLRLPDPQILKSDTPCDDFTRCPTNNTCCKLNSGDWGCCPIPEAVCCSDNQHCCPQGFTC-LAQGYCQKG 430          

HSP 3 Score: 210.305 bits (534), Expect = 3.415e-61
Identity = 130/364 (35.71%), Postives = 177/364 (48.63%), Query Frame = 2
Query:  263 GSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSK------LKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKT----FQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKISPIL---VESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIINFHP 1315
            G Y CCP  +A+CCSD  HCCPQ+T C+L +  C S  K   T +  K+P   +  V C  +  C +G +CC +  G + CCP++ AVCC D  HCCP    C+   GTC+        +K+V+  ++L  P I      C D  + C T  TCC L+ G +GCCP   AVCCSD   CCPQ   C L  G C       + L K       P  +  + C D    C  GQTCC    G S+ CC    A CC D+ HCCP    CN+   TC+   + ++  +   L   V +++C  G  C    TCC  +   ++CCPY   VCC D  HCCP    CS     C +  + ++ +    P
Sbjct:  239 GKYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCLS--KNYTTDLLTKLPGYPVKEVKCDMEVSCPEGYTCCRLNTGAWGCCPFAKAVCCEDHIHCCPAGFQCHTEKGTCEMGILQVPWMKKVIAPLRLPDPQILKSDTPC-DDFTRCPTNNTCCKLNSGDWGCCPIPEAVCCSDNQHCCPQGFTC-LAQGYCQKGDTMVAGLEKIPARQTTPLQIGDIGC-DQHTSCPVGQTCCPSLKG-SWACCQLPHAVCCEDRQHCCPAGYTCNVKARTCEKDVDFIQPPVLLTLGPKVGNVECGEGHFCHDNQTCCKDSAGVWACCPYLKGVCCRDGRHCCPGGFHCSARGTKCLRKKIPRWDMFLRDP 596          

HSP 4 Score: 189.119 bits (479), Expect = 2.387e-53
Identity = 115/299 (38.46%), Postives = 149/299 (49.83%), Query Frame = 2
Query:  416 SSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNR-------VICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC--DHQAEALEIKISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNIL 1285
            S  L   C     C  G SC +   G  +CCP+S  V C D  HCCPQ   C+    +C             ++      +++CP     C   ATCC++ DGS+GCCP   A CC D++ CCP    C+L    C S T   +LL K F     NR       V+CPDAK QC D  TCC+LPTG  YGCCP   A CCSD +HCCPQ+TVC++ +  C   +    L  K+    V+ +KC     C +  TCC     ++ CCP+  AVCC DH HCCP    C     +C+  IL
Sbjct:   67 SHHLDGSCQTHGHCPAGYSCLLTVSGTSSCCPFSKGVSCGDGYHCCPQGFHCSADGKSC------------FQMSDNPLGAVQCPGSQFECPDSATCCIMVDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHTRCVSPTGTHTLL-KKFPAQKTNRAVSLPFSVVCPDAKTQCPDDSTCCELPTG-KYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCLSKNYTTDLLTKLPGYPVKEVKCDMEVSCPEGYTCCRLNTGAWGCCPFAKAVCCEDHIHCCPAGFQCHTEKGTCEMGIL 351          
BLAST of Granulin precursor vs. Ensembl Mouse
Match: Grn (granulin [Source:MGI Symbol;Acc:MGI:95832])

HSP 1 Score: 105.531 bits (262), Expect = 1.565e-25
Identity = 76/258 (29.46%), Postives = 109/258 (42.25%), Query Frame = 2
Query:  569 CNLSAGTCDSK------LKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKISPIL---VESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIINFHP 1315
            C+   GTC+        +K+V+  ++L  P I      C D  + C T  TCC L+ G +GCCP     C               + AG      K P+      Q   +  + C D    C  GQTCC    G S+ CC    A CC D+ HCCP    CN+   TC+   + ++  +   L   V +++C  G  C    TCC  +   ++CCPY   VCC D  HCCP    CS     C +  + ++ +    P
Sbjct:    4 CHTEKGTCEMGILQVPWMKKVIAPLRLPDPQILKSDTPC-DDFTRCPTNNTCCKLNSGDWGCCPIPEGYCQKGD----------TMVAGL----EKIPARQTTPLQ---IGDIGC-DQHTSCPVGQTCCPSLKG-SWACCQLPHAVCCEDRQHCCPAGYTCNVKARTCEKDVDFIQPPVLLTLGPKVGNVECGEGHFCHDNQTCCKDSAGVWACCPYLKGVCCRDGRHCCPGGFHCSARGTKCLRKKIPRWDMFLRDP 241          

HSP 2 Score: 100.138 bits (248), Expect = 1.315e-23
Identity = 76/251 (30.28%), Postives = 110/251 (43.82%), Query Frame = 2
Query:  338 ECNLNKGTCD------SVLKEVVTKIKLKVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECP----DGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTK--KPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC 1054
            +C+  KGTC+        +K+V+  ++L  P        C D ++C   ++CC +  G++ CCP     C                       K   +V  ++ KIPA     ++      D  ++C  G TCC    GS+ CC   +AVCC D+  CCP    CN+ A TC+      +P +L+ T  P  V  V C +  + C D QTCCK   G  + CCPY    CC D  HCCP    C+     C
Sbjct:    3 QCHTEKGTCEMGILQVPWMKKVIAPLRLPDPQILKSDTPCDDFTRCPTNNTCCKLNSGDWGCCPIPEGYC----------------------QKGDTMVAGLE-KIPARQTTPLQIGDIGCDQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTCEKDVDFIQPPVLL-TLGPK-VGNVECGEGHF-CHDNQTCCKDSAG-VWACCPYLKGVCCRDGRHCCPGGFHCSARGTKC 226          

HSP 3 Score: 88.9669 bits (219), Expect = 1.216e-19
Identity = 62/208 (29.81%), Postives = 90/208 (43.27%), Query Frame = 2
Query:  302 CSDKQHCCPQNTECNLNKGTC-------------DSVLKEVVTKIKLKVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKI-PAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTC-DSKTKKPSLLIKTFQPNPV 880
            C D   C   NT C LN G               D+++  +      +     I  + C   + C  G +CC    G++ACC    AVCC D+QHCCP    CN+ A TC+  +  +   + L + P + N  +EC +G   C    TCC  S G + CCP+   VCC D   CCP    C+     C   K  +  + ++   P P+
Sbjct:   42 CDDFTRCPTNNTCCKLNSGDWGCCPIPEGYCQKGDTMVAGLEKIPARQTTPLQIGDIGCDQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTCEKDVDFIQPPVLLTLGPKVGN--VECGEG-HFCHDNQTCCKDSAGVWACCPYLKGVCCRDGRHCCPGGFHCSARGTKCLRKKIPRWDMFLRDPVPRPL 246          

HSP 4 Score: 82.0333 bits (201), Expect = 3.055e-17
Identity = 47/131 (35.88%), Postives = 65/131 (49.62%), Query Frame = 2
Query:  263 GSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNL 655
            GS++CC    AVCC D+QHCCP    CN+   TC+  +  +   + L +    + +V C +   C D  +CC  + G +ACCPY   VCC D +HCCP    C+     C  K K     M L+ P    L
Sbjct:  118 GSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTCEKDVDFIQPPVLLTL-GPKVGNVECGEGHFCHDNQTCCKDSAGVWACCPYLKGVCCRDGRHCCPGGFHCSARGTKCLRK-KIPRWDMFLRDPVPRPL 246          
BLAST of Granulin precursor vs. Ensembl Mouse
Match: Grn (granulin [Source:MGI Symbol;Acc:MGI:95832])

HSP 1 Score: 104.375 bits (259), Expect = 1.907e-24
Identity = 71/182 (39.01%), Postives = 97/182 (53.30%), Query Frame = 2
Query:  449 SQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPD----GSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTK--KPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPY 976
            ++C   ++CC +  G++ CCP   AVCCSD QHCCPQ   C L+ G C  K   +V  ++ KIPA     ++  D      ++C  G TCC    GS+ CC   +AVCC D+  CCP    CN+ A TC+      +P +L+ T  P  V  V C +  + C D QTCCK   G  + CCPY
Sbjct:    3 TRCPTNNTCCKLNSGDWGCCPIPEAVCCSDNQHCCPQGFTC-LAQGYCQ-KGDTMVAGLE-KIPARQTTPLQIGDIGCDQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTCEKDVDFIQPPVLL-TLGPK-VGNVECGEGHF-CHDNQTCCKDSAG-VWACCPY 177          

HSP 2 Score: 100.908 bits (250), Expect = 2.960e-23
Identity = 63/167 (37.72%), Postives = 85/167 (50.90%), Query Frame = 2
Query:  263 GSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASS-----ILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKI-PAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPF 745
            G + CCP   AVCCSD QHCCPQ   C L +G C     + +     K+PA       I  + C   + C  G +CC    G++ACC    AVCC D+QHCCP    CN+ A TC+  +  +   + L + P + N  +EC +G   C    TCC  S G + CCP+
Sbjct:   17 GDWGCCPIPEAVCCSDNQHCCPQGFTC-LAQGYCQK--GDTMVAGLEKIPARQTTPLQIGDIGCDQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTCEKDVDFIQPPVLLTLGPKVGN--VECGEG-HFCHDNQTCCKDSAGVWACCPY 177          

HSP 3 Score: 95.5153 bits (236), Expect = 2.826e-21
Identity = 65/178 (36.52%), Postives = 85/178 (47.75%), Query Frame = 2
Query:  680 STCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLL--IKTFQPNP--VNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKISPIL---VESIKCPNGSLCGQKGTCCPSANDSYSCCPY 1192
            + C T  TCC L+ G +GCCP   AVCCSD   CCPQ   C L  G C       + L  I   Q  P  +  + C D    C  GQTCC    G S+ CC    A CC D+ HCCP    CN+   TC+   + ++  +   L   V +++C  G  C    TCC  +   ++CCPY
Sbjct:    3 TRCPTNNTCCKLNSGDWGCCPIPEAVCCSDNQHCCPQGFTC-LAQGYCQKGDTMVAGLEKIPARQTTPLQIGDIGC-DQHTSCPVGQTCCPSLKG-SWACCQLPHAVCCEDRQHCCPAGYTCNVKARTCEKDVDFIQPPVLLTLGPKVGNVECGEGHFCHDNQTCCKDSAGVWACCPY 177          

HSP 4 Score: 94.3597 bits (233), Expect = 5.577e-21
Identity = 54/139 (38.85%), Postives = 79/139 (56.83%), Query Frame = 2
Query:  911 QCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC---DHQAEALE----IKISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNI-LLKFPII 1303
            +C    TCCKL +GD +GCCP   A CCSD  HCCPQ   C + +G C   D     LE     + +P+ +  I C   + C    TCCPS   S++CC  P+AVCC D  HCCP   +C++  ++C+K++  ++ P++
Sbjct:    4 RCPTNNTCCKLNSGD-WGCCPIPEAVCCSDNQHCCPQGFTC-LAQGYCQKGDTMVAGLEKIPARQTTPLQIGDIGCDQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTCEKDVDFIQPPVL 140          
BLAST of Granulin precursor vs. Ensembl Mouse
Match: Grn (granulin [Source:MGI Symbol;Acc:MGI:95832])

HSP 1 Score: 98.2117 bits (243), Expect = 3.511e-23
Identity = 62/174 (35.63%), Postives = 80/174 (45.98%), Query Frame = 2
Query:  416 SSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNR-------VICPDAKYQC 916
            S  L   C     C  G SC +   G  +CCP+S  V C D  HCCPQ   C+    +C             ++      +++CP     C   ATCC++ DGS+GCCP   A CC D++ CCP    C+L    C S T   +LL K F     NR       V+CPDAK QC
Sbjct:   54 SHHLDGSCQTHGHCPAGYSCLLTVSGTSSCCPFSKGVSCGDGYHCCPQGFHCSADGKSC------------FQMSDNPLGAVQCPGSQFECPDSATCCIMVDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHTRCVSPTGTHTLL-KKFPAQKTNRAVSLPFSVVCPDAKTQC 214          

HSP 2 Score: 83.9593 bits (206), Expect = 3.620e-18
Identity = 51/156 (32.69%), Postives = 74/156 (47.44%), Query Frame = 2
Query:  251 VTTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPD-QSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDS---------KLKEVVTKMKLKIPAISNLSIECPDGSSTC 688
            +T  G+ SCCP+S  V C D  HCCPQ   C+ +  +C             ++  + + +V CP  Q +C D ++CC+M DG++ CCP   A CC D+ HCCP    C+L    C S         K     T   + +P     S+ CPD  + C
Sbjct:   75 LTVSGTSSCCPFSKGVSCGDGYHCCPQGFHCSADGKSC------------FQMSDNPLGAVQCPGSQFECPDSATCCIMVDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHTRCVSPTGTHTLLKKFPAQKTNRAVSLP----FSVVCPDAKTQC 214          

HSP 3 Score: 82.4185 bits (202), Expect = 1.052e-17
Identity = 45/123 (36.59%), Postives = 62/123 (50.41%), Query Frame = 2
Query:  686 CKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC 1054
            C  G +C L   G+  CCPFS  V C D   CCPQ   C+    +C   +            NP+  V CP ++++C D  TCC +  G S+GCCP   A+CC D++HCCP    C++    C
Sbjct:   67 CPAGYSCLLTVSGTSSCCPFSKGVSCGDGYHCCPQGFHCSADGKSCFQMSD-----------NPLGAVQCPGSQFECPDSATCCIMVDG-SWGCCPMPQASCCEDRVHCCPHGASCDLVHTRC 177          

HSP 4 Score: 71.633 bits (174), Expect = 7.239e-14
Identity = 43/127 (33.86%), Postives = 58/127 (45.67%), Query Frame = 2
Query:  935 CKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKISPILVESIKCPNGSL-CGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSC-----DKNILLKFP 1297
            C L    +  CCP+S    C D  HCCPQ   C+ +  +C         ++S   + +++CP     C    TCC   + S+ CCP P A CC D  HCCP+  SC L    C        +L KFP
Sbjct:   73 CLLTVSGTSSCCPFSKGVSCGDGYHCCPQGFHCSADGKSC--------FQMSDNPLGAVQCPGSQFECPDSATCCIMVDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHTRCVSPTGTHTLLKKFP 191          
BLAST of Granulin precursor vs. UniProt/SwissProt
Match: sp|P28799|GRN_HUMAN (Progranulin OS=Homo sapiens OX=9606 GN=GRN PE=1 SV=2)

HSP 1 Score: 234.572 bits (597), Expect = 1.644e-69
Identity = 140/350 (40.00%), Postives = 187/350 (53.43%), Query Frame = 2
Query:  251 VTTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPD-QSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSK------LKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCD---HQAEALEIKISPI-------LVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSC 1249
             T  G+ SCCP+  AV C D  HCCP+   C+ +  +C             +   +S+ ++ CPD Q +C D S+CCVM DG++ CCP   A CC D+ HCCP    C+L    C +        K++  +   +  A+S+ S+ CPD  S C  G+TCC L  G YGCCP  NA CCSD L CCPQ+TVC+L    C SK    + L+     + V  V C D +  C DG TCC+L +G ++GCCP++ A CC D IHCCP    C+  KGTC+   HQ   +E   + +       L   + C N S C    TCC   +  + CCP P AVCCSDH HCCP   +C
Sbjct:   75 FTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQ-----------RSGNNSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCITPTGTHPLAKKLPAQRTNRAVALSS-SVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGDVKC-DMEVSCPDGYTCCRLQSG-AWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQALKRDVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTC 410          

HSP 2 Score: 227.639 bits (579), Expect = 5.312e-67
Identity = 140/370 (37.84%), Postives = 193/370 (52.16%), Query Frame = 2
Query:  251 VTTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSI-------LSVVCPD-QSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTF------QPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALE-IKISPILVESIKCPNGSLCGQK------GTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFP 1297
            V  DGS+ CCP   A CC D+ HCCP    C+L    C  +       +  K+PA           SV+CPD +S+C DGS+CC +  G + CCP  +A CCSD  HCCPQ+TVC+L    C SK +   T +  K+PA +   ++C D   +C  G TCC L  G++GCCPF+ AVCC D + CCP    C+   GTC+    +   + K         P  + R +  D    C    TCC+L +G+ +GCCP   A CCSD  HCCPQ   C + +G C   +E +  ++  P    S+  P    C Q        TCCPS   S++CC  P+AVCC D  HCCP   +C++  +SC+K ++   P
Sbjct:  141 VMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRC--ITPTGTHPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSK-ENATTDLLTKLPAHTVGDVKC-DMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQALKRDVPCDNVSSCPSSDTCCQLTSGE-WGCCPIPEAVCCSDHQHCCPQGYTC-VAEGQCQRGSEIVAGLEKMPARRASLSHPRDIGCDQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARSCEKEVVSAQP 504          

HSP 3 Score: 210.69 bits (535), Expect = 1.378e-60
Identity = 126/361 (34.90%), Postives = 177/361 (49.03%), Query Frame = 2
Query:  263 GSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMK----LKIPAISNLSIECP-DGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRV-------ICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALE----IKISP-ILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKF 1294
            G Y CCP  +A CCSD  HCCPQ+T C+L +  C S  +   T +  K+PA ++  V C  +  C DG +CC +  G + CCP++ AVCC D  HCCP    C+   GTC+    +V    K    L +P    L  + P D  S+C +  TCC L+ G +GCCP   AVCCSD   CCPQ   C       + + ++ S ++   +  P  R        I  D    C  GQTCC    G S+ CC    A CC D+ HCCP    CN+   +C+ +  + +    +  SP + V+ ++C  G  C    TCC      ++CCPY   VCC+D  HCCP    C+     C +    ++
Sbjct:  227 GKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSK-ENATTDLLTKLPAHTVGDVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQALKRDVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTC-----VAEGQCQRGSEIVAGLEKMPARRASLSHPRDIGCDQHTSCPVGQTCCP-SLGGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARSCEKEVVSAQPATFLARSPHVGVKDVECGEGHFCHDNQTCCRDNRQGWACCPYRQGVCCADRRHCCPAGFRCAARGTKCLRREAPRW 580          

HSP 4 Score: 183.341 bits (464), Expect = 2.018e-50
Identity = 112/304 (36.84%), Postives = 150/304 (49.34%), Query Frame = 2
Query:  398 KLKVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNR-------VICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEA---LEIKISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKN 1279
            K     S  L   C   + C  G SC     G  +CCP+  AV C D  HCCP+   C+    +C  +               S  +I+CPD    C   +TCC++ DGS+GCCP   A CC D++ CCP    C+L    C + T     L K       NR       V+CPDA+ +C DG TCC+LP+G  YGCCP   ATCCSD +HCCPQ+TVC++ +  C  +  A   L  K+    V  +KC     C    TCC   + ++ CCP+  AVCC DH HCCP   +C     +C++ 
Sbjct:   48 KWPTTLSRHLGGPCQVDAHCSAGHSCIFTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQRSGN-----------NSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCITPTGT-HPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELPSG-KYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGDVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQG 338          
BLAST of Granulin precursor vs. UniProt/SwissProt
Match: sp|P28798|GRN_MOUSE (Progranulin OS=Mus musculus OX=10090 GN=Grn PE=1 SV=2)

HSP 1 Score: 229.18 bits (583), Expect = 1.498e-67
Identity = 141/371 (38.01%), Postives = 197/371 (53.10%), Query Frame = 2
Query:  251 VTTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDS-----VLKEVVTKIKLKVPASSILSVVCPD-QSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPN--PVNRVICPDAK----YQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC---DHQAEALE----IKISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNI-LLKFPII 1303
            +  DGS+ CCP   A CC D+ HCCP    C+L    C S      L +     K     S   SVVCPD ++QC D S+CC +  G + CCP  +A+CCSD  HCCPQ+TVC+L    C SK     T +  K+P      ++C D   +C  G TCC L+ G++GCCPF+ AVCC D + CCP    C+   GTC+    +   + K   P   P  +++  D       +C    TCCKL +GD +GCCP   A CCSD  HCCPQ   C + +G C   D     LE     + +P+ +  I C   + C    TCCPS   S++CC  P+AVCC D  HCCP   +C++  ++C+K++  ++ P++
Sbjct:  140 IMVDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHTRCVSPTGTHTLLKKFPAQKTNRAVSLPFSVVCPDAKTQCPDDSTCCELPTGKYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCLSK--NYTTDLLTKLPGYPVKEVKC-DMEVSCPEGYTCCRLNTGAWGCCPFAKAVCCEDHIHCCPAGFQCHTEKGTCEMGILQVPWMKKVIAPLRLPDPQILKSDTPCDDFTRCPTNNTCCKLNSGD-WGCCPIPEAVCCSDNQHCCPQGFTC-LAQGYCQKGDTMVAGLEKIPARQTTPLQIGDIGCDQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTCEKDVDFIQPPVL 505          

HSP 2 Score: 223.016 bits (567), Expect = 2.751e-65
Identity = 141/363 (38.84%), Postives = 186/363 (51.24%), Query Frame = 2
Query:  251 VTTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPD-QSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDS---------KLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDH---QAEALEIKISP-------ILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKN 1279
            +T  G+ SCCP+S  V C D  HCCPQ   C+ +  +C             ++  + + +V CP  Q +C D ++CC+M DG++ CCP   A CC D+ HCCP    C+L    C S         K     T   + +P     S+ CPD  + C   +TCC L  G YGCCP  NA+CCSD L CCPQ+TVC+L    C SK     LL K     PV  V C D +  C +G TCC+L TG ++GCCP++ A CC D IHCCP    C+  KGTC+    Q   ++  I+P       IL     C + + C    TCC   +  + CCP P AVCCSD+ HCCP   +C L    C K 
Sbjct:   75 LTVSGTSSCCPFSKGVSCGDGYHCCPQGFHCSADGKSC------------FQMSDNPLGAVQCPGSQFECPDSATCCIMVDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHTRCVSPTGTHTLLKKFPAQKTNRAVSLP----FSVVCPDAKTQCPDDSTCCELPTGKYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCLSKNYTTDLLTK-LPGYPVKEVKC-DMEVSCPEGYTCCRLNTG-AWGCCPFAKAVCCEDHIHCCPAGFQCHTEKGTCEMGILQVPWMKKVIAPLRLPDPQILKSDTPCDDFTRCPTNNTCCKLNSGDWGCCPIPEAVCCSDNQHCCPQGFTC-LAQGYCQKG 417          

HSP 3 Score: 210.69 bits (535), Expect = 1.542e-60
Identity = 130/364 (35.71%), Postives = 177/364 (48.63%), Query Frame = 2
Query:  263 GSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSK------LKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKT----FQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKISPIL---VESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIINFHP 1315
            G Y CCP  +A+CCSD  HCCPQ+T C+L +  C S  K   T +  K+P   +  V C  +  C +G +CC +  G + CCP++ AVCC D  HCCP    C+   GTC+        +K+V+  ++L  P I      C D  + C T  TCC L+ G +GCCP   AVCCSD   CCPQ   C L  G C       + L K       P  +  + C D    C  GQTCC    G S+ CC    A CC D+ HCCP    CN+   TC+   + ++  +   L   V +++C  G  C    TCC  +   ++CCPY   VCC D  HCCP    CS     C +  + ++ +    P
Sbjct:  226 GKYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCLS--KNYTTDLLTKLPGYPVKEVKCDMEVSCPEGYTCCRLNTGAWGCCPFAKAVCCEDHIHCCPAGFQCHTEKGTCEMGILQVPWMKKVIAPLRLPDPQILKSDTPC-DDFTRCPTNNTCCKLNSGDWGCCPIPEAVCCSDNQHCCPQGFTC-LAQGYCQKGDTMVAGLEKIPARQTTPLQIGDIGC-DQHTSCPVGQTCCPSLKG-SWACCQLPHAVCCEDRQHCCPAGYTCNVKARTCEKDVDFIQPPVLLTLGPKVGNVECGEGHFCHDNQTCCKDSAGVWACCPYLKGVCCRDGRHCCPGGFHCSARGTKCLRKKIPRWDMFLRDP 583          

HSP 4 Score: 189.119 bits (479), Expect = 1.277e-52
Identity = 115/299 (38.46%), Postives = 149/299 (49.83%), Query Frame = 2
Query:  416 SSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNR-------VICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC--DHQAEALEIKISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNIL 1285
            S  L   C     C  G SC +   G  +CCP+S  V C D  HCCPQ   C+    +C             ++      +++CP     C   ATCC++ DGS+GCCP   A CC D++ CCP    C+L    C S T   +LL K F     NR       V+CPDAK QC D  TCC+LPTG  YGCCP   A CCSD +HCCPQ+TVC++ +  C   +    L  K+    V+ +KC     C +  TCC     ++ CCP+  AVCC DH HCCP    C     +C+  IL
Sbjct:   54 SHHLDGSCQTHGHCPAGYSCLLTVSGTSSCCPFSKGVSCGDGYHCCPQGFHCSADGKSC------------FQMSDNPLGAVQCPGSQFECPDSATCCIMVDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHTRCVSPTGTHTLL-KKFPAQKTNRAVSLPFSVVCPDAKTQCPDDSTCCELPTG-KYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCLSKNYTTDLLTKLPGYPVKEVKCDMEVSCPEGYTCCRLNTGAWGCCPFAKAVCCEDHIHCCPAGFQCHTEKGTCEMGIL 338          
BLAST of Granulin precursor vs. UniProt/SwissProt
Match: sp|P23785|GRN_RAT (Progranulin OS=Rattus norvegicus OX=10116 GN=Grn PE=1 SV=3)

HSP 1 Score: 228.409 bits (581), Expect = 2.426e-67
Identity = 141/371 (38.01%), Postives = 192/371 (51.75%), Query Frame = 2
Query:  251 VTTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSK------LKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCD----------HQAEALEIKISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNI-----LLKFPI 1300
            +T  G+ SCCP+S  V C D QHCCP+   C+ +  +C  +   ++  ++   P S         Q +C D ++CC+M DG++ CCP   A CC D+ HCCP    C+L    C S       LK+   +   +  A+++ S+ CPD  + C   +TCC L  G YGCCP  NA+CCSD L CCPQ+TVC+L    C SK     L+ K     PVN V C D +  C DG TCC+L TG ++GCCP++ A CC D IHCCP    C+   GTC+              +L +    IL   + C + S C    TCC  ++  + CCP P AVCC DH HCCP    C ++   C K       L K P+
Sbjct:   75 LTVSGTSSCCPFSEGVSCDDGQHCCPRGFHCSADGKSCSQISDSLLGAVQ--CPGS---------QFECPDSATCCIMIDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHTRCISPTGTHPLLKKFPAQRTNR--AVASFSVVCPDAKTQCPDDSTCCELPTGKYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCISKDYTTDLMTK-LPGYPVNEVKC-DLEVSCPDGYTCCRLNTG-AWGCCPFTKAVCCEDHIHCCPAGFQCHTETGTCELGVLQVPWMKKVTASLSLPDPQILKNDVPCDDFSSCPSNNTCCRLSSGDWGCCPMPEAVCCLDHQHCCPQGFKC-MDEGYCQKGDRMVAGLEKMPV 428          

HSP 2 Score: 221.476 bits (563), Expect = 1.266e-64
Identity = 143/374 (38.24%), Postives = 199/374 (53.21%), Query Frame = 2
Query:  251 VTTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDS------VLKEVVTKIKLKVPASSILSVVCPD-QSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQ----PNPV---NRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC---DHQAEALE---IKISPILVES-IKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIINF 1309
            +  DGS+ CCP   A CC D+ HCCP    C+L    C S      +LK+   +   +  AS   SVVCPD ++QC D S+CC +  G + CCP  +A+CCSD  HCCPQ+TVC+L    C SK  +  T +  K+P      ++C D   +C  G TCC L+ G++GCCPF+ AVCC D + CCP    C+   GTC+    +   + K       P+P    N V C D    C    TCC+L +GD +GCCP   A CC D  HCCPQ   C +++G C   D     LE   ++ + +L    I C   + C    TCCPS   S++CC  P+AVCC D  HCCP   +C++  ++C+K+     P ++ 
Sbjct:  140 IMIDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHTRCISPTGTHPLLKKFPAQRTNRAVAS--FSVVCPDAKTQCPDDSTCCELPTGKYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCISK--DYTTDLMTKLPGYPVNEVKC-DLEVSCPDGYTCCRLNTGAWGCCPFTKAVCCEDHIHCCPAGFQCHTETGTCELGVLQVPWMKKVTASLSLPDPQILKNDVPCDDFS-SCPSNNTCCRLSSGD-WGCCPMPEAVCCLDHQHCCPQGFKC-MDEGYCQKGDRMVAGLEKMPVRQTTLLQHGDIGCDQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTCEKDAGSVQPSMDL 505          

HSP 3 Score: 209.92 bits (533), Expect = 2.707e-60
Identity = 130/367 (35.42%), Postives = 179/367 (48.77%), Query Frame = 2
Query:  263 GSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCD------SKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRV-------ICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKISPIL---VESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIINFHP 1315
            G Y CCP  +A+CCSD  HCCPQ+T C+L +  C  + K+  T +  K+P   +  V C  +  C DG +CC +  G + CCP++ AVCC D  HCCP    C+   GTC+        +K+V   + L  P I    + C D SS C +  TCC LS G +GCCP   AVCC D   CCPQ   C +  G C    +K   ++   +  PV +        I  D    C  GQTCC    G S+ CC    A CC D+ HCCP    CN+   TC+  A +++  +       V +++C  G  C    +CC  +   ++CCPY   VCC D  HCCP    CS     C +    ++ I+   P
Sbjct:  225 GKYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKC--ISKDYTTDLMTKLPGYPVNEVKCDLEVSCPDGYTCCRLNTGAWGCCPFTKAVCCEDHIHCCPAGFQCHTETGTCELGVLQVPWMKKVTASLSLPDPQILKNDVPCDDFSS-CPSNNTCCRLSSGDWGCCPMPEAVCCLDHQHCCPQGFKC-MDEGYC----QKGDRMVAGLEKMPVRQTTLLQHGDIGCDQHTSCPVGQTCCPSLKG-SWACCQLPHAVCCEDRQHCCPAGYTCNVKARTCEKDAGSVQPSMDLTFGSKVGNVECGAGHFCHDNQSCCKDSQGGWACCPYVKGVCCRDGRHCCPIGFHCSAKGTKCLRKKTPRWDILLRDP 582          

HSP 4 Score: 191.43 bits (485), Expect = 1.716e-53
Identity = 117/302 (38.74%), Postives = 153/302 (50.66%), Query Frame = 2
Query:  407 VPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNR------VICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC---DHQAEALEIKISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNIL 1285
            +  S  L   C  +  C DG SC +   G  +CCP+S  V C D QHCCP+   C+    +C      ++             +++CP     C   ATCC++ DGS+GCCP   A CC D++ CCP    C+L    C S T    LL K F     NR      V+CPDAK QC D  TCC+LPTG  YGCCP   A CCSD +HCCPQ+TVC++ +  C   D+  + L  K+    V  +KC     C    TCC     ++ CCP+  AVCC DH HCCP    C   T +C+  +L
Sbjct:   51 IITSRRLDGSCQIRDHCPDGYSCLLTVSGTSSCCPFSEGVSCDDGQHCCPRGFHCSADGKSCSQISDSLLG------------AVQCPGSQFECPDSATCCIMIDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHTRCISPTGTHPLL-KKFPAQRTNRAVASFSVVCPDAKTQCPDDSTCCELPTG-KYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCISKDYTTD-LMTKLPGYPVNEVKCDLEVSCPDGYTCCRLNTGAWGCCPFTKAVCCEDHIHCCPAGFQCHTETGTCELGVL 337          

HSP 5 Score: 123.635 bits (309), Expect = 4.175e-29
Identity = 74/212 (34.91%), Postives = 105/212 (49.53%), Query Frame = 2
Query:  257 TDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILS---VVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTC-DSKTKKPSLLIKTFQPNPV 880
            + G + CCP   AVCC D QHCCPQ  +C +++G C    + V    K+ V  +++L    + C   + C  G +CC    G++ACC    AVCC D+QHCCP    CN+ A TC+     V   M L   +    ++EC  G   C    +CC  S G + CCP+   VCC D   CCP    C+     C   KT +  +L++   P P+
Sbjct:  379 SSGDWGCCPMPEAVCCLDHQHCCPQGFKC-MDEGYCQKGDRMVAGLEKMPVRQTTLLQHGDIGCDQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTCEKDAGSVQPSMDLTFGSKVG-NVECGAG-HFCHDNQSCCKDSQGGWACCPYVKGVCCRDGRHCCPIGFHCSAKGTKCLRKKTPRWDILLRDPAPRPL 587          

HSP 6 Score: 111.694 bits (278), Expect = 4.266e-25
Identity = 81/243 (33.33%), Postives = 111/243 (45.68%), Query Frame = 2
Query:  611 VVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC-DHQAEALEIKISP-------ILVESIKCPNG-SLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSC-----DKNILLKFP 1297
            ++T  +L       +   CPDG S       C L   G+  CCPFS  V C D   CCP+   C+    +C   +   SLL           V CP ++++C D  TCC +  G S+GCCP   A+CC D++HCCP    C++    C         +K  P       +   S+ CP+  + C    TCC      Y CCP PNA+CCSDH HCCP +T C L    C       +++ K P
Sbjct:   51 IITSRRLD--GSCQIRDHCPDGYS-------CLLTVSGTSSCCPFSEGVSCDDGQHCCPRGFHCSADGKSCSQISD--SLL---------GAVQCPGSQFECPDSATCCIMIDG-SWGCCPMPQASCCEDRVHCCPHGASCDLVHTRCISPTGTHPLLKKFPAQRTNRAVASFSVVCPDAKTQCPDDSTCCELPTGKYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCISKDYTTDLMTKLP 272          
BLAST of Granulin precursor vs. UniProt/SwissProt
Match: sp|P28797|GRN_CAVPO (Progranulin OS=Cavia porcellus OX=10141 GN=GRN PE=1 SV=2)

HSP 1 Score: 189.504 bits (480), Expect = 1.138e-52
Identity = 115/291 (39.52%), Postives = 154/291 (52.92%), Query Frame = 2
Query:  251 VTTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVV-CPD-QSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKE--VVTKMKLK-----------------IPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDH 1060
            +T  G+ +CCP+S A+ C D  HCCP    C+ + GTC            ++ P   +L  V CP  + +C D S+CC M DG++ CCP   A CC D+ HCCP    C+L    C + L    + TK+  +                 +PA    S+ CPD  S C    TCCLL+ G YGCCP  NA+CCSD L CCPQ+TVC+L    C S+ K  +LL K      V  V C D +  C +GQTCC+L +G  +GCCP+  A CC D +HCCP+   C+  K TC+ 
Sbjct:   75 LTAAGTAACCPFSQAMACGDGHHCCPYGFHCSTDGGTC------------IQRPDIHLLGAVQCPGGEFECPDSSTCCHMLDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHIRCVTALGSHPLTTKLPAQRTNYTGAEGTPVVSPGLLPAALPTSVICPDSRSQCPDDTTCCLLASGEYGCCPMPNAICCSDHLHCCPQDTVCDLRQSRCLSQNKAKTLLTK-LPSWTVWDVEC-DQEVSCPEGQTCCRLQSG-KWGCCPFPKAVCCEDHVHCCPEGFRCHTEKDTCEQ 350          

HSP 2 Score: 189.504 bits (480), Expect = 1.355e-52
Identity = 126/378 (33.33%), Postives = 178/378 (47.09%), Query Frame = 2
Query:  260 DGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLK-------------------VPASSILSVVCPD-QSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKT-------------------FQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDK 1276
            DGS+ CCP   A CC D+ HCCP    C+L    C + L       KL                    +PA+   SV+CPD +SQC D ++CC++A G + CCP  +A+CCSD  HCCPQ+TVC+L    C S+ K     +  K+P+ +   +EC D   +C  G TCC L  G +GCCPF  AVCC D + CCP+   C+    TC+    +     KT                     P P+   I  D    C+ G  CC+L +G+ +GCCP       S + + C     C +       +  A  + +S      + C   + C    TCCP     ++CC  P+AVCC D  HCCP   +C++  +SC+K
Sbjct:  144 DGSWGCCPMPQASCCEDRVHCCPHGASCDLVHIRCVTALGSHPLTTKLPAQRTNYTGAEGTPVVSPGLLPAALPTSVICPDSRSQCPDDTTCCLLASGEYGCCPMPNAICCSDHLHCCPQDTVCDLRQSRCLSQNK--AKTLLTKLPSWTVWDVEC-DQEVSCPEGQTCCRLQSGKWGCCPFPKAVCCEDHVHCCPEGFRCHTEKDTCEQGLLQVPWAQKTPAQPSRPSQPSPPGPPGPPSPPGPLRSEISCDEVVSCAPGNICCRLASGE-WGCCP-------SSEGYLCMAGERCQVGDRLAPEKMAAHLMSLS--QTTDVGCDQHASCPVGQTCCPKLGGGWACCQLPHAVCCEDGQHCCPAGYTCNVKARSCEK 508          

HSP 3 Score: 189.504 bits (480), Expect = 1.547e-52
Identity = 119/331 (35.95%), Postives = 162/331 (48.94%), Query Frame = 2
Query:  395 IKLKVPA-SSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNL-SIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKT---------FQPNPV-----------NRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC--DHQAEALEIKISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIINFHP 1315
            + L+  A S  L   C   + C  G SC + A G  ACCP+S A+ C D  HCCP    C+   GTC            ++ P I  L +++CP G   C   +TCC + DGS+GCCP   A CC D++ CCP    C+L    C +      L  K           +  PV             VICPD++ QC D  TCC L +G+ YGCCP   A CCSD +HCCPQ+TVC++ +  C   ++A+ L  K+    V  ++C     C +  TCC   +  + CCP+P AVCC DH HCCP    C     +C++  LL+ P     P
Sbjct:   46 VDLRTTALSGYLGRPCQSPANCPIGHSCVLTAAGTAACCPFSQAMACGDGHHCCPYGFHCSTDGGTC------------IQRPDIHLLGAVQCPGGEFECPDSSTCCHMLDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHIRCVTALGSHPLTTKLPAQRTNYTGAEGTPVVSPGLLPAALPTSVICPDSRSQCPDDTTCCLLASGE-YGCCPMPNAICCSDHLHCCPQDTVCDLRQSRCLSQNKAKTLLTKLPSWTVWDVECDQEVSCPEGQTCCRLQSGKWGCCPFPKAVCCEDHVHCCPEGFRCHTEKDTCEQG-LLQVPWAQKTP 362          

HSP 4 Score: 169.474 bits (428), Expect = 3.170e-45
Identity = 116/374 (31.02%), Postives = 160/374 (42.78%), Query Frame = 2
Query:  251 VTTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAIS-------------------NLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKISPILVES------IKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSC-SLNTKSCDKNILLKF 1294
            +   G Y CCP  +A+CCSD  HCCPQ+T C+L +  C S  K     +  K+P+ ++  V C  +  C +G +CC +  G + CCP+  AVCC D  HCCP+   C+    TC+  L +V    K                             I C D   +C  G  CC L+ G +GCCP S    C     C           G   +  K  + L+   Q   V      D    C  GQTCC    G  + CC    A CC D  HCCP    CN+   +C+  A+   +  +P+ V S      + C +   C  + TCC  +   ++CCP+   VCC D  HCCP    C S  T+   K  LL +
Sbjct:  237 LLASGEYGCCPMPNAICCSDHLHCCPQDTVCDLRQSRCLSQNK--AKTLLTKLPSWTVWDVECDQEVSCPEGQTCCRLQSGKWGCCPFPKAVCCEDHVHCCPEGFRCHTEKDTCEQGLLQVPWAQKTPAQPSRPSQPSPPGPPGPPSPPGPLRSEISC-DEVVSCAPGNICCRLASGEWGCCPSSEGYLCMAGERC---------QVGDRLAPEKMAAHLMSLSQTTDVGC----DQHASCPVGQTCCP-KLGGGWACCQLPHAVCCEDGQHCCPAGYTCNVKARSCEKAADGAHLA-APLAVGSTGGVMDVACGDRHFCHDEQTCCRDSRGGWACCPFHQGVCCKDQRHCCPAGFHCESQGTRCVHKKSLLHW 592          

HSP 5 Score: 87.4261 bits (215), Expect = 3.619e-17
Identity = 62/207 (29.95%), Postives = 80/207 (38.65%), Query Frame = 2
Query:  263 GSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISN-LSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPV 880
            G + CCP S    C   + C              D +  E +    + +  S    V C   + C  G +CC    G +ACC    AVCC D QHCCP    CN+ A +C+           L + +    + + C D    C    TCC  S G + CCPF   VCC D+  CCP    C      C     K SLL     P P 
Sbjct:  410 GEWGCCPSSEGYLCMAGERC-----------QVGDRLAPEKMAAHLMSL--SQTTDVGCDQHASCPVGQTCCPKLGGGWACCQLPHAVCCEDGQHCCPAGYTCNVKARSCEKAADGAHLAAPLAVGSTGGVMDVACGD-RHFCHDEQTCCRDSRGGWACCPFHQGVCCKDQRHCCPAGFHCESQGTRC---VHKKSLLHWDSLPRPA 599          
BLAST of Granulin precursor vs. UniProt/SwissProt
Match: sp|Q54QR7|GRN_DICDI (Granulin OS=Dictyostelium discoideum OX=44689 GN=grn PE=3 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 5.189e-11
Identity = 31/65 (47.69%), Postives = 39/65 (60.00%), Query Frame = 2
Query: 1106 SIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPI 1300
            S+KCP+GSLC    TCC +++ SY+CCP PNA CCSD  HCCP   +C      C     L+F  
Sbjct:   64 SVKCPDGSLCPNSNTCCSASDGSYACCPTPNAQCCSDKQHCCPYQFTCGNGGNICKPQQGLRFSF 128          

HSP 2 Score: 57.7658 bits (138), Expect = 6.089e-9
Identity = 28/55 (50.91%), Postives = 35/55 (63.64%), Query Frame = 2
Query:  428 SVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTC 592
            SV CPD S C + ++CC  +DG++ACCP  +A CCSDKQHCCP    C      C
Sbjct:   64 SVKCPDGSLCPNSNTCCSASDGSYACCPTPNAQCCSDKQHCCPYQFTCGNGGNIC 118          

HSP 3 Score: 55.0694 bits (131), Expect = 5.016e-8
Identity = 33/70 (47.14%), Postives = 38/70 (54.29%), Query Frame = 2
Query:  617 TKMKLKIPAISNL-SIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTC 823
            TK  L++    +  S++CPDGS  C    TCC  SDGSY CCP  NA CCSDK  CCP    C      C
Sbjct:   50 TKKSLELTETQDFGSVKCPDGS-LCPNSNTCCSASDGSYACCPTPNAQCCSDKQHCCPYQFTCGNGGNIC 118          
BLAST of Granulin precursor vs. TrEMBL
Match: V4ARK5 (Uncharacterized protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_146967 PE=4 SV=1)

HSP 1 Score: 268.855 bits (686), Expect = 1.460e-82
Identity = 157/352 (44.60%), Postives = 202/352 (57.39%), Query Frame = 2
Query:  263 GSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSV-LKEVVTKIKLKVPASSILSVVCPDQ-SQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIE---CPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIK--TFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQ-----AEALEIKISPILVESIKCPN-GSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKN 1279
            G Y CCP  +AVCCSD+ HCCP  T C+   G C+      V+   K    +  + +VVCPDQ SQC DGS+CC ++ G + CCP  +AVCCSD+ HCCP  T C+  AG C+   ++  + M  K  +  +L +E   CPD  S C  G+TCC LS G YGCCP  NAVCCSD++ CCP  T C+  AG C+ +     +  K  + Q   V  V+CPD + QC DG TCCKL TG  YGCCP   A CCSD+IHCCP  T C+   G C+ Q       + +     + VE++ CP+  S C    TCC  +   Y CCP PNAVCCSD  HCCP+ T+C      CD+ 
Sbjct:   13 GQYGCCPLPNAVCCSDQIHCCPSGTTCDTGAGKCNRQDGTSVMWSKKTSSQSLKVENVVCPDQQSQCPDGSTCCKLSTGQYGCCPLPNAVCCSDQIHCCPSGTTCDTGAGKCN--RQDGTSVMWSKKTSSQSLKVENVVCPDQQSQCPDGSTCCKLSTGQYGCCPLPNAVCCSDQIHCCPSGTTCDTGAGKCNRQDGTSVMWSKKTSSQSLKVENVVCPDQQSQCPDGSTCCKLSTGQ-YGCCPLPNAVCCSDQIHCCPSGTTCDTGAGKCNRQDGTSVMWSKKTSSQSLKVENVVCPDQQSQCPDGSTCCKLSTGQYGCCPLPNAVCCSDQIHCCPSGTTCDTGAGKCDRQ 361          

HSP 2 Score: 226.868 bits (577), Expect = 2.006e-66
Identity = 131/291 (45.02%), Postives = 168/291 (57.73%), Query Frame = 2
Query:  263 GSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSV-LKEVVTKIKLKVPASSILSVVCPDQ-SQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIE---CPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIK--TFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKISPILVESIK 1114
            G Y CCP  +AVCCSD+ HCCP  T C+   G C+      V+   K    +  + +VVCPDQ SQC DGS+CC ++ G + CCP  +AVCCSD+ HCCP  T C+  AG C+   ++  + M  K  +  +L +E   CPD  S C  G+TCC LS G YGCCP  NAVCCSD++ CCP  T C+  AG C+ +     +  K  + Q   V  V+CPD + QC DG TCCKL TG  YGCCP   A CCSD+IHCCP  T C+   G CD Q     +       +S+K
Sbjct:   91 GQYGCCPLPNAVCCSDQIHCCPSGTTCDTGAGKCNRQDGTSVMWSKKTSSQSLKVENVVCPDQQSQCPDGSTCCKLSTGQYGCCPLPNAVCCSDQIHCCPSGTTCDTGAGKCN--RQDGTSVMWSKKTSSQSLKVENVVCPDQQSQCPDGSTCCKLSTGQYGCCPLPNAVCCSDQIHCCPSGTTCDTGAGKCNRQDGTSVMWSKKTSSQSLKVENVVCPDQQSQCPDGSTCCKLSTGQ-YGCCPLPNAVCCSDQIHCCPSGTTCDTGAGKCDRQDGTSVMWSKKTSSQSLK 378          

HSP 3 Score: 222.631 bits (566), Expect = 1.154e-64
Identity = 127/286 (44.41%), Postives = 165/286 (57.69%), Query Frame = 2
Query:  455 CDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIE---CPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIK--TFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQ-----AEALEIKISPILVESIKCPN-GSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKN 1279
            C DGS+CC ++ G + CCP  +AVCCSD+ HCCP  T C+  AG C+   ++  + M  K  +  +L +E   CPD  S C  G+TCC LS G YGCCP  NAVCCSD++ CCP  T C+  AG C+ +     +  K  + Q   V  V+CPD + QC DG TCCKL TG  YGCCP   A CCSD+IHCCP  T C+   G C+ Q       + +     + VE++ CP+  S C    TCC  +   Y CCP PNAVCCSD  HCCP+ T+C      C++ 
Sbjct:    1 CPDGSTCCKLSTGQYGCCPLPNAVCCSDQIHCCPSGTTCDTGAGKCN--RQDGTSVMWSKKTSSQSLKVENVVCPDQQSQCPDGSTCCKLSTGQYGCCPLPNAVCCSDQIHCCPSGTTCDTGAGKCNRQDGTSVMWSKKTSSQSLKVENVVCPDQQSQCPDGSTCCKLSTGQ-YGCCPLPNAVCCSDQIHCCPSGTTCDTGAGKCNRQDGTSVMWSKKTSSQSLKVENVVCPDQQSQCPDGSTCCKLSTGQYGCCPLPNAVCCSDQIHCCPSGTTCDTGAGKCNRQ 283          
BLAST of Granulin precursor vs. TrEMBL
Match: K1PAM6 (Uncharacterized protein OS=Crassostrea gigas OX=29159 GN=CGI_10005248 PE=4 SV=1)

HSP 1 Score: 282.337 bits (721), Expect = 2.791e-82
Identity = 161/386 (41.71%), Postives = 223/386 (57.77%), Query Frame = 2
Query:  263 GSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTC---DSVLKEVVTKIKLKVPASSILSVVCPD-QSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPV----------NRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC----------------DHQAEALEIKISPILV----ESIKCPNG-SLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIINFHP 1315
            G + CCP   AVCCSD +HCCP++T+C +++G C   DS+  +   K+    PA    +VVCPD QSQC DG +CC +A G + CCP   AVCCSD +HCCP+NT C++S+G C  +  E+      K+PA+ + ++ CPDG S CKT  TCC L+ G+YGCCP   AVCCSD   CCP+NT C++ +G C   T+   L++  F+  P+          + V+CPD   +C DGQTCC L +G  YGCCP   A CCSD +HCCPQ T C+I +  C                  Q +  E     +L+    E+++CP+G S C    TCC +A  +Y CCP P AVCCSD  HCCP  T+C +++  C++        ++  P
Sbjct:  393 GQWGCCPIPKAVCCSDGKHCCPESTKCEVSQGKCIRADSLSMDWFEKL----PALRTRNVVCPDGQSQCKDGQTCCKLATGQYGCCPIPKAVCCSDGKHCCPENTQCDVSSGKC-KRGDELSMDWFAKLPALRSKNVVCPDGQSECKTSQTCCKLASGNYGCCPIPKAVCCSDMKHCCPENTKCDVSSGKC---TRGDGLIVDWFEKMPLAVRSRGQGEASSVMCPDGASECEDGQTCCLLASG-KYGCCPIQDAVCCSDHVHCCPQGTKCDIQEKKCIGKPAANLGVISMDMIQIQGKGQEKSHPELLLKLPTENVECPDGQSECKTGQTCCKTAAGNYGCCPLPKAVCCSDMKHCCPEGTTCDVSSGKCNRGNTYVMDWMDKQP 769          

HSP 2 Score: 279.641 bits (714), Expect = 2.555e-81
Identity = 150/361 (41.55%), Postives = 212/361 (58.73%), Query Frame = 2
Query:  263 GSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPD-QSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNP----VNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEI----KISPILVESIKCPNG-SLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIINFHP 1315
            G+Y CCP   AVCCSD +HCCP+ T C+++ G C+     V+  +  +       SV+CPD Q +C DG +CC +A G + CCP   AVCCSD +HCCP+NT C +S G C     E++  +K +   + + ++ CPDG S CK+G TCC L+ G+YGCCP   AVCCSD   CCP+ T C++ +G C+  +   + ++      P       V+CPD +++C DGQTCCKL +G  +GCCP   A CCSD  HCCP++T C +++G C  +A++L +    K+  +   ++ CP+G S C    TCC  A   Y CCP P AVCCSD  HCCP NT C +++  C +   L        P
Sbjct:  162 GNYGCCPIPKAVCCSDMKHCCPEGTTCDVSSGKCNRGSTYVMDWMDKQPAVVRAGSVMCPDGQHECKDGQTCCKLASGQWGCCPIPKAVCCSDGKHCCPENTKCEVSQGKCMRGTGEMLDWLKKEPAMLRSKNVVCPDGQSECKSGQTCCKLASGNYGCCPIPKAVCCSDMKHCCPEGTTCDVSSGKCNRGS---TYVMDWMDKQPAVVRAGSVMCPDGQHECKDGQTCCKLASG-QWGCCPIPKAVCCSDGKHCCPESTKCEVSQGKC-IRADSLSMDWFEKLPALRTRNVVCPDGQSQCKDGQTCCKLATGQYGCCPIPKAVCCSDGKHCCPENTQCDVSSGKCKRGDELSMDWFAKLP 517          

HSP 3 Score: 271.166 bits (692), Expect = 3.219e-78
Identity = 145/361 (40.17%), Postives = 205/361 (56.79%), Query Frame = 2
Query:  263 GSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPD-QSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPV----NRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQA----EALEIKISPILVESIKCPNGS-LCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIINFHP 1315
            G + CCP   AVCC+D +HCCP+NT+C +++G C     E++   + +       +VVCPD QS+C  G +CC +A GN+ CCP   AVCCSD +HCCP+ T C++S+G C+     V+  M  +   +   S+ CPDG   CK G TCC L+ G +GCCP   AVCCSD   CCP+NT C +  G C   T +   ++   +  P       V+CPD + +C  GQTCCKL +G+ YGCCP   A CCSD  HCCP+ T C+++ G C+  +    + ++ + + +   S+ CP+G   C    TCC  A+  + CCP P AVCCSD  HCCP +T C ++   C +   L        P
Sbjct:   85 GQWGCCPIPKAVCCNDGKHCCPENTKCEVSQGKCMRGTGEMLDWFEKEPALVRSENVVCPDGQSECKSGQTCCKLASGNYGCCPIPKAVCCSDMKHCCPEGTTCDVSSGKCNRGSTYVMDWMDKQPAVVRAGSVMCPDGQHECKDGQTCCKLASGQWGCCPIPKAVCCSDGKHCCPENTKCEVSQGKCMRGTGE---MLDWLKKEPAMLRSKNVVCPDGQSECKSGQTCCKLASGN-YGCCPIPKAVCCSDMKHCCPEGTTCDVSSGKCNRGSTYVMDWMDKQPAVVRAGSVMCPDGQHECKDGQTCCKLASGQWGCCPIPKAVCCSDGKHCCPESTKCEVSQGKCIRADSLSMDWFEKLP 441          

HSP 4 Score: 270.011 bits (689), Expect = 8.878e-78
Identity = 156/384 (40.62%), Postives = 210/384 (54.69%), Query Frame = 2
Query:  263 GSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPD-QSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTC---DSKLKEVVTKMKLKIPAISNL---SIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSK---------------------TKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCD----HQAEALEIKISPILVESIKCPNGS-LCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIINFHP 1315
            G Y CCP   AVCCSD +HCCP+NT+C+++ G C     E+      K+PA    +VVCPD QS+C    +CC +A GN+ CCP   AVCCSD +HCCP+NT C++S+G C   D  + +   KM L + +       S+ CPDG+S C+ G TCCLL+ G YGCCP  +AVCCSD + CCPQ T C++    C  K                        P LL+K     P   V CPD + +C  GQTCCK   G+ YGCCP   A CCSD  HCCP+ T C+++ G C+    +  + ++ + + +   S+ CP+G   C    TCC  A+  + CCP P AVCC+D  HCCP NT C ++   C +   L        P
Sbjct:  469 GQYGCCPIPKAVCCSDGKHCCPENTQCDVSSGKCKRG-DELSMDWFAKLPALRSKNVVCPDGQSECKTSQTCCKLASGNYGCCPIPKAVCCSDMKHCCPENTKCDVSSGKCTRGDGLIVDWFEKMPLAVRSRGQGEASSVMCPDGASECEDGQTCCLLASGKYGCCPIQDAVCCSDHVHCCPQGTKCDIQEKKCIGKPAANLGVISMDMIQIQGKGQEKSHPELLLKL----PTENVECPDGQSECKTGQTCCKTAAGN-YGCCPLPKAVCCSDMKHCCPEGTTCDVSSGKCNRGNTYVMDWMDKQPAVVRAGSVMCPDGQHECKDGQTCCKLASGQWGCCPIPKAVCCNDGKHCCPENTKCEVSQGKCTRGTGLVLDWFEKLP 846          

HSP 5 Score: 265.774 bits (678), Expect = 3.001e-76
Identity = 144/351 (41.03%), Postives = 207/351 (58.97%), Query Frame = 2
Query:  293 AVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPD-QSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNP----VNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC-DHQAEALE-IKISPILVES--IKCPNG-SLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIINFHP 1315
            AVCCSD +HCCP+ T C+++ G C      V+  +  +       SV+CPD Q +C DG +CC +A G + CCP   AVCC+D +HCCP+NT C +S G C     E++   + +   + + ++ CPDG S CK+G TCC L+ G+YGCCP   AVCCSD   CCP+ T C++ +G C+  +   + ++      P       V+CPD +++C DGQTCCKL +G  +GCCP   A CCSD  HCCP+NT C +++G C     E L+ +K  P ++ S  + CP+G S C    TCC  A+ +Y CCP P AVCCSD  HCCP  T+C +++  C++        ++  P
Sbjct:   18 AVCCSDMKHCCPEGTTCDVSSGKCKRGNTYVMDWMDKQPAVVRAGSVMCPDGQHECKDGQTCCKLASGQWGCCPIPKAVCCNDGKHCCPENTKCEVSQGKCMRGTGEMLDWFEKEPALVRSENVVCPDGQSECKSGQTCCKLASGNYGCCPIPKAVCCSDMKHCCPEGTTCDVSSGKCNRGS---TYVMDWMDKQPAVVRAGSVMCPDGQHECKDGQTCCKLASG-QWGCCPIPKAVCCSDGKHCCPENTKCEVSQGKCMRGTGEMLDWLKKEPAMLRSKNVVCPDGQSECKSGQTCCKLASGNYGCCPIPKAVCCSDMKHCCPEGTTCDVSSGKCNRGSTYVMDWMDKQP 364          

HSP 6 Score: 247.669 bits (631), Expect = 1.432e-69
Identity = 148/370 (40.00%), Postives = 204/370 (55.14%), Query Frame = 2
Query:  263 GSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTC---DSVLKEVVTKIKLKVPA---SSILSVVCPD-QSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSK-----------LKEVVTKMKLK-----IPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPV----NRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQA-------EALEIKISPILVESIK------CPNGSL-CGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSC 1249
            G+Y CCP   AVCCSD +HCCP+NT+C+++ G C   D ++ +   K+ L V +       SV+CPD  S+C+DG +CC++A G + CCP   AVCCSD  HCCPQ T C++    C  K           + ++  K + K     +  +   ++ECPDG S CKTG TCC  + G+YGCCP   AVCCSD   CCP+ T C++ +G C+   +  + ++      P       V+CPD +++C DGQTCCKL +G  +GCCP   A CC+D  HCCP+NT C +++G C           E L     P LVE IK      CP+    C  K TCC +    + CC Y NAVCC   ++CCP    C
Sbjct:  545 GNYGCCPIPKAVCCSDMKHCCPENTKCDVSSGKCTRGDGLIVDWFEKMPLAVRSRGQGEASSVMCPDGASECEDGQTCCLLASGKYGCCPIQDAVCCSDHVHCCPQGTKCDIQEKKCIGKPAANLGVISMDMIQIQGKGQEKSHPELLLKLPTENVECPDGQSECKTGQTCCKTAAGNYGCCPLPKAVCCSDMKHCCPEGTTCDVSSGKCN---RGNTYVMDWMDKQPAVVRAGSVMCPDGQHECKDGQTCCKLASG-QWGCCPIPKAVCCNDGKHCCPENTKCEVSQGKCTRGTGLVLDWFEKLPALKRPGLVEMIKKDNTIVCPDQKTSCPDKNTCCKNKEGKFGCCAYNNAVCCKSGTYCCPKGYIC 910          

HSP 7 Score: 193.741 bits (491), Expect = 3.222e-50
Identity = 113/292 (38.70%), Postives = 153/292 (52.40%), Query Frame = 2
Query:  251 VTTDGSYSCCPYSSAVCCSDKQHCCPQNTECNL-----------NKGTCDSVLKEVVTKIKLKVPASSIL-----SVVCPD-QSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPV-------------NRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCN 1036
            +   G Y CCP   AVCCSD  HCCPQ T+C++           N G     + ++  K + K     +L     +V CPD QS+C  G +CC  A GN+ CCP   AVCCSD +HCCP+ T C++S+G C+     V+  M  +   +   S+ CPDG   CK G TCC L+ G +GCCP   AVCC+D   CCP+NT C +  G C   T+   L++  F+  P              N ++CPD K  C D  TCCK   G  +GCC Y+ A CC    +CCP+  +C+
Sbjct:  624 LLASGKYGCCPIQDAVCCSDHVHCCPQGTKCDIQEKKCIGKPAANLGVISMDMIQIQGKGQEKSHPELLLKLPTENVECPDGQSECKTGQTCCKTAAGNYGCCPLPKAVCCSDMKHCCPEGTTCDVSSGKCNRGNTYVMDWMDKQPAVVRAGSVMCPDGQHECKDGQTCCKLASGQWGCCPIPKAVCCNDGKHCCPENTKCEVSQGKC---TRGTGLVLDWFEKLPALKRPGLVEMIKKDNTIVCPDQKTSCPDKNTCCKNKEG-KFGCCAYNNAVCCKSGTYCCPKGYICD 911          

HSP 8 Score: 145.976 bits (367), Expect = 7.190e-34
Identity = 93/285 (32.63%), Postives = 131/285 (45.96%), Query Frame = 2
Query:  632 KIPAI---SNLSIECPDGSS---------------------------------------------TCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPV----NRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQA----EALEIKISPILVESIKCPNGS-LCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIINFHP 1315
            K PA+    N+++ C D                                                 CK G TCC L+ G +GCCP   AVCC+D   CCP+NT C +  G C   T +   ++  F+  P       V+CPD + +C  GQTCCKL +G+ YGCCP   A CCSD  HCCP+ T C+++ G C+  +    + ++ + + +   S+ CP+G   C    TCC  A+  + CCP P AVCCSD  HCCP NT C ++   C +        +   P
Sbjct:    7 KEPALVRSENVAVCCSDMKHCCPEGTTCDVSSGKCKRGNTYVMDWMDKQPAVVRAGSVMCPDGQHECKDGQTCCKLASGQWGCCPIPKAVCCNDGKHCCPENTKCEVSQGKCMRGTGE---MLDWFEKEPALVRSENVVCPDGQSECKSGQTCCKLASGN-YGCCPIPKAVCCSDMKHCCPEGTTCDVSSGKCNRGSTYVMDWMDKQPAVVRAGSVMCPDGQHECKDGQTCCKLASGQWGCCPIPKAVCCSDGKHCCPENTKCEVSQGKCMRGTGEMLDWLKKEP 287          

HSP 9 Score: 143.665 bits (361), Expect = 4.017e-33
Identity = 83/223 (37.22%), Postives = 117/223 (52.47%), Query Frame = 2
Query:  254 TTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPD-QSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMK----LKIPAISNL-----SIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVI 892
            T  G+Y CCP   AVCCSD +HCCP+ T C+++ G C+     V+  +  +       SV+CPD Q +C DG +CC +A G + CCP   AVCC+D +HCCP+NT C +S G C      V+   +    LK P +  +     +I CPD  ++C    TCC   +G +GCC ++NAVCC     CCP+  +C+     C     K +        N  NR I
Sbjct:  718 TAAGNYGCCPLPKAVCCSDMKHCCPEGTTCDVSSGKCNRGNTYVMDWMDKQPAVVRAGSVMCPDGQHECKDGQTCCKLASGQWGCCPIPKAVCCNDGKHCCPENTKCEVSQGKCTRGTGLVLDWFEKLPALKRPGLVEMIKKDNTIVCPDQKTSCPDKNTCCKNKEGKFGCCAYNNAVCCKSGTYCCPKGYICDTLPEICRMPEAKEAW------KNTANRFI 934          
BLAST of Granulin precursor vs. TrEMBL
Match: A0A087Y631 (Granulin b OS=Poecilia formosa OX=48698 PE=4 SV=2)

HSP 1 Score: 274.633 bits (701), Expect = 6.432e-81
Identity = 160/376 (42.55%), Postives = 212/376 (56.38%), Query Frame = 2
Query:  260 DGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDS-------VLKEVVTKIKLKVPASSILSVVCPD-QSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTF--------QPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIK------ISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCD--KNILLKFPIINFHP 1315
            D S+ CCP   AVCC DK+HCCP  ++C+L    C S       +L+++  K     P S   SV+CPD +S C DG +CCV A G + CCPY  A CC+D  HCCP NT C+L+ G C S   EV   +  +IPA S   +ECPD  + C  G TCC +++GS+GCCP  +AVCCSD + CCP  T C+L   TC S      L IK            + V+ V C +A   C+DG TCCK PTG  + CCP   A CC D +HCCP  TVCN+   TCDH +    +       + P+L E+ KC   + C    TCC +A+ +++CCP P AVCC DH HCCP+ T C+L  ++CD    + L  P++   P
Sbjct:  123 DSSWGCCPLPKAVCCEDKRHCCPGGSKCDLVHLKCVSPSLESFPMLEKLPAKRSKDRPVSVAGSVICPDGESSCPDGYTCCVQASGQYGCCPYKEATCCNDHLHCCPSNTTCDLTHGVCKSGGNEV--PLTRRIPAASR-DVECPDKKTVCPDGTTCCQMTNGSFGCCPMPDAVCCSDHIHCCPSGTKCDLKHSTCVSFQDDAPLPIKKLPTMTNQGPAQSKVHAVPC-NASVACADGNTCCKSPTG-KWACCPLPQAVCCKDHLHCCPSGTVCNLAASTCDHPSGVALMPLLSNTPVFPLLTENDKCDESTSCPGNATCCKTASGAWACCPLPKAVCCDDHVHCCPHGTVCNLEAETCDDSSGVFLPLPLLTKVP 493          

HSP 2 Score: 242.662 bits (618), Expect = 7.550e-69
Identity = 154/383 (40.21%), Postives = 204/383 (53.26%), Query Frame = 2
Query:  257 TDGSYSCCPYSSAVCCSDKQHCCPQNTECNL------NKGTCDSVLKEVVTKIKLKVP--ASSILSVVCPD-QSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDS-------KLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC-DHQAEA-LEIKISPIL---------VESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDK-NILLKFPIINFHP*F 1321
            T G YSCCP   A CCSD  HCC Q T C+L      NK     ++K + +K +       S + +V+CPD +S+C D ++CC + D ++ CCP   AVCC DK+HCCP  + C+L    C S        L+++  K     P     S+ CPDG S+C  G TCC+ + G YGCCP+  A CC+D L CCP NT C+L  G C S   +  L  +   P     V CPD K  C DG TCC++  G S+GCCP   A CCSD IHCCP  T C++   TC   Q +A L IK  P +         V ++ C     C    TCC S    ++CCP P AVCC DH HCCP+ T C+L   +CD  + +   P+++  P F
Sbjct:   37 TQGGYSCCPLPHAECCSDHLHCCYQGTVCDLVHQKCINKTVSLPMVKRLPSKQRSSASQLVSGVKAVMCPDHESECPDDTTCCQLYDSSWGCCPLPKAVCCEDKRHCCPGGSKCDLVHLKCVSPSLESFPMLEKLPAKRSKDRPVSVAGSVICPDGESSCPDGYTCCVQASGQYGCCPYKEATCCNDHLHCCPSNTTCDLTHGVCKSGGNEVPLTRRI--PAASRDVECPDKKTVCPDGTTCCQMTNG-SFGCCPMPDAVCCSDHIHCCPSGTKCDLKHSTCVSFQDDAPLPIKKLPTMTNQGPAQSKVHAVPCNASVACADGNTCCKSPTGKWACCPLPQAVCCKDHLHCCPSGTVCNLAASTCDHPSGVALMPLLSNTPVF 416          

HSP 3 Score: 226.868 bits (577), Expect = 5.340e-63
Identity = 144/379 (37.99%), Postives = 192/379 (50.66%), Query Frame = 2
Query:  257 TDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPA--------SSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSI--ECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSK----------TKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDH------QAEALEIKISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDK---NILLKFPIIN 1306
            T+GS+ CCP   AVCCSD  HCCP  T+C+L   TC S   +    IK K+P         S + +V C     C DG++CC    G +ACCP   AVCC D  HCCP  TVCNL+A TCD      +  +    P    L+   +C D S++C   ATCC  + G++ CCP   AVCC D + CCP  TVCNL A TCD            TK P+L  +  Q     +++C D +  C    TCC +     +GCCP   A CC D IHCCP    C+ ++ +C         +  L     P  +  +KC N S C    TCC   +  + CCP   AVCC DH HCCP   +C++ TK+C+K   N+ L   +++
Sbjct:  280 TNGSFGCCPMPDAVCCSDHIHCCPSGTKCDLKHSTCVSFQDDAPLPIK-KLPTMTNQGPAQSKVHAVPCNASVACADGNTCCKSPTGKWACCPLPQAVCCKDHLHCCPSGTVCNLAASTCDHPSGVALMPLLSNTPVFPLLTENDKC-DESTSCPGNATCCKTASGAWACCPLPKAVCCDDHVHCCPHGTVCNLEAETCDDSSGVFLPLPLLTKVPALTSRVQQ----EKIMC-DRQTSCPKDATCCFMERTHKWGCCPLPEAVCCKDGIHCCPSGHTCDPHRSSCSSGPRRIPWSTKLGALAEPSALTDVKCDNTSSCATGTTCCKLPSGEWGCCPLLKAVCCPDHEHCCPQGYTCNMQTKTCEKKGYNLQLTTALLS 651          

HSP 4 Score: 219.55 bits (558), Expect = 2.231e-60
Identity = 145/363 (39.94%), Postives = 185/363 (50.96%), Query Frame = 2
Query:  251 VTTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPD-QSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNL--------SIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICP----DAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEA-----LEIKI----SPILVESIKCPNGSLCGQKGTCC-PSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSC 1270
            V   G Y CCPY  A CC+D  HCCP NT C+L  G C S   EV   +  ++PA+S   V CPD ++ C DG++CC M +G+F CCP   AVCCSD  HCCP  T C+L   TC S   +    +K K+P ++N         ++ C + S  C  G TCC    G + CCP   AVCC D L CCP  TVCNL A TCD  +     L+      PV  ++      D    C    TCCK  +G ++ CCP   A CC D +HCCP  TVCN+   TCD  +       L  K+    S +  E I C   + C +  TCC       + CCP P AVCC D  HCCP+  +C  +  SC
Sbjct:  204 VQASGQYGCCPYKEATCCNDHLHCCPSNTTCDLTHGVCKSGGNEV--PLTRRIPAAS-RDVECPDKKTVCPDGTTCCQMTNGSFGCCPMPDAVCCSDHIHCCPSGTKCDLKHSTCVSFQDDAPLPIK-KLPTMTNQGPAQSKVHAVPC-NASVACADGNTCCKSPTGKWACCPLPQAVCCKDHLHCCPSGTVCNLAASTCDHPSG--VALMPLLSNTPVFPLLTENDKCDESTSCPGNATCCKTASG-AWACCPLPKAVCCDDHVHCCPHGTVCNLEAETCDDSSGVFLPLPLLTKVPALTSRVQQEKIMCDRQTSCPKDATCCFMERTHKWGCCPLPEAVCCKDGIHCCPSGHTCDPHRSSC 558          

HSP 5 Score: 207.994 bits (528), Expect = 4.621e-56
Identity = 134/369 (36.31%), Postives = 184/369 (49.86%), Query Frame = 2
Query:  263 GSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSV--VCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVV-TKMKLKIPAISNL----SIECPDGSSTCKTGATCCLLSD-GSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKK---PSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKISPI-------LVESIKCPNGS-------LCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKF 1294
            G ++CCP   AVCC D  HCCP  T CNL   TCD      +  +    P   +L+    C + + C   ++CC  A G +ACCP   AVCC D  HCCP  TVCNL A TCD      +   +  K+PA+++      I C D  ++C   ATCC +     +GCCP   AVCC D + CCP    C+    +C S  ++    + L    +P+ +  V C D    C+ G TCCKLP+G+ +GCCP   A CC D  HCCPQ   CN+   TC+ +   L++  + +       L E+++  N         LC    TCC  +   +SCCP+  A CC+D  HCCP   SC L  +SC     L +
Sbjct:  365 GKWACCPLPQAVCCKDHLHCCPSGTVCNLAASTCDHPSGVALMPLLSNTPVFPLLTENDKCDESTSCPGNATCCKTASGAWACCPLPKAVCCDDHVHCCPHGTVCNLEAETCDDSSGVFLPLPLLTKVPALTSRVQQEKIMC-DRQTSCPKDATCCFMERTHKWGCCPLPEAVCCKDGIHCCPSGHTCDPHRSSCSSGPRRIPWSTKLGALAEPSALTDVKC-DNTSSCATGTTCCKLPSGE-WGCCPLLKAVCCPDHEHCCPQGYTCNMQTKTCEKKGYNLQLTTALLSKVEQSALREAVEETNVQCDSTGVFLCPANSTCCKISATEWSCCPFAKAECCADMKHCCPVGYSCDLKARSCTPQTRLTW 730          

HSP 6 Score: 199.519 bits (506), Expect = 5.690e-53
Identity = 120/299 (40.13%), Postives = 157/299 (52.51%), Query Frame = 2
Query:  428 SVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLS--------IECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKT--------KKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEI-KISPILVESIKCPN-GSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSC 1270
            +++CP+ S C D  +CC    G ++CCP   A CCSD  HCC Q TVC+L    C +K   +    +L     S+ S        + CPD  S C    TCC L D S+GCCP   AVCC DK  CCP  + C+L    C S +        K P+   K    +    VICPD +  C DG TCC   +G  YGCCPY  ATCC+D +HCCP NT C++  G C      + + +  P     ++CP+  ++C    TCC   N S+ CCP P+AVCCSDH HCCP+ T C L   +C
Sbjct:   18 ALICPNGSMCGDEDTCCKNTQGGYSCCPLPHAECCSDHLHCCYQGTVCDLVHQKCINKTVSLPMVKRLPSKQRSSASQLVSGVKAVMCPDHESECPDDTTCCQLYDSSWGCCPLPKAVCCEDKRHCCPGGSKCDLVHLKCVSPSLESFPMLEKLPAKRSKDRPVSVAGSVICPDGESSCPDGYTCCVQASGQ-YGCCPYKEATCCNDHLHCCPSNTTCDLTHGVCKSGGNEVPLTRRIPAASRDVECPDKKTVCPDGTTCCQMTNGSFGCCPMPDAVCCSDHIHCCPSGTKCDLKHSTC 315          

HSP 7 Score: 153.68 bits (387), Expect = 1.224e-36
Identity = 97/290 (33.45%), Postives = 138/290 (47.59%), Query Frame = 2
Query:  254 TTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDS-----VLKEVVTKIKLKVPASSILSVVCPDQSQCDDGSSCCVMADGN-FACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNL--SIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSL---LIKTFQPNPVNRVICPD-------AKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAE 1069
            T  G+++CCP   AVCC D  HCCP  T CNL   TCD      +   ++TK+           ++C  Q+ C   ++CC M   + + CCP   AVCC D  HCCP    C+    +C S  + +    KL   A  +    ++C D +S+C TG TCC L  G +GCCP   AVCC D   CCPQ   CN+   TC+ K     L   L+   + + +   +            + C    TCCK+ +   + CCP++ A CC+D  HCCP    C++   +C  Q  
Sbjct:  440 TASGAWACCPLPKAVCCDDHVHCCPHGTVCNLEAETCDDSSGVFLPLPLLTKVPALTSRVQQEKIMCDRQTSCPKDATCCFMERTHKWGCCPLPEAVCCKDGIHCCPSGHTCDPHRSSCSSGPRRIPWSTKLGALAEPSALTDVKC-DNTSSCATGTTCCKLPSGEWGCCPLLKAVCCPDHEHCCPQGYTCNMQTKTCEKKGYNLQLTTALLSKVEQSALREAVEETNVQCDSTGVFLCPANSTCCKI-SATEWSCCPFAKAECCADMKHCCPVGYSCDLKARSCTPQTR 727          

HSP 8 Score: 85.8853 bits (211), Expect = 4.332e-14
Identity = 58/156 (37.18%), Postives = 78/156 (50.00%), Query Frame = 2
Query:  887 VICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEI----------KISPIL--VESIKCPNG-SLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIINFHP 1315
            +ICP+    C D  TCCK   G  Y CCP   A CCSD +HCC Q TVC++    C ++  +L +            S ++  V+++ CP+  S C    TCC   + S+ CCP P AVCC D  HCCP  + C L    C    L  FP++   P
Sbjct:   19 LICPNGSM-CGDEDTCCKNTQG-GYSCCPLPHAECCSDHLHCCYQGTVCDLVHQKCINKTVSLPMVKRLPSKQRSSASQLVSGVKAVMCPDHESECPDDTTCCQLYDSSWGCCPLPKAVCCEDKRHCCPGGSKCDLVHLKCVSPSLESFPMLEKLP 172          

HSP 9 Score: 65.0846 bits (157), Expect = 1.772e-7
Identity = 33/73 (45.21%), Postives = 43/73 (58.90%), Query Frame = 2
Query: 1097 LVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIINFHP 1315
            L  ++ CPNGS+CG + TCC +    YSCCP P+A CCSDH HCC   T C L  + C  N  +  P++   P
Sbjct:   15 LSAALICPNGSMCGDEDTCCKNTQGGYSCCPLPHAECCSDHLHCCYQGTVCDLVHQKC-INKTVSLPMVKRLP 86          
BLAST of Granulin precursor vs. TrEMBL
Match: A0A2G8L0S4 (Putative fibrillin-1 isoform X4 (Fragment) OS=Stichopus japonicus OX=307972 GN=BSL78_09258 PE=4 SV=1)

HSP 1 Score: 270.396 bits (690), Expect = 8.065e-81
Identity = 152/347 (43.80%), Postives = 204/347 (58.79%), Query Frame = 2
Query:  251 VTTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCP-DQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEI--KISPILVESIKCPNG-SLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKN 1279
            +   G Y CCP  +AVCCSD  HCCP    C+ ++GTC S   E++   + K  A+++ +V CP  QS+C DG++CC+++ G + CCP  +AVCCSD  HCCP    C++S GTC S+  E++   + K  A    ++ CP G S C  G TCCLLS G YGCCP  NAVCCSD L CCP    C++  GTC   ++  +   KT +   V  V CP  + +C DG TCC L +G  YGCCP   A CCSD +HCCP    C+I+ GTC   +E +    K     + ++ CP G S C    TCC  ++  Y CCP PNAVCCSDH HCCPN  +C ++  +C + 
Sbjct:  165 ILATGRYGCCPLRNAVCCSDHLHCCPNGYTCDASQGTC-SQGSEIMNWFE-KTEATTLGTVTCPGGQSECPDGNTCCLLSSGQYGCCPLPNAVCCSDHLHCCPNGYTCDVSQGTC-SQGSEIMAWFE-KTEATPVGTVTCPGGQSECPDGNTCCLLSSGQYGCCPLPNAVCCSDHLHCCPNGYTCDVSGGTCSQGSEIMAWFEKT-EATTVGTVTCPGGQSECPDGNTCCLLSSGQ-YGCCPLPNAVCCSDHLHCCPNGYTCDISGGTCSQGSEIMNWFEKTEATTLGTVTCPGGQSECPDGNTCCLLSSGQYGCCPLPNAVCCSDHLHCCPNGYTCDVSQGTCSQG 505          

HSP 2 Score: 264.618 bits (675), Expect = 1.186e-78
Identity = 151/355 (42.54%), Postives = 207/355 (58.31%), Query Frame = 2
Query:  251 VTTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPD-QSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEI--KISPILVESIKCPNG-SLCGQKGTCCPSANDSYSCCPYPN--------AVCCSDHSHCCPNNTSCSLNTKSCDKN 1279
            + + G Y CCP  +AVCCSD  HCCP    C++++GTC S   E++   + K  A+ + +V CP  QS+C DG++CC+++ G + CCP  +AVCCSD  HCCP    C++S GTC S+  E++   + K  A +  ++ CP G S C  G TCCLLS G YGCCP  NAVCCSD L CCP    C++  GTC   ++  +   KT +   +  V CP  + +C DG TCC L +G  YGCCP   A CCSD +HCCP    C++++GTC   +E +    K     V ++ CP G S C    TCC  ++  Y CCP PN        AVCCSDH HCCPN  +C ++  +C + 
Sbjct:  240 LLSSGQYGCCPLPNAVCCSDHLHCCPNGYTCDVSQGTC-SQGSEIMAWFE-KTEATPVGTVTCPGGQSECPDGNTCCLLSSGQYGCCPLPNAVCCSDHLHCCPNGYTCDVSGGTC-SQGSEIMAWFE-KTEATTVGTVTCPGGQSECPDGNTCCLLSSGQYGCCPLPNAVCCSDHLHCCPNGYTCDISGGTCSQGSEIMNWFEKT-EATTLGTVTCPGGQSECPDGNTCCLLSSGQ-YGCCPLPNAVCCSDHLHCCPNGYTCDVSQGTCSQGSEIMNWFEKTEATTVGTVTCPGGQSECPDGSTCCLLSSGQYGCCPLPNCKILLILQAVCCSDHLHCCPNGYTCDVSQGTCSQG 588          

HSP 3 Score: 253.062 bits (645), Expect = 3.128e-74
Identity = 151/361 (41.83%), Postives = 198/361 (54.85%), Query Frame = 2
Query:  260 DGSYSCCP---YSSAVCCSDK--------------QHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPDQ-SQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEI--KISPILVESIKCPNG-SLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKN 1279
            DG Y CCP   Y+    CS+                HCCP+   C+ ++  C      V      K  A  + SV+CPD+ S+C DGS+CC++A G + CCP  +AVCCSD  HCCP    C+ S GTC S+  E++   + K  A +  ++ CP G S C  G TCCLLS G YGCCP  NAVCCSD L CCP    C++  GTC   ++  +   KT +  PV  V CP  + +C DG TCC L +G  YGCCP   A CCSD +HCCP    C+++ GTC   +E +    K     V ++ CP G S C    TCC  ++  Y CCP PNAVCCSDH HCCPN  +C ++  +C + 
Sbjct:   76 DGKYGCCPCPKYTCTALCSEDICSSSLFVKAECCDTHCCPEGFSCDGDQ--CSKEEGNVFVAGVSKTEAVIVESVMCPDRRSECPDGSTCCILATGRYGCCPLRNAVCCSDHLHCCPNGYTCDASQGTC-SQGSEIMNWFE-KTEATTLGTVTCPGGQSECPDGNTCCLLSSGQYGCCPLPNAVCCSDHLHCCPNGYTCDVSQGTCSQGSEIMAWFEKT-EATPVGTVTCPGGQSECPDGNTCCLLSSGQ-YGCCPLPNAVCCSDHLHCCPNGYTCDVSGGTCSQGSEIMAWFEKTEATTVGTVTCPGGQSECPDGNTCCLLSSGQYGCCPLPNAVCCSDHLHCCPNGYTCDISGGTCSQG 430          

HSP 4 Score: 222.246 bits (565), Expect = 1.964e-62
Identity = 138/356 (38.76%), Postives = 187/356 (52.53%), Query Frame = 2
Query:  293 AVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCP---YSSAVCCSD--------------KQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEI--KISPILVESIKCPNG-SLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKN--ILLKF 1294
            AVCCSD +HCCP    C++++GTC S   E +   + +V      +V C  +  C DG++CC  ADG + CCP   Y+    CS+                HCCP+   C+     C  +   V      K  A+   S+ CPD  S C  G+TCC+L+ G YGCCP  NAVCCSD L CCP    C+   GTC   ++  +   KT +   +  V CP  + +C DG TCC L +G  YGCCP   A CCSD +HCCP    C++++GTC   +E +    K     V ++ CP G S C    TCC  ++  Y CCP PNAVCCSDH HCCPN  +C ++  +C +   I+  F
Sbjct:   16 AVCCSDGEHCCPSGYTCDVSEGTCSSE-SEKLPWFEKEVAK----NVHCGGKYYCKDGNTCCPQADGKYGCCPCPKYTCTALCSEDICSSSLFVKAECCDTHCCPEGFSCD--GDQCSKEEGNVFVAGVSKTEAVIVESVMCPDRRSECPDGSTCCILATGRYGCCPLRNAVCCSDHLHCCPNGYTCDASQGTCSQGSEIMNWFEKT-EATTLGTVTCPGGQSECPDGNTCCLLSSGQ-YGCCPLPNAVCCSDHLHCCPNGYTCDVSQGTCSQGSEIMAWFEKTEATPVGTVTCPGGQSECPDGNTCCLLSSGQYGCCPLPNAVCCSDHLHCCPNGYTCDVSGGTCSQGSEIMAWF 362          
BLAST of Granulin precursor vs. TrEMBL
Match: A0A4W5RTY1 (Granulin b OS=Hucho hucho OX=62062 PE=4 SV=1)

HSP 1 Score: 273.863 bits (699), Expect = 4.753e-80
Identity = 163/375 (43.47%), Postives = 210/375 (56.00%), Query Frame = 2
Query:  260 DGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPD-QSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSK-------TKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDH--QAEALEIKISPILVESIKCPNGSL----------CGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIINFHP*FN 1324
            +GS+ CCP + AVCC DK HCCP+ T+C+L    C S   E    ++ K PA    +V CP  +S+C DG++CC++  G++ CCPY  AVCC+DK HCCP NT C+L    C S      T +  K PAI N  ++CPD  S+C    TCCLL DGSYGCCP  +AVCC D L CCP+ T C+L  GTC SK        K P+ L  TF  + VN V C D+   C+DG TCCKL  G+ + CCP   A CC D +HCCP  T+CN+ + TCD      AL   +  +   S   P   L          C  K  CC +   +++CC  PNAVCC+DH HCCP+ T C+L   +CD       P +N  P F 
Sbjct:  119 EGSWGCCPLAKAVCCEDKMHCCPEGTKCDLAHTKCVSPTLETFA-MREKGPAMKKQTVTCPGGKSRCPDGTTCCLLTSGDYGCCPYLEAVCCTDKLHCCPGNTTCDLERDMCTSP--NTQTPLAKKTPAIPN-DVDCPDKVSSCPDETTCCLLGDGSYGCCPMPSAVCCPDHLHCCPEGTTCDLEQGTCVSKHGQTSMAVKFPATLTTTFLQSTVNGVPCNDS-VTCADGTTCCKLLNGE-WACCPLPKAVCCDDHLHCCPHGTICNLEESTCDDPSSGSALVPMLDKVPAFSYVSPEEPLPNSICDRSTSCPGKSMCCKTTTGNWACCLLPNAVCCNDHIHCCPDGTVCNLEASTCDDPSGFNVPWVNKVPAFT 487          

HSP 2 Score: 260.766 bits (665), Expect = 3.612e-75
Identity = 156/377 (41.38%), Postives = 206/377 (54.64%), Query Frame = 2
Query:  263 GSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILS---------VVCPD-QSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC--DHQAEALEIKISPIL--------VESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCD--KNILLKFPIINFHP*FNY 1327
            G Y CCP  +A CCSD  HCC + T C+L    C  + K V      +VPA  + S         V+CPD +S+C + ++CC + +G++ CCP + AVCC DK HCCP+ T C+L+   C S   E    M+ K PA+   ++ CP G S C  G TCCLL+ G YGCCP+  AVCC+DKL CCP NT C+L    C S   +  L  KT  P   N V CPD    C D  TCC L  G SYGCCP  +A CC D +HCCP+ T C++ +GTC   H   ++ +K    L        V  + C +   C    TCC   N  ++CCP P AVCC DH HCCP+ T C+L   +CD   +     P+++  P F+Y
Sbjct:   36 GGYGCCPLPNAECCSDHLHCCYEGTVCDLVHSKC--LNKTVSLPWVRRVPAHHLFSPLMVEGVRAVICPDGESECPEDTTCCQLPEGSWGCCPLAKAVCCEDKMHCCPEGTKCDLAHTKCVSPTLETFA-MREKGPAMKKQTVTCPGGKSRCPDGTTCCLLTSGDYGCCPYLEAVCCTDKLHCCPGNTTCDLERDMCTSPNTQTPLAKKT--PAIPNDVDCPDKVSSCPDETTCCLLGDG-SYGCCPMPSAVCCPDHLHCCPEGTTCDLEQGTCVSKHGQTSMAVKFPATLTTTFLQSTVNGVPCNDSVTCADGTTCCKLLNGEWACCPLPKAVCCDDHLHCCPHGTICNLEESTCDDPSSGSALVPMLDKVPAFSY 406          

HSP 3 Score: 238.424 bits (607), Expect = 9.762e-67
Identity = 154/379 (40.63%), Postives = 199/379 (52.51%), Query Frame = 2
Query:  251 VTTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPDQ-SQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLS--------IECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLL-----IKTFQ----PNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCD----------HQAEALEIKISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPII 1303
            + T G Y CCPY  AVCC+DK HCCP NT C+L +  C S      T +  K PA     V CPD+ S C D ++CC++ DG++ CCP  SAVCC D  HCCP+ T C+L  GTC SK  +  T M +K PA    +        + C D S TC  G TCC L +G + CCP   AVCC D L CCP  T+CNL   TCD  +   +L+     +  F       P+   IC D    C     CCK  TG+ + CC    A CC+D IHCCP  TVCN+   TCD          ++  A   + +P+  E  KC   ++C    TCC   +  ++CCP P AVCC DH HCCP   +C++  ++CDK   L  P I
Sbjct:  192 LLTSGDYGCCPYLEAVCCTDKLHCCPGNTTCDLERDMCTS--PNTQTPLAKKTPAIPN-DVDCPDKVSSCPDETTCCLLGDGSYGCCPMPSAVCCPDHLHCCPEGTTCDLEQGTCVSKHGQ--TSMAVKFPATLTTTFLQSTVNGVPCND-SVTCADGTTCCKLLNGEWACCPLPKAVCCDDHLHCCPHGTICNLEESTCDDPSSGSALVPMLDKVPAFSYVSPEEPLPNSIC-DRSTSCPGKSMCCKTTTGN-WACCLLPNAVCCNDHIHCCPDGTVCNLEASTCDDPSGFNVPWVNKVPAFTTQ-APLATE--KCDKQTMCPGGTTCCRQNSGQWACCPLPLAVCCDDHEHCCPKGYTCNVADQTCDKAGTLSLPWI 559          

HSP 4 Score: 219.164 bits (557), Expect = 1.060e-59
Identity = 128/306 (41.83%), Postives = 170/306 (55.56%), Query Frame = 2
Query:  428 SVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPA---ISNLSIE------CPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDH-QAEALEIKISPILVESIKCPNG-SLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSC-----DKNILLKFP 1297
            +++CPD   CDDG++CC    G + CCP  +A CCSD  HCC + TVC+L    C +K   V      ++PA    S L +E      CPDG S C    TCC L +GS+GCCP + AVCC DK+ CCP+ T C+L    C S T +   + +         V CP  K +C DG TCC L +GD YGCCPY  A CC+DK+HCCP NT C++ +  C     +    K +P +   + CP+  S C  + TCC   + SY CCP P+AVCC DH HCCP  T+C L   +C       ++ +KFP
Sbjct:   15 ALICPDGGMCDDGNTCCKNPSGGYGCCPLPNAECCSDHLHCCYEGTVCDLVHSKCLNKT--VSLPWVRRVPAHHLFSPLMVEGVRAVICPDGESECPEDTTCCQLPEGSWGCCPLAKAVCCEDKMHCCPEGTKCDLAHTKCVSPTLETFAMREKGPAMKKQTVTCPGGKSRCPDGTTCCLLTSGD-YGCCPYLEAVCCTDKLHCCPGNTTCDLERDMCTSPNTQTPLAKKTPAIPNDVDCPDKVSSCPDETTCCLLGDGSYGCCPMPSAVCCPDHLHCCPEGTTCDLEQGTCVSKHGQTSMAVKFP 317          

HSP 5 Score: 218.394 bits (555), Expect = 1.739e-59
Identity = 147/384 (38.28%), Postives = 196/384 (51.04%), Query Frame = 2
Query:  260 DGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPA--------SSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDS-KLKEVVTKMKLKIPAISNLSIECP------DGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKT--------KKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEI----KISPILVESI--------------KCPNGSLCGQKGTCC-PSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNIL 1285
            DGSY CCP  SAVCC D  HCCP+ T C+L +GTC  V K   T + +K PA        S++  V C D   C DG++CC + +G +ACCP   AVCC D  HCCP  T+CNL   TCD       +  M  K+PA S +S E P      D S++C   + CC  + G++ CC   NAVCC+D + CCP  TVCNL A TCD  +        K P+   +     P+    C D +  C  G TCC+  +G  + CCP   A CC D  HCCP+   CN+   TCD +A  L +    K+  +L+  +               C   + C +  TCC  +    + CCP P AVCC++  HCCP+  SC ++  SC K  L
Sbjct:  269 DGSYGCCPMPSAVCCPDHLHCCPEGTTCDLEQGTC--VSKHGQTSMAVKFPATLTTTFLQSTVNGVPCNDSVTCADGTTCCKLLNGEWACCPLPKAVCCDDHLHCCPHGTICNLEESTCDDPSSGSALVPMLDKVPAFSYVSPEEPLPNSICDRSTSCPGKSMCCKTTTGNWACCLLPNAVCCNDHIHCCPDGTVCNLEASTCDDPSGFNVPWVNKVPAFTTQA----PLATEKC-DKQTMCPGGTTCCRQNSG-QWACCPLPLAVCCDDHEHCCPKGYTCNVADQTCD-KAGTLSLPWIPKVPALLLHGVLPQASAHAFPPTKNMCDPHTSCPKYTTCCFMNKAGKWGCCPLPKAVCCANGDHCCPSGYSCDVHKTSCTKGRL 643          

HSP 6 Score: 207.994 bits (528), Expect = 1.019e-55
Identity = 135/377 (35.81%), Postives = 181/377 (48.01%), Query Frame = 2
Query:  260 DGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDS-VLKEVVTKIKLKVPASSILS-------VVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISN---LSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKT--------KKPSLLIKTFQPNPVNRVICP-----DAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEAL------EIKISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDK---NILLK 1291
            +G ++CCP   AVCC D  HCCP  T CNL + TCD       +  +  KVPA S +S        +C   + C   S CC    GN+ACC   +AVCC+D  HCCP  TVCNL A TCD      V  +  K+PA +    L+ E  D  + C  G TCC  + G + CCP   AVCC D   CCP+   CN+   TCD           K P+LL+    P        P     D    C    TCC +     +GCCP   A CC++  HCCP    C+++K +C      +      +      +++ +KC + S C    TCC      + CCP   AVCC+DH HCCP   SC++ T +C+K    +LL+
Sbjct:  351 NGEWACCPLPKAVCCDDHLHCCPHGTICNLEESTCDDPSSGSALVPMLDKVPAFSYVSPEEPLPNSICDRSTSCPGKSMCCKTTTGNWACCLLPNAVCCNDHIHCCPDGTVCNLEASTCDDPSGFNVPWVN-KVPAFTTQAPLATEKCDKQTMCPGGTTCCRQNSGQWACCPLPLAVCCDDHEHCCPKGYTCNVADQTCDKAGTLSLPWIPKVPALLLHGVLPQASAHAFPPTKNMCDPHTSCPKYTTCCFMNKAGKWGCCPLPKAVCCANGDHCCPSGYSCDVHKTSCTKGRLTIPWYRKEKALTEGAMLKDVKCDDKSSCASGATCCKLPTGEWGCCPLVKAVCCTDHEHCCPQGYSCNMQTGTCEKLVEGVLLR 726          

HSP 7 Score: 197.593 bits (501), Expect = 5.278e-52
Identity = 138/390 (35.38%), Postives = 194/390 (49.74%), Query Frame = 2
Query:  254 TTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPA----SSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSS--------------TCKTGATCCLLSD-GSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNP-------VNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKISPI--LVES----------IKCPNGSL--CGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPII 1303
            TT G+++CC   +AVCC+D  HCCP  T CNL   TCD      V  +  KVPA    + + +  C  Q+ C  G++CC    G +ACCP   AVCC D +HCCP+   CN++  TCD K   +      K+PA+  L    P  S+              +C    TCC ++  G +GCCP   AVCC++   CCP    C++   +C     K  L I  ++          +  V C D K  C+ G TCCKLPTG+ +GCCP   A CC+D  HCCPQ   CN+  GTC+   E + ++  P+  + ES          +KC +     C +  TCC ++   +SCCP P A+CC+D  HCCP   +C L    C +   L + + 
Sbjct:  433 TTTGNWACCLLPNAVCCNDHIHCCPDGTVCNLEASTCDDPSGFNVPWVN-KVPAFTTQAPLATEKCDKQTMCPGGTTCCRQNSGQWACCPLPLAVCCDDHEHCCPKGYTCNVADQTCD-KAGTLSLPWIPKVPALL-LHGVLPQASAHAFPPTKNMCDPHTSCPKYTTCCFMNKAGKWGCCPLPKAVCCANGDHCCPSGYSCDVHKTSC----TKGRLTIPWYRKEKALTEGAMLKDVKC-DDKSSCASGATCCKLPTGE-WGCCPLVKAVCCTDHEHCCPQGYSCNMQTGTCEKLVEGVLLRTVPLTKVAESQQRASEMGIDVKCDSTGEYSCPKLETCCKTSPTEWSCCPAPKAICCADTRHCCPMGYTCDLERGGCSQQAELTWDMF 813          

HSP 8 Score: 99.7525 bits (247), Expect = 1.396e-18
Identity = 73/219 (33.33%), Postives = 99/219 (45.21%), Query Frame = 2
Query:  743 FSNAVCCSDKLSCCPQNTVCNLPAG-------------------------------TCDSKTKKPSLLIKT-----FQP---NPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC---DHQAEALEIKISPILVESIKCPNG-SLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSC 1270
             ++A+ C D   C   NT C  P+G                                C +KT     + +      F P     V  VICPD + +C +  TCC+LP G S+GCCP + A CC DK+HCCP+ T C++    C     +  A+  K   +  +++ CP G S C    TCC   +  Y CCPY  AVCC+D  HCCP NT+C L    C
Sbjct:   12 LTSALICPDGGMCDDGNTCCKNPSGGYGCCPLPNAECCSDHLHCCYEGTVCDLVHSKCLNKTVSLPWVRRVPAHHLFSPLMVEGVRAVICPDGESECPEDTTCCQLPEG-SWGCCPLAKAVCCEDKMHCCPEGTKCDLAHTKCVSPTLETFAMREKGPAMKKQTVTCPGGKSRCPDGTTCCLLTSGDYGCCPYLEAVCCTDKLHCCPGNTTCDLERDMC 229          
BLAST of Granulin precursor vs. Ensembl Cavefish
Match: grnb (granulins-like [Source:NCBI gene;Acc:103046308])

HSP 1 Score: 221.476 bits (563), Expect = 1.831e-64
Identity = 152/380 (40.00%), Postives = 194/380 (51.05%), Query Frame = 2
Query:  260 DGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDS--VLKEVVTKIKLKVPAS-SILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLK--IPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPS--LLIKTFQPNPVNRVICPDAKYQCSD------GQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQ--AEALEIKISPIL---------------------VESI-KCPNGSLCGQKGTCCPSAN-DSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNIL 1285
            +GSY CCP   AVCCSD  HCCPQ T C+L    C S  VL+ V T +   V    ++ SV C +   C+ GS+CC   DG++ACCP   AVCC D  HCCPQ TVC  S     + L  +V  ++ K  I  +   + E  D ++TC  GATCC +  G++GCCP   AVCC D L CCP+NTVCN+ AGTCDS     +  L +   +  P   +  P A  QC +      G TCC+  +G ++ CCP   A CC D  HCCPQ   C+I   +CDH      L  K  P L                     VES  KC   + C +  TCC     + + CCP P AVCC D  HCCPN+ +C     +C K  L
Sbjct:  208 NGSYGCCPMPKAVCCSDHVHCCPQGTSCDLAHSKCVSSNVLEPVTTNLSPVVRVKVTVESVPCNESVACESGSTCCKTKDGDWACCPLPEAVCCEDHIHCCPQGTVCARSTCVASADLLTLVRWVEKKPTINRVPQPANEKCDPTTTCPKGATCCKMESGTWGCCPLPQAVCCEDHLHCCPRNTVCNVAAGTCDSAFSGTAGQLSVPWVRKTPATSL--PPANDQCDETSACPTGTTCCRQKSG-AWACCPLPQAVCCDDHEHCCPQGYKCDIIHESCDHPFLPSMLWFKKQPALQSMTQQSNANAKAIAESAVADVESKHKCDAQTSCPRDNTCCYMKKFNKWGCCPLPEAVCCGDGDHCCPNSYTCDTTKNTCLKGHL 584          

HSP 2 Score: 221.476 bits (563), Expect = 2.317e-64
Identity = 151/394 (38.32%), Postives = 195/394 (49.49%), Query Frame = 2
Query:  254 TTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTC--DSVLKEVVTKIKLKVPASSILSVVCPDQ-SQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLS-----------------IECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICP------DAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEAL----EIKISPILVE-----SIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNI-----LLKFPIINFHP 1315
            T  G Y CCP  +A CCSD  HCC + T C+L    C   +   + V ++ ++ P S   +VVCPDQ S+C D ++CC + DG++ CCP  +AVCC DK HCCPQ T C+L    C S +   V  ++ K PA                      ++CPD  S C    TCC L +GSYGCCP   AVCCSD + CCPQ T C+L    C S      L   T   +PV RV         +    C  G TCCK   GD + CCP   A CC D IHCCPQ TVC   + TC   A+ L     ++  P +       + KC   + C +  TCC   + ++ CCP P AVCC DH HCCP NT C++   +CD         L  P +   P
Sbjct:   35 TPSGGYGCCPLPNAECCSDHLHCCHEGTLCDLEHSKCVNKTHTLDWVMRVPIRQP-SLPQAVVCPDQESECPDDTTCCQLPDGSWGCCPMPNAVCCEDKMHCCPQGTTCDLPHSKCVSSMLGSV-PLRRKFPAYKRAEWKARKDSNGLDLADSNDVDCPDKVSFCPDDTTCCPLGNGSYGCCPMPKAVCCSDHVHCCPQGTSCDLAHSKCVSSN---VLEPVTTNLSPVVRVKVTVESVPCNESVACESGSTCCKTKDGD-WACCPLPEAVCCEDHIHCCPQGTVC--ARSTCVASADLLTLVRWVEKKPTINRVPQPANEKCDPTTTCPKGATCCKMESGTWGCCPLPQAVCCEDHLHCCPRNTVCNVAAGTCDSAFSGTAGQLSVPWVRKTP 420          

HSP 3 Score: 211.075 bits (536), Expect = 1.213e-60
Identity = 129/328 (39.33%), Postives = 174/328 (53.05%), Query Frame = 2
Query:  428 SVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLK--EVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDS--------KTKKPSLLIKTFQPNP---------VNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC--DHQAEALEIKISPIL-----VESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNT--KSCDKNILLKF----PIINFHP 1315
            +++CPD   CDDG++CC    G + CCP  +A CCSD  HCC + T+C+L    C +K    + V ++ ++ P++   ++ CPD  S C    TCC L DGS+GCCP  NAVCC DK+ CCPQ T C+LP   C S        + K P+     ++             N V CPD    C D  TCC L  G SYGCCP   A CCSD +HCCPQ T C++    C   +  E +   +SP++     VES+ C     C    TCC + +  ++CCP P AVCC DH HCCP  T C+ +T   S D   L+++    P IN  P
Sbjct:   17 ALICPDGGMCDDGNTCCQTPSGGYGCCPLPNAECCSDHLHCCHEGTLCDLEHSKCVNKTHTLDWVMRVPIRQPSLPQ-AVVCPDQESECPDDTTCCQLPDGSWGCCPMPNAVCCEDKMHCCPQGTTCDLPHSKCVSSMLGSVPLRRKFPAYKRAEWKARKDSNGLDLADSNDVDCPDKVSFCPDDTTCCPLGNG-SYGCCPMPKAVCCSDHVHCCPQGTSCDLAHSKCVSSNVLEPVTTNLSPVVRVKVTVESVPCNESVACESGSTCCKTKDGDWACCPLPEAVCCEDHIHCCPQGTVCARSTCVASADLLTLVRWVEKKPTINRVP 342          

HSP 4 Score: 206.068 bits (523), Expect = 7.907e-59
Identity = 136/395 (34.43%), Postives = 185/395 (46.84%), Query Frame = 2
Query:  254 TTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPDQSQCD------DGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKL----KIPAIS--NLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSK--------TKKPSLLIKTFQPNPVNRVICP------------DAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC-----------DHQAEALEIKISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIINF 1309
            T DG ++CCP   AVCC D  HCCPQ T C   + TC     +++T ++      +I  V  P   +CD       G++CC M  G + CCP   AVCC D  HCCP+NTVCN++AGTCDS       ++ +    K PA S    + +C D +S C TG TCC    G++ CCP   AVCC D   CCPQ   C++   +CD           K+P+L   T Q N   + I              DA+  C    TCC +   + +GCCP   A CC D  HCCP +  C+  K TC             +A+  +       V  ++C + + C    TCC      + CCP+  AVCC DH HCCP   +C L   +C +   L    +  
Sbjct:  285 TKDGDWACCPLPEAVCCEDHIHCCPQGTVCA--RSTC-VASADLLTLVRWVEKKPTINRVPQPANEKCDPTTTCPKGATCCKMESGTWGCCPLPQAVCCEDHLHCCPRNTVCNVAAGTCDSAFSGTAGQLSVPWVRKTPATSLPPANDQC-DETSACPTGTTCCRQKSGAWACCPLPQAVCCDDHEHCCPQGYKCDIIHESCDHPFLPSMLWFKKQPALQSMTQQSNANAKAIAESAVADVESKHKCDAQTSCPRDNTCCYMKKFNKWGCCPLPEAVCCGDGDHCCPNSYTCDTTKNTCLKGHLEIPWFKKQEAKVTQGSEVAHGVADVQCDSTARCPTGSTCCRLTTGQWGCCPHVQAVCCDDHVHCCPAGYTCDLQAGTCLRTSTLHTVALTL 675          

HSP 5 Score: 197.593 bits (501), Expect = 1.040e-55
Identity = 126/382 (32.98%), Postives = 183/382 (47.91%), Query Frame = 2
Query:  263 GSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKL----KVPASSI--LSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECP--------------------DGSSTCKTGATCCLLSD-GSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDS--------KTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKISPILV---ESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKF 1294
            G++ CCP   AVCC D  HCCP+NT CN+  GTCDS       ++ +    K PA+S+   +  C + S C  G++CC    G +ACCP   AVCC D +HCCPQ   C++   +CD      +   K K PA+ +++ +                      D  ++C    TCC +     +GCCP   AVCC D   CCP +  C+    TC          K ++  +   +   + V  V C D+  +C  G TCC+L TG  +GCCP+  A CC D +HCCP    C++  GTC   +    + ++ +     E + C   S C +  TCC  ++  ++CCP+  AVCC D  HCCP    C    K C +   L +
Sbjct:  367 GTWGCCPLPQAVCCEDHLHCCPRNTVCNVAAGTCDSAFSGTAGQLSVPWVRKTPATSLPPANDQCDETSACPTGTTCCRQKSGAWACCPLPQAVCCDDHEHCCPQGYKCDIIHESCDHPFLPSMLWFK-KQPALQSMTQQSNANAKAIAESAVADVESKHKCDAQTSCPRDNTCCYMKKFNKWGCCPLPEAVCCGDGDHCCPNSYTCDTTKNTCLKGHLEIPWFKKQEAKVTQGSEVAHGVADVQC-DSTARCPTGSTCCRLTTG-QWGCCPHVQAVCCDDHVHCCPAGYTCDLQAGTCLRTSTLHTVALTLVHTHTKEQVMCDATSHCTESQTCCKLSDTEWACCPFKQAVCCKDMKHCCPVGYVCDPKAKGCARATSLTW 745          
BLAST of Granulin precursor vs. Ensembl Cavefish
Match: grnb (granulins-like [Source:NCBI gene;Acc:103046308])

HSP 1 Score: 221.476 bits (563), Expect = 1.831e-64
Identity = 152/380 (40.00%), Postives = 194/380 (51.05%), Query Frame = 2
Query:  260 DGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDS--VLKEVVTKIKLKVPAS-SILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLK--IPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPS--LLIKTFQPNPVNRVICPDAKYQCSD------GQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQ--AEALEIKISPIL---------------------VESI-KCPNGSLCGQKGTCCPSAN-DSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNIL 1285
            +GSY CCP   AVCCSD  HCCPQ T C+L    C S  VL+ V T +   V    ++ SV C +   C+ GS+CC   DG++ACCP   AVCC D  HCCPQ TVC  S     + L  +V  ++ K  I  +   + E  D ++TC  GATCC +  G++GCCP   AVCC D L CCP+NTVCN+ AGTCDS     +  L +   +  P   +  P A  QC +      G TCC+  +G ++ CCP   A CC D  HCCPQ   C+I   +CDH      L  K  P L                     VES  KC   + C +  TCC     + + CCP P AVCC D  HCCPN+ +C     +C K  L
Sbjct:  208 NGSYGCCPMPKAVCCSDHVHCCPQGTSCDLAHSKCVSSNVLEPVTTNLSPVVRVKVTVESVPCNESVACESGSTCCKTKDGDWACCPLPEAVCCEDHIHCCPQGTVCARSTCVASADLLTLVRWVEKKPTINRVPQPANEKCDPTTTCPKGATCCKMESGTWGCCPLPQAVCCEDHLHCCPRNTVCNVAAGTCDSAFSGTAGQLSVPWVRKTPATSL--PPANDQCDETSACPTGTTCCRQKSG-AWACCPLPQAVCCDDHEHCCPQGYKCDIIHESCDHPFLPSMLWFKKQPALQSMTQQSNANAKAIAESAVADVESKHKCDAQTSCPRDNTCCYMKKFNKWGCCPLPEAVCCGDGDHCCPNSYTCDTTKNTCLKGHL 584          

HSP 2 Score: 221.476 bits (563), Expect = 2.317e-64
Identity = 151/394 (38.32%), Postives = 195/394 (49.49%), Query Frame = 2
Query:  254 TTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTC--DSVLKEVVTKIKLKVPASSILSVVCPDQ-SQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLS-----------------IECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICP------DAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEAL----EIKISPILVE-----SIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNI-----LLKFPIINFHP 1315
            T  G Y CCP  +A CCSD  HCC + T C+L    C   +   + V ++ ++ P S   +VVCPDQ S+C D ++CC + DG++ CCP  +AVCC DK HCCPQ T C+L    C S +   V  ++ K PA                      ++CPD  S C    TCC L +GSYGCCP   AVCCSD + CCPQ T C+L    C S      L   T   +PV RV         +    C  G TCCK   GD + CCP   A CC D IHCCPQ TVC   + TC   A+ L     ++  P +       + KC   + C +  TCC   + ++ CCP P AVCC DH HCCP NT C++   +CD         L  P +   P
Sbjct:   35 TPSGGYGCCPLPNAECCSDHLHCCHEGTLCDLEHSKCVNKTHTLDWVMRVPIRQP-SLPQAVVCPDQESECPDDTTCCQLPDGSWGCCPMPNAVCCEDKMHCCPQGTTCDLPHSKCVSSMLGSV-PLRRKFPAYKRAEWKARKDSNGLDLADSNDVDCPDKVSFCPDDTTCCPLGNGSYGCCPMPKAVCCSDHVHCCPQGTSCDLAHSKCVSSN---VLEPVTTNLSPVVRVKVTVESVPCNESVACESGSTCCKTKDGD-WACCPLPEAVCCEDHIHCCPQGTVC--ARSTCVASADLLTLVRWVEKKPTINRVPQPANEKCDPTTTCPKGATCCKMESGTWGCCPLPQAVCCEDHLHCCPRNTVCNVAAGTCDSAFSGTAGQLSVPWVRKTP 420          

HSP 3 Score: 211.075 bits (536), Expect = 1.213e-60
Identity = 129/328 (39.33%), Postives = 174/328 (53.05%), Query Frame = 2
Query:  428 SVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLK--EVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDS--------KTKKPSLLIKTFQPNP---------VNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC--DHQAEALEIKISPIL-----VESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNT--KSCDKNILLKF----PIINFHP 1315
            +++CPD   CDDG++CC    G + CCP  +A CCSD  HCC + T+C+L    C +K    + V ++ ++ P++   ++ CPD  S C    TCC L DGS+GCCP  NAVCC DK+ CCPQ T C+LP   C S        + K P+     ++             N V CPD    C D  TCC L  G SYGCCP   A CCSD +HCCPQ T C++    C   +  E +   +SP++     VES+ C     C    TCC + +  ++CCP P AVCC DH HCCP  T C+ +T   S D   L+++    P IN  P
Sbjct:   17 ALICPDGGMCDDGNTCCQTPSGGYGCCPLPNAECCSDHLHCCHEGTLCDLEHSKCVNKTHTLDWVMRVPIRQPSLPQ-AVVCPDQESECPDDTTCCQLPDGSWGCCPMPNAVCCEDKMHCCPQGTTCDLPHSKCVSSMLGSVPLRRKFPAYKRAEWKARKDSNGLDLADSNDVDCPDKVSFCPDDTTCCPLGNG-SYGCCPMPKAVCCSDHVHCCPQGTSCDLAHSKCVSSNVLEPVTTNLSPVVRVKVTVESVPCNESVACESGSTCCKTKDGDWACCPLPEAVCCEDHIHCCPQGTVCARSTCVASADLLTLVRWVEKKPTINRVP 342          

HSP 4 Score: 206.068 bits (523), Expect = 7.907e-59
Identity = 136/395 (34.43%), Postives = 185/395 (46.84%), Query Frame = 2
Query:  254 TTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPDQSQCD------DGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKL----KIPAIS--NLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSK--------TKKPSLLIKTFQPNPVNRVICP------------DAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC-----------DHQAEALEIKISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIINF 1309
            T DG ++CCP   AVCC D  HCCPQ T C   + TC     +++T ++      +I  V  P   +CD       G++CC M  G + CCP   AVCC D  HCCP+NTVCN++AGTCDS       ++ +    K PA S    + +C D +S C TG TCC    G++ CCP   AVCC D   CCPQ   C++   +CD           K+P+L   T Q N   + I              DA+  C    TCC +   + +GCCP   A CC D  HCCP +  C+  K TC             +A+  +       V  ++C + + C    TCC      + CCP+  AVCC DH HCCP   +C L   +C +   L    +  
Sbjct:  285 TKDGDWACCPLPEAVCCEDHIHCCPQGTVCA--RSTC-VASADLLTLVRWVEKKPTINRVPQPANEKCDPTTTCPKGATCCKMESGTWGCCPLPQAVCCEDHLHCCPRNTVCNVAAGTCDSAFSGTAGQLSVPWVRKTPATSLPPANDQC-DETSACPTGTTCCRQKSGAWACCPLPQAVCCDDHEHCCPQGYKCDIIHESCDHPFLPSMLWFKKQPALQSMTQQSNANAKAIAESAVADVESKHKCDAQTSCPRDNTCCYMKKFNKWGCCPLPEAVCCGDGDHCCPNSYTCDTTKNTCLKGHLEIPWFKKQEAKVTQGSEVAHGVADVQCDSTARCPTGSTCCRLTTGQWGCCPHVQAVCCDDHVHCCPAGYTCDLQAGTCLRTSTLHTVALTL 675          

HSP 5 Score: 197.593 bits (501), Expect = 1.040e-55
Identity = 126/382 (32.98%), Postives = 183/382 (47.91%), Query Frame = 2
Query:  263 GSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKL----KVPASSI--LSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECP--------------------DGSSTCKTGATCCLLSD-GSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDS--------KTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKISPILV---ESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKF 1294
            G++ CCP   AVCC D  HCCP+NT CN+  GTCDS       ++ +    K PA+S+   +  C + S C  G++CC    G +ACCP   AVCC D +HCCPQ   C++   +CD      +   K K PA+ +++ +                      D  ++C    TCC +     +GCCP   AVCC D   CCP +  C+    TC          K ++  +   +   + V  V C D+  +C  G TCC+L TG  +GCCP+  A CC D +HCCP    C++  GTC   +    + ++ +     E + C   S C +  TCC  ++  ++CCP+  AVCC D  HCCP    C    K C +   L +
Sbjct:  367 GTWGCCPLPQAVCCEDHLHCCPRNTVCNVAAGTCDSAFSGTAGQLSVPWVRKTPATSLPPANDQCDETSACPTGTTCCRQKSGAWACCPLPQAVCCDDHEHCCPQGYKCDIIHESCDHPFLPSMLWFK-KQPALQSMTQQSNANAKAIAESAVADVESKHKCDAQTSCPRDNTCCYMKKFNKWGCCPLPEAVCCGDGDHCCPNSYTCDTTKNTCLKGHLEIPWFKKQEAKVTQGSEVAHGVADVQC-DSTARCPTGSTCCRLTTG-QWGCCPHVQAVCCDDHVHCCPAGYTCDLQAGTCLRTSTLHTVALTLVHTHTKEQVMCDATSHCTESQTCCKLSDTEWACCPFKQAVCCKDMKHCCPVGYVCDPKAKGCARATSLTW 745          
BLAST of Granulin precursor vs. Ensembl Cavefish
Match: grna (granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434])

HSP 1 Score: 219.164 bits (557), Expect = 1.260e-63
Identity = 143/379 (37.73%), Postives = 191/379 (50.40%), Query Frame = 2
Query:  260 DGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDS------VLKEVVTK--IKLKVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKL--------KIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKT-------KKPSLLIKTFQPNPVNRVICP-DAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEA---LEIKIS-PI----------LVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNI 1282
            +G +SCCP   AVCC D  HCCP   +CNL  G C+        LK+V ++   + K+P + + +V C D + C D ++CC  ++G + CCP   AVCC D  HCCP    CNL+AGTC+     V    KL        K+P     ++ C D ++ C    TCC  S+G + CCP   AVCC D   CCP    CN+ AGTC+  +       K PS  I   +   V     P +A + C D  TCCK   G  + CCP   A CC D +HCCP    CN+   TCD  + +   LE K S PI             ++ C +   C    TCC   N  +SCCP+P  VCC D  HCCP++ +C+L T +CDKN 
Sbjct:  307 EGGWSCCPLPQAVCCDDFLHCCPHGKKCNLIAGKCEDPSGSVPWLKKVPSRPIREKKLPETKVYNVPCNDTAACPDETTCCKDSEGEWKCCPLPQAVCCDDFIHCCPHGKKCNLAAGTCEDPSGSVPWMKKLPSQPIKGKKLPETKVYNVPCND-TAACPDETTCCKDSEGEWKCCPLPQAVCCDDFQHCCPHGKKCNVAAGTCEDPSGSVPWIKKVPSRPISGKKLPKVKGAGVPCNATFACEDESTCCKNDKG-GWSCCPLPEAVCCEDFLHCCPHGKKCNLAAMTCDDPSGSIPWLEKKPSRPIGGQNKEKGKAAAANVSCDSSHFCPASSTCCKDVNAEWSCCPFPQGVCCEDRIHCCPHDATCNLRTLTCDKNT 683          

HSP 2 Score: 200.675 bits (509), Expect = 8.736e-57
Identity = 134/410 (32.68%), Postives = 183/410 (44.63%), Query Frame = 2
Query:  254 TTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTC-----------------------------------------DSVLKEVVTKIKLKVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSK------LKEVVTK--MKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAKY---------QCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEI------------KISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCD 1273
            TTDG + CCP   AVCC+DK HCCP+N+ C++N   C                                          + LK   T        S++ +V C D   C DG++CC   +G ++CCP   AVCC D  HCCP    CNL AG C+        LK+V ++   + K+P     ++ C D ++ C    TCC  S+G + CCP   AVCC D + CCP    CNL AGTC+  +     + K     P+     P+ K           C D  TCCK   G+ + CCP   A CC D  HCCP    CN+  GTC+  + ++              K+  +    + C     C  + TCC +    +SCCP P AVCC D  HCCP+   C+L   +CD
Sbjct:  188 TTDGGWGCCPMPRAVCCADKVHCCPENSVCHVNSSKCVSSTNKELPMWAKFPARLRADWENHRPVAVTPKLTNKQPKTSTALKSTTTNKTRNATVSTVYNVPCDDTVACADGTTCCKNGEGGWSCCPLPQAVCCDDFLHCCPHGKKCNLIAGKCEDPSGSVPWLKKVPSRPIREKKLPETKVYNVPCND-TAACPDETTCCKDSEGEWKCCPLPQAVCCDDFIHCCPHGKKCNLAAGTCEDPSGSVPWM-KKLPSQPIKGKKLPETKVYNVPCNDTAACPDETTCCKDSEGE-WKCCPLPQAVCCDDFQHCCPHGKKCNVAAGTCEDPSGSVPWIKKVPSRPISGKKLPKVKGAGVPCNATFACEDESTCCKNDKGGWSCCPLPEAVCCEDFLHCCPHGKKCNLAAMTCD 594          

HSP 3 Score: 176.792 bits (447), Expect = 2.797e-48
Identity = 124/410 (30.24%), Postives = 178/410 (43.41%), Query Frame = 2
Query:  251 VTTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILS---------------VVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTF-----------------------QP-------------------NPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEAL------------EIKISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCD 1273
            V + G Y+CCP+    CC D  HCCP    C   +  C +    +      + PA + L+               ++CPD S C    SC  + D  + CCP +  + C+D+ HCCP +  C+  + +C  K + V+                CPDG S C    TCC  +DG +GCCP   AVCC+DK+ CCP+N+VC++ +  C S T K   +   F                       QP                   + V  V C D    C+DG TCCK   G  + CCP   A CC D +HCCP    CN+  G C+  + ++            E K+    V ++ C + + C  + TCC  +   + CCP P AVCC D  HCCP+   C+L   +C+
Sbjct:   38 VLSSGEYNCCPFPQGECCEDHLHCCPAGMLCQTAESKCQNSTHSL--SWTERKPAQAYLAKSFRMISSSTANKDNIICPDNSSCPPEFSCLKLTD-KYGCCPVTQGIVCADRNHCCPNDHECSADSISCVKKAEPVM----------------CPDGVSECPVQTTCCPTTDGGWGCCPMPRAVCCADKVHCCPENSVCHVNSSKCVSSTNKELPMWAKFPARLRADWENHRPVAVTPKLTNKQPKTSTALKSTTTNKTRNATVSTVYNVPC-DDTVACADGTTCCKNGEG-GWSCCPLPQAVCCDDFLHCCPHGKKCNLIAGKCEDPSGSVPWLKKVPSRPIREKKLPETKVYNVPCNDTAACPDETTCCKDSEGEWKCCPLPQAVCCDDFIHCCPHGKKCNLAAGTCE 426          

HSP 4 Score: 175.252 bits (443), Expect = 1.078e-47
Identity = 124/364 (34.07%), Postives = 169/364 (46.43%), Query Frame = 2
Query:  257 TDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKL--------KVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKL--------KIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKT-------KKPSLLI----KTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKS 1267
            ++G + CCP   AVCC D  HCCP   +CNL  GTC+     V    KL        K+P + + +V C D + C D ++CC  ++G + CCP   AVCC D QHCCP    CN++AGTC+     V    K+        K+P +    + C + +  C+  +TCC    G + CCP   AVCC D L CCP    CNL A TCD  +       KKPS  I    K         V C D+ + C    TCCK    + + CCP+    CC D+IHCCP +  CN+   TCD    ++       +   +K        +K      AN+          V C DH H CP+ T+C    K+
Sbjct:  390 SEGEWKCCPLPQAVCCDDFIHCCPHGKKCNLAAGTCEDPSGSVPWMKKLPSQPIKGKKLPETKVYNVPCNDTAACPDETTCCKDSEGEWKCCPLPQAVCCDDFQHCCPHGKKCNVAAGTCEDPSGSVPWIKKVPSRPISGKKLPKVKGAGVPC-NATFACEDESTCCKNDKGGWSCCPLPEAVCCEDFLHCCPHGKKCNLAAMTCDDPSGSIPWLEKKPSRPIGGQNKEKGKAAAANVSC-DSSHFCPASSTCCKDVNAE-WSCCPFPQGVCCEDRIHCCPHDATCNLRTLTCDKNTTSVP------MAGPVKASGPPPPEKKKPKENKANE---------PVKCDDH-HSCPDQTTCCFMNKT 734          

HSP 5 Score: 140.198 bits (352), Expect = 1.866e-35
Identity = 110/363 (30.30%), Postives = 163/363 (44.90%), Query Frame = 2
Query:  383 VVTKIKLKVPASSILSVV----CPDQSQCDDGSSCC-VMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLS---------------IECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGD-SYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC-----------------------DHQAEALEIKISPI----------------------LVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCD 1273
            ++T +KL V A ++L +V    CP+Q  C D  +CC V++ G + CCP+    CC D  HCCP   +C  +   C +    +      + PA + L+               I CPD SS C    +C  L+D  YGCCP +  + C+D+  CCP +  C+  + +C          +K  +P     V+CPD   +C    TCC  PT D  +GCCP   A CC+DK+HCCP+N+VC++N   C                       +H+  A+  K++                         V ++ C +   C    TCC +    +SCCP P AVCC D  HCCP+   C+L    C+
Sbjct:    2 LLTMLKLMV-ALALLGLVTGTQCPNQQLCGDKHTCCQVLSSGEYNCCPFPQGECCEDHLHCCPAGMLCQTAESKCQNSTHSL--SWTERKPAQAYLAKSFRMISSSTANKDNIICPDNSS-CPPEFSCLKLTD-KYGCCPVTQGIVCADRNHCCPNDHECSADSISC----------VKKAEP-----VMCPDGVSECPVQTTCC--PTTDGGWGCCPMPRAVCCADKVHCCPENSVCHVNSSKCVSSTNKELPMWAKFPARLRADWENHRPVAVTPKLTNKQPKTSTALKSTTTNKTRNATVSTVYNVPCDDTVACADGTTCCKNGEGGWSCCPLPQAVCCDDFLHCCPHGKKCNLIAGKCE 342          

HSP 6 Score: 118.627 bits (296), Expect = 3.229e-28
Identity = 88/255 (34.51%), Postives = 130/255 (50.98%), Query Frame = 2
Query:  611 VVTKMKLKIPAISNLSI----ECPDGSSTCKTGATCC-LLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKT-------KKPS--LLIKTFQ---PNPVNR--VICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKISPILVESIKCPNG-SLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIINFHP 1315
            ++T +KL + A++ L +    +CP+    C    TCC +LS G Y CCPF    CC D L CCP   +C      C + T       +KP+   L K+F+    +  N+  +ICPD    C    +C KL   D YGCCP +    C+D+ HCCP +  C+ +  +C  +AE       P++     CP+G S C  + TCCP+ +  + CCP P AVCC+D  HCCP N+ C +N+  C  +   + P+    P
Sbjct:    2 LLTMLKLMV-ALALLGLVTGTQCPN-QQLCGDKHTCCQVLSSGEYNCCPFPQGECCEDHLHCCPAGMLCQTAESKCQNSTHSLSWTERKPAQAYLAKSFRMISSSTANKDNIICPD-NSSCPPEFSCLKL--TDKYGCCPVTQGIVCADRNHCCPNDHECSADSISCVKKAE-------PVM-----CPDGVSECPVQTTCCPTTDGGWGCCPMPRAVCCADKVHCCPENSVCHVNSSKCVSSTNKELPMWAKFP 239          
BLAST of Granulin precursor vs. Ensembl Cavefish
Match: grna (granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434])

HSP 1 Score: 216.468 bits (550), Expect = 1.291e-62
Identity = 142/379 (37.47%), Postives = 184/379 (48.55%), Query Frame = 2
Query:  260 DGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKL--------KVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKL--------KIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKT-------KKPSLLIKTFQPNPVNRVICP-DAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEA---LEIKIS-PI----------LVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNI 1282
            +G +SCCP   AVCC D  HCCP   +CNL  GTC+     V    KL        K+P + + +V C D + C D ++CC  ++G + CCP   AVCC D  HCCP    CNL+AGTC+     V    K+        K+P      + C D +  C    TCC    G + CCP   AVCC D   CCP    CN+ AGTC+  +       K PS  I   +   V     P +A + C D  TCCK   G  + CCP   A CC D +HCCP    CN+   TCD  + +   LE K S PI             ++ C +   C    TCC   N  +SCCP+P  VCC D  HCCP++ +C+L T +CDKN 
Sbjct:  307 EGGWSCCPLPQAVCCDDFIHCCPHGKKCNLAAGTCEDPSGSVPWMKKLPSQPIKGKKLPETKVYNVPCNDTAACPDETTCCKDSEGEWKCCPLPQAVCCDDFIHCCPHGKKCNLAAGTCEDPSGSVPWMKKVPSRPIKGKKLPETKGSDVPCND-TVACPDETTCCKNVKGGWNCCPLPQAVCCDDFQHCCPHGKKCNVAAGTCEDPSGSVPWIKKVPSRPISGKKLPKVKGAGVPCNATFACEDESTCCKNDKG-GWSCCPLPEAVCCEDFLHCCPHGKKCNLAAMTCDDPSGSIPWLEKKPSRPIGGQNKEKGKAAAANVSCDSSHFCPASSTCCKDVNAEWSCCPFPQGVCCEDRIHCCPHDATCNLRTLTCDKNT 683          

HSP 2 Score: 202.216 bits (513), Expect = 2.065e-57
Identity = 135/410 (32.93%), Postives = 180/410 (43.90%), Query Frame = 2
Query:  254 TTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTC-----------------------------------------DSVLKEVVTKIKLKVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKL--------KIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAK---------YQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEI------------KISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCD 1273
            TTDG + CCP   AVCC+DK HCCP+N+ C++N   C                                          + LK   T        S++ +V C D   C DG++CC   +G ++CCP   AVCC D  HCCP    CNL+AGTC+     V    KL        K+P     ++ C D ++ C    TCC  S+G + CCP   AVCC D + CCP    CNL AGTC+  +     + K     P+     P+ K           C D  TCCK   G  + CCP   A CC D  HCCP    CN+  GTC+  + ++              K+  +    + C     C  + TCC +    +SCCP P AVCC D  HCCP+   C+L   +CD
Sbjct:  188 TTDGGWGCCPMPRAVCCADKVHCCPENSVCHVNSSKCVSSTNKELPMWAKFPARLRADWENHRPVAVTPKLTNKQPKTSTALKSTTTNKTRNATVSTVYNVPCDDTVACADGTTCCKNGEGGWSCCPLPQAVCCDDFIHCCPHGKKCNLAAGTCEDPSGSVPWMKKLPSQPIKGKKLPETKVYNVPCND-TAACPDETTCCKDSEGEWKCCPLPQAVCCDDFIHCCPHGKKCNLAAGTCEDPSGSVPWM-KKVPSRPIKGKKLPETKGSDVPCNDTVACPDETTCCKNVKG-GWNCCPLPQAVCCDDFQHCCPHGKKCNVAAGTCEDPSGSVPWIKKVPSRPISGKKLPKVKGAGVPCNATFACEDESTCCKNDKGGWSCCPLPEAVCCEDFLHCCPHGKKCNLAAMTCD 594          

HSP 3 Score: 178.333 bits (451), Expect = 8.821e-49
Identity = 125/410 (30.49%), Postives = 178/410 (43.41%), Query Frame = 2
Query:  251 VTTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILS---------------VVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTF-----------------------QP-------------------NPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEI------------KISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCD 1273
            V + G Y+CCP+    CC D  HCCP    C   +  C +    +      + PA + L+               ++CPD S C    SC  + D  + CCP +  + C+D+ HCCP +  C+  + +C  K + V+                CPDG S C    TCC  +DG +GCCP   AVCC+DK+ CCP+N+VC++ +  C S T K   +   F                       QP                   + V  V C D    C+DG TCCK   G  + CCP   A CC D IHCCP    CN+  GTC+  + ++              K+    V ++ C + + C  + TCC  +   + CCP P AVCC D  HCCP+   C+L   +C+
Sbjct:   38 VLSSGEYNCCPFPQGECCEDHLHCCPAGMLCQTAESKCQNSTHSL--SWTERKPAQAYLAKSFRMISSSTANKDNIICPDNSSCPPEFSCLKLTD-KYGCCPVTQGIVCADRNHCCPNDHECSADSISCVKKAEPVM----------------CPDGVSECPVQTTCCPTTDGGWGCCPMPRAVCCADKVHCCPENSVCHVNSSKCVSSTNKELPMWAKFPARLRADWENHRPVAVTPKLTNKQPKTSTALKSTTTNKTRNATVSTVYNVPC-DDTVACADGTTCCKNGEG-GWSCCPLPQAVCCDDFIHCCPHGKKCNLAAGTCEDPSGSVPWMKKLPSQPIKGKKLPETKVYNVPCNDTAACPDETTCCKDSEGEWKCCPLPQAVCCDDFIHCCPHGKKCNLAAGTCE 426          

HSP 4 Score: 168.318 bits (425), Expect = 3.083e-45
Identity = 125/364 (34.34%), Postives = 169/364 (46.43%), Query Frame = 2
Query:  257 TDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDS------VLKEVVTK-IK-LKVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKL--------KIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKT-------KKPSLLI----KTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKS 1267
            ++G + CCP   AVCC D  HCCP   +CNL  GTC+        +K+V ++ IK  K+P +    V C D   C D ++CC    G + CCP   AVCC D QHCCP    CN++AGTC+     V    K+        K+P +    + C + +  C+  +TCC    G + CCP   AVCC D L CCP    CNL A TCD  +       KKPS  I    K         V C D+ + C    TCCK    + + CCP+    CC D+IHCCP +  CN+   TCD    ++       +   +K        +K      AN+          V C DH H CP+ T+C    K+
Sbjct:  390 SEGEWKCCPLPQAVCCDDFIHCCPHGKKCNLAAGTCEDPSGSVPWMKKVPSRPIKGKKLPETKGSDVPCNDTVACPDETTCCKNVKGGWNCCPLPQAVCCDDFQHCCPHGKKCNVAAGTCEDPSGSVPWIKKVPSRPISGKKLPKVKGAGVPC-NATFACEDESTCCKNDKGGWSCCPLPEAVCCEDFLHCCPHGKKCNLAAMTCDDPSGSIPWLEKKPSRPIGGQNKEKGKAAAANVSC-DSSHFCPASSTCCKDVNAE-WSCCPFPQGVCCEDRIHCCPHDATCNLRTLTCDKNTTSVP------MAGPVKASGPPPPEKKKPKENKANE---------PVKCDDH-HSCPDQTTCCFMNKT 734          

HSP 5 Score: 140.969 bits (354), Expect = 9.366e-36
Identity = 110/363 (30.30%), Postives = 164/363 (45.18%), Query Frame = 2
Query:  383 VVTKIKLKVPASSILSVV----CPDQSQCDDGSSCC-VMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLS---------------IECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGD-SYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC-----------------------DHQAEALEIKISPI----------------------LVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCD 1273
            ++T +KL V A ++L +V    CP+Q  C D  +CC V++ G + CCP+    CC D  HCCP   +C  +   C +    +      + PA + L+               I CPD SS C    +C  L+D  YGCCP +  + C+D+  CCP +  C+  + +C          +K  +P     V+CPD   +C    TCC  PT D  +GCCP   A CC+DK+HCCP+N+VC++N   C                       +H+  A+  K++                         V ++ C +   C    TCC +    +SCCP P AVCC D  HCCP+   C+L   +C+
Sbjct:    2 LLTMLKLMV-ALALLGLVTGTQCPNQQLCGDKHTCCQVLSSGEYNCCPFPQGECCEDHLHCCPAGMLCQTAESKCQNSTHSL--SWTERKPAQAYLAKSFRMISSSTANKDNIICPDNSS-CPPEFSCLKLTD-KYGCCPVTQGIVCADRNHCCPNDHECSADSISC----------VKKAEP-----VMCPDGVSECPVQTTCC--PTTDGGWGCCPMPRAVCCADKVHCCPENSVCHVNSSKCVSSTNKELPMWAKFPARLRADWENHRPVAVTPKLTNKQPKTSTALKSTTTNKTRNATVSTVYNVPCDDTVACADGTTCCKNGEGGWSCCPLPQAVCCDDFIHCCPHGKKCNLAAGTCE 342          

HSP 6 Score: 118.627 bits (296), Expect = 3.319e-28
Identity = 88/255 (34.51%), Postives = 130/255 (50.98%), Query Frame = 2
Query:  611 VVTKMKLKIPAISNLSI----ECPDGSSTCKTGATCC-LLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKT-------KKPS--LLIKTFQ---PNPVNR--VICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKISPILVESIKCPNG-SLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIINFHP 1315
            ++T +KL + A++ L +    +CP+    C    TCC +LS G Y CCPF    CC D L CCP   +C      C + T       +KP+   L K+F+    +  N+  +ICPD    C    +C KL   D YGCCP +    C+D+ HCCP +  C+ +  +C  +AE       P++     CP+G S C  + TCCP+ +  + CCP P AVCC+D  HCCP N+ C +N+  C  +   + P+    P
Sbjct:    2 LLTMLKLMV-ALALLGLVTGTQCPN-QQLCGDKHTCCQVLSSGEYNCCPFPQGECCEDHLHCCPAGMLCQTAESKCQNSTHSLSWTERKPAQAYLAKSFRMISSSTANKDNIICPD-NSSCPPEFSCLKL--TDKYGCCPVTQGIVCADRNHCCPNDHECSADSISCVKKAE-------PVM-----CPDGVSECPVQTTCCPTTDGGWGCCPMPRAVCCADKVHCCPENSVCHVNSSKCVSSTNKELPMWAKFP 239          
BLAST of Granulin precursor vs. Ensembl Cavefish
Match: grna (granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434])

HSP 1 Score: 215.698 bits (548), Expect = 2.583e-62
Identity = 142/378 (37.57%), Postives = 187/378 (49.47%), Query Frame = 2
Query:  260 DGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDS------VLKEVVTK--IKLKVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKL--------KIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKT-------KKPSLLIKTFQPNPVNRVICP-DAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEA---LEIKIS-PI----------LVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKN 1279
            +G +SCCP   AVCC D  HCCP   +CNL  G C+        LK+V ++   + K+P + + +V C D + C D ++CC  ++G + CCP   AVCC D  HCCP    CNL+AGTC+     V    KL        K+P      + C D +  C    TCC    G + CCP   AVCC D   CCP    CN+ AGTC+  +       K PS  I   +   V     P +A + C D  TCCK   G  + CCP   A CC D +HCCP    CN+   TCD  + +   LE K S PI             ++ C +   C    TCC   N  +SCCP+P  VCC D  HCCP++ +C+L T +CDKN
Sbjct:  307 EGGWSCCPLPQAVCCDDFLHCCPHGKKCNLIAGKCEDPSGSVPWLKKVPSRPIREKKLPETKVYNVPCNDTAACPDETTCCKDSEGEWKCCPLPQAVCCDDFIHCCPHGKKCNLAAGTCEDPSGSVPWMKKLPSQPIKGKKLPETKGSDVPCND-TVACPDETTCCKNVKGGWNCCPLPQAVCCDDFQHCCPHGKKCNVAAGTCEDPSGSVPWIKKVPSRPISGKKLPKVKGAGVPCNATFACEDESTCCKNDKG-GWSCCPLPEAVCCEDFLHCCPHGKKCNLAAMTCDDPSGSIPWLEKKPSRPIGGQNKEKGKAAAANVSCDSSHFCPASSTCCKDVNAEWSCCPFPQGVCCEDRIHCCPHDATCNLRTLTCDKN 682          

HSP 2 Score: 199.904 bits (507), Expect = 1.823e-56
Identity = 134/410 (32.68%), Postives = 182/410 (44.39%), Query Frame = 2
Query:  254 TTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTC-----------------------------------------DSVLKEVVTKIKLKVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSK------LKEVVTK--MKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAK---------YQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEI------------KISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCD 1273
            TTDG + CCP   AVCC+DK HCCP+N+ C++N   C                                          + LK   T        S++ +V C D   C DG++CC   +G ++CCP   AVCC D  HCCP    CNL AG C+        LK+V ++   + K+P     ++ C D ++ C    TCC  S+G + CCP   AVCC D + CCP    CNL AGTC+  +     + K     P+     P+ K           C D  TCCK   G  + CCP   A CC D  HCCP    CN+  GTC+  + ++              K+  +    + C     C  + TCC +    +SCCP P AVCC D  HCCP+   C+L   +CD
Sbjct:  188 TTDGGWGCCPMPRAVCCADKVHCCPENSVCHVNSSKCVSSTNKELPMWAKFPARLRADWENHRPVAVTPKLTNKQPKTSTALKSTTTNKTRNATVSTVYNVPCDDTVACADGTTCCKNGEGGWSCCPLPQAVCCDDFLHCCPHGKKCNLIAGKCEDPSGSVPWLKKVPSRPIREKKLPETKVYNVPCND-TAACPDETTCCKDSEGEWKCCPLPQAVCCDDFIHCCPHGKKCNLAAGTCEDPSGSVPWM-KKLPSQPIKGKKLPETKGSDVPCNDTVACPDETTCCKNVKG-GWNCCPLPQAVCCDDFQHCCPHGKKCNVAAGTCEDPSGSVPWIKKVPSRPISGKKLPKVKGAGVPCNATFACEDESTCCKNDKGGWSCCPLPEAVCCEDFLHCCPHGKKCNLAAMTCD 594          

HSP 3 Score: 177.178 bits (448), Expect = 2.716e-48
Identity = 124/410 (30.24%), Postives = 178/410 (43.41%), Query Frame = 2
Query:  251 VTTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILS---------------VVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTF-----------------------QP-------------------NPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEAL------------EIKISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCD 1273
            V + G Y+CCP+    CC D  HCCP    C   +  C +    +      + PA + L+               ++CPD S C    SC  + D  + CCP +  + C+D+ HCCP +  C+  + +C  K + V+                CPDG S C    TCC  +DG +GCCP   AVCC+DK+ CCP+N+VC++ +  C S T K   +   F                       QP                   + V  V C D    C+DG TCCK   G  + CCP   A CC D +HCCP    CN+  G C+  + ++            E K+    V ++ C + + C  + TCC  +   + CCP P AVCC D  HCCP+   C+L   +C+
Sbjct:   38 VLSSGEYNCCPFPQGECCEDHLHCCPAGMLCQTAESKCQNSTHSL--SWTERKPAQAYLAKSFRMISSSTANKDNIICPDNSSCPPEFSCLKLTD-KYGCCPVTQGIVCADRNHCCPNDHECSADSISCVKKAEPVM----------------CPDGVSECPVQTTCCPTTDGGWGCCPMPRAVCCADKVHCCPENSVCHVNSSKCVSSTNKELPMWAKFPARLRADWENHRPVAVTPKLTNKQPKTSTALKSTTTNKTRNATVSTVYNVPC-DDTVACADGTTCCKNGEG-GWSCCPLPQAVCCDDFLHCCPHGKKCNLIAGKCEDPSGSVPWLKKVPSRPIREKKLPETKVYNVPCNDTAACPDETTCCKDSEGEWKCCPLPQAVCCDDFIHCCPHGKKCNLAAGTCE 426          

HSP 4 Score: 169.474 bits (428), Expect = 1.161e-45
Identity = 124/364 (34.07%), Postives = 164/364 (45.05%), Query Frame = 2
Query:  257 TDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKL--------KVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKL--------KIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKT-------KKPSLLI----KTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKS 1267
            ++G + CCP   AVCC D  HCCP   +CNL  GTC+     V    KL        K+P +    V C D   C D ++CC    G + CCP   AVCC D QHCCP    CN++AGTC+     V    K+        K+P +    + C + +  C+  +TCC    G + CCP   AVCC D L CCP    CNL A TCD  +       KKPS  I    K         V C D+ + C    TCCK    + + CCP+    CC D+IHCCP +  CN+   TCD    ++       +   +K        +K      AN+          V C DH H CP+ T+C    K+
Sbjct:  390 SEGEWKCCPLPQAVCCDDFIHCCPHGKKCNLAAGTCEDPSGSVPWMKKLPSQPIKGKKLPETKGSDVPCNDTVACPDETTCCKNVKGGWNCCPLPQAVCCDDFQHCCPHGKKCNVAAGTCEDPSGSVPWIKKVPSRPISGKKLPKVKGAGVPC-NATFACEDESTCCKNDKGGWSCCPLPEAVCCEDFLHCCPHGKKCNLAAMTCDDPSGSIPWLEKKPSRPIGGQNKEKGKAAAANVSC-DSSHFCPASSTCCKDVNAE-WSCCPFPQGVCCEDRIHCCPHDATCNLRTLTCDKNTTSVP------MAGPVKASGPPPPEKKKPKENKANE---------PVKCDDH-HSCPDQTTCCFMNKT 734          

HSP 5 Score: 140.198 bits (352), Expect = 1.902e-35
Identity = 110/363 (30.30%), Postives = 163/363 (44.90%), Query Frame = 2
Query:  383 VVTKIKLKVPASSILSVV----CPDQSQCDDGSSCC-VMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLS---------------IECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGD-SYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC-----------------------DHQAEALEIKISPI----------------------LVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCD 1273
            ++T +KL V A ++L +V    CP+Q  C D  +CC V++ G + CCP+    CC D  HCCP   +C  +   C +    +      + PA + L+               I CPD SS C    +C  L+D  YGCCP +  + C+D+  CCP +  C+  + +C          +K  +P     V+CPD   +C    TCC  PT D  +GCCP   A CC+DK+HCCP+N+VC++N   C                       +H+  A+  K++                         V ++ C +   C    TCC +    +SCCP P AVCC D  HCCP+   C+L    C+
Sbjct:    2 LLTMLKLMV-ALALLGLVTGTQCPNQQLCGDKHTCCQVLSSGEYNCCPFPQGECCEDHLHCCPAGMLCQTAESKCQNSTHSL--SWTERKPAQAYLAKSFRMISSSTANKDNIICPDNSS-CPPEFSCLKLTD-KYGCCPVTQGIVCADRNHCCPNDHECSADSISC----------VKKAEP-----VMCPDGVSECPVQTTCC--PTTDGGWGCCPMPRAVCCADKVHCCPENSVCHVNSSKCVSSTNKELPMWAKFPARLRADWENHRPVAVTPKLTNKQPKTSTALKSTTTNKTRNATVSTVYNVPCDDTVACADGTTCCKNGEGGWSCCPLPQAVCCDDFLHCCPHGKKCNLIAGKCE 342          

HSP 6 Score: 118.627 bits (296), Expect = 3.259e-28
Identity = 88/255 (34.51%), Postives = 130/255 (50.98%), Query Frame = 2
Query:  611 VVTKMKLKIPAISNLSI----ECPDGSSTCKTGATCC-LLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKT-------KKPS--LLIKTFQ---PNPVNR--VICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKISPILVESIKCPNG-SLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIINFHP 1315
            ++T +KL + A++ L +    +CP+    C    TCC +LS G Y CCPF    CC D L CCP   +C      C + T       +KP+   L K+F+    +  N+  +ICPD    C    +C KL   D YGCCP +    C+D+ HCCP +  C+ +  +C  +AE       P++     CP+G S C  + TCCP+ +  + CCP P AVCC+D  HCCP N+ C +N+  C  +   + P+    P
Sbjct:    2 LLTMLKLMV-ALALLGLVTGTQCPN-QQLCGDKHTCCQVLSSGEYNCCPFPQGECCEDHLHCCPAGMLCQTAESKCQNSTHSLSWTERKPAQAYLAKSFRMISSSTANKDNIICPD-NSSCPPEFSCLKL--TDKYGCCPVTQGIVCADRNHCCPNDHECSADSISCVKKAE-------PVM-----CPDGVSECPVQTTCCPTTDGGWGCCPMPRAVCCADKVHCCPENSVCHVNSSKCVSSTNKELPMWAKFP 239          
BLAST of Granulin precursor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009302.1 (pep scaffold:Pmarinus_7.0:GL483232:1183:11161:1 gene:ENSPMAG00000008413.1 transcript:ENSPMAT00000009302.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 258.84 bits (660), Expect = 5.691e-79
Identity = 157/364 (43.13%), Postives = 193/364 (53.02%), Query Frame = 2
Query:  254 TTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILS----VVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMK---LKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDS-------KTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKI-SPILV-----ESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNIL 1285
            T  G ++CCP   AVCC D +HCCPQ T CNL   TCD     +      K PA  +      V+C DQS C DG++CC M  G++ CCP   AVCC D QHCCP+ T CNL    CD     +    K   L++    N+ I   D   +C  G TCC L  G +GCCP   AVCC D   CCPQ T CNLPA TCD         TK P+L +        N VIC D ++ C DG TCCK+P+GD +GCCP   A CC D  HCCPQ T CN+   TCD  A +L     +P L        +KC +   C  + TCC +    + CCP   AVCC DH HCCP  T+C++   SCD+  L
Sbjct:  307 TPGGDWACCPLVKAVCCDDHEHCCPQGTTCNLPAQTCDQ--GTLSLPWSTKTPALRVAGEPNVVICDDQSSCPDGNTCCKMPSGDWGCCPLPKAVCCDDHQHCCPEGTTCNLPVERCDKGTLSLPWSTKTPALRVAGEPNVVIC--DDQFSCPDGNTCCKLPSGDWGCCPLVKAVCCDDHEHCCPQGTTCNLPAQTCDQGTLSLPWSTKTPALRVA----GEPNVVIC-DDQFSCPDGDTCCKMPSGD-WGCCPLVKAVCCDDHEHCCPQGTTCNLPAQTCDKGALSLPWSTKTPALRVAGEPNDVKCDDQVSCPDQTTCCKTGTGDWGCCPLVKAVCCDDHEHCCPEGTTCNVPAGSCDQGQL 660          

HSP 2 Score: 258.455 bits (659), Expect = 7.698e-79
Identity = 158/370 (42.70%), Postives = 195/370 (52.70%), Query Frame = 2
Query:  254 TTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILS----VVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMK---LKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDS-------KTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDH---------QAEALEIKISPILV---ESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNIL 1285
            T  G ++CCP   AVCC D +HCCPQ T CNL   TCD     +      K PA  +      V+C DQS C DG++CC    G++ACCP   AVCC D +HCCPQ T CNL A TCD     +    K   L++    N+ I   D  S+C  G TCC +  G +GCCP   AVCC D   CCP+ T CNLP   CD         TK P+L +        N VIC D ++ C DG TCCKLP+GD +GCCP   A CC D  HCCPQ T CN+   TCD          +  AL +   P +V   +   CP+G       TCC   +  + CCP   AVCC DH HCCP  T+C+L  ++CDK  L
Sbjct:  229 TPGGDWACCPLVKAVCCDDHEHCCPQGTTCNLPAQTCDQ--GTLSLPWSTKTPALRVAGEPNVVICDDQSSCPDGNTCCKTPGGDWACCPLVKAVCCDDHEHCCPQGTTCNLPAQTCDQGTLSLPWSTKTPALRVAGEPNVVIC--DDQSSCPDGNTCCKMPSGDWGCCPLPKAVCCDDHQHCCPEGTTCNLPVERCDKGTLSLPWSTKTPALRVA----GEPNVVIC-DDQFSCPDGNTCCKLPSGD-WGCCPLVKAVCCDDHEHCCPQGTTCNLPAQTCDQGTLSLPWSTKTPALRVAGEPNVVICDDQFSCPDGD------TCCKMPSGDWGCCPLVKAVCCDDHEHCCPQGTTCNLPAQTCDKGAL 582          

HSP 3 Score: 241.121 bits (614), Expect = 2.427e-72
Identity = 151/371 (40.70%), Postives = 191/371 (51.48%), Query Frame = 2
Query:  251 VTTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILS----VVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMK---LKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDS-------KTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDH---------QAEALEIKISPILV---ESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNIL 1285
            +   G + CCP   AVCC DK+HCCP+ T CN+   TC+     +      K PA  +      V C D   C DG++CC    G++ACCP   AVCC D +HCCPQ T CNL A TCD     +    K   L++    N+ I   D  S+C  G TCC    G + CCP   AVCC D   CCPQ T CNLPA TCD         TK P+L +        N VIC D +  C DG TCCK+P+GD +GCCP   A CC D  HCCP+ T CN+    CD          +  AL +   P +V   +   CP+G+      TCC   +  + CCP   AVCC DH HCCP  T+C+L  ++CD+  L
Sbjct:  150 ILPSGQWGCCPLPKAVCCDDKEHCCPEGTICNVTSQTCNHAALSL--PWSTKTPALRMTGEPNDVQCDDLVGCPDGNTCCKTPGGDWACCPLVKAVCCDDHEHCCPQGTTCNLPAQTCDQGTLSLPWSTKTPALRVAGEPNVVIC--DDQSSCPDGNTCCKTPGGDWACCPLVKAVCCDDHEHCCPQGTTCNLPAQTCDQGTLSLPWSTKTPALRVA----GEPNVVIC-DDQSSCPDGNTCCKMPSGD-WGCCPLPKAVCCDDHQHCCPEGTTCNLPVERCDKGTLSLPWSTKTPALRVAGEPNVVICDDQFSCPDGN------TCCKLPSGDWGCCPLVKAVCCDDHEHCCPQGTTCNLPAQTCDQGTL 504          

HSP 4 Score: 234.187 bits (596), Expect = 8.331e-70
Identity = 148/368 (40.22%), Postives = 185/368 (50.27%), Query Frame = 2
Query:  263 GSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILS----VVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMK---LKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDS-------KTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEAL--------EIKISPILVES-------IKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKN 1279
            G + CCP   AVCC D QHCCP+ T CNL    CD     +      K PA  +      V+C DQ  C DG++CC +  G++ CCP   AVCC D +HCCPQ T CNL A TCD     +    K   L++    N+ I   D   +C  G TCC +  G +GCCP   AVCC D   CCPQ T CNLPA TCD         TK P+L +   +PN V      D +  C D  TCCK  TGD +GCCP   A CC D  HCCP+ T CN+  G+CD    +L          +++ +L  S       ++C +   C    TCC      + CCP P A CCSD  HCCP+  +C L   SC K 
Sbjct:  388 GDWGCCPLPKAVCCDDHQHCCPEGTTCNLPVERCDK--GTLSLPWSTKTPALRVAGEPNVVICDDQFSCPDGNTCCKLPSGDWGCCPLVKAVCCDDHEHCCPQGTTCNLPAQTCDQGTLSLPWSTKTPALRVAGEPNVVIC--DDQFSCPDGDTCCKMPSGDWGCCPLVKAVCCDDHEHCCPQGTTCNLPAQTCDKGALSLPWSTKTPALRV-AGEPNDVKC----DDQVSCPDQTTCCKTGTGD-WGCCPLVKAVCCDDHEHCCPEGTTCNVPAGSCDQGQLSLPWSSKTPARTRLTALLPASAAARGGSVRCDSAYACPDGTTCCQLPQGQWGCCPLPLATCCSDFVHCCPSGYTCDLAQASCIKK 745          

HSP 5 Score: 233.417 bits (594), Expect = 1.498e-69
Identity = 149/361 (41.27%), Postives = 187/361 (51.80%), Query Frame = 2
Query:  263 GSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILS-VVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMK---LKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDS-------KTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDH---------QAEALEIKISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNIL 1285
            G Y CC    AVCCSD  HCCP+NT C+L  G C  V  ++      K P+    S V C   + C D ++CC++  G + CCP   AVCC DK+HCCP+ T+CN+++ TC+     +    K   L++    N  ++C D    C  G TCC    G + CCP   AVCC D   CCPQ T CNLPA TCD         TK P+L +        N VIC D +  C DG TCCK P GD + CCP   A CC D  HCCPQ T CN+   TCD          +  AL +   P +V    C + S C    TCC   +  + CCP P AVCC DH HCCP  T+C+L  + CDK  L
Sbjct:   79 GQYGCCSLEDAVCCSDYLHCCPKNTMCDLKLGKC--VHGKLSIPWVSKYPSKQAASDVQCDAFTSCSDQNTCCILPSGQWGCCPLPKAVCCDDKEHCCPEGTICNVTSQTCNHAALSLPWSTKTPALRMTGEPN-DVQC-DDLVGCPDGNTCCKTPGGDWACCPLVKAVCCDDHEHCCPQGTTCNLPAQTCDQGTLSLPWSTKTPALRVA----GEPNVVIC-DDQSSCPDGNTCCKTPGGD-WACCPLVKAVCCDDHEHCCPQGTTCNLPAQTCDQGTLSLPWSTKTPALRVAGEPNVV---ICDDQSSCPDGNTCCKMPSGDWGCCPLPKAVCCDDHQHCCPEGTTCNLPVERCDKGTL 426          

HSP 6 Score: 215.698 bits (548), Expect = 6.004e-63
Identity = 143/365 (39.18%), Postives = 184/365 (50.41%), Query Frame = 2
Query:  293 AVCCSDKQHCCPQNTECNLNKGTCDSVLKEV--------VTKIKLKVPASSILSVV---CPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNL-------SIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDS-------KTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDH---------QAEALEIKISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNIL 1285
            AVCCSD  HCCP  T C+L  G C      V         T    +   +  L+V    CPD + C D ++CC +A G + CC    AVCCSD  HCCP+NT+C+L  G C           KL IP +S          ++C D  ++C    TCC+L  G +GCCP   AVCC DK  CCP+ T+CN+ + TC+         TK P+L + T +PN V      D    C DG TCCK P GD + CCP   A CC D  HCCPQ T CN+   TCD          +  AL +   P +V    C + S C    TCC +    ++CCP   AVCC DH HCCP  T+C+L  ++CD+  L
Sbjct:    2 AVCCSDGLHCCPSGTVCDLAHGMCQKGKISVPWLEKTPTFTPRTWRWRLARSLAVRPPQCPDGTSCGDDATCCPLASGQYGCCSLEDAVCCSDYLHCCPKNTMCDLKLGKC--------VHGKLSIPWVSKYPSKQAASDVQC-DAFTSCSDQNTCCILPSGQWGCCPLPKAVCCDDKEHCCPEGTICNVTSQTCNHAALSLPWSTKTPALRM-TGEPNDVQC----DDLVGCPDGNTCCKTPGGD-WACCPLVKAVCCDDHEHCCPQGTTCNLPAQTCDQGTLSLPWSTKTPALRVAGEPNVV---ICDDQSSCPDGNTCCKTPGGDWACCPLVKAVCCDDHEHCCPQGTTCNLPAQTCDQGTL 348          

HSP 7 Score: 140.584 bits (353), Expect = 2.998e-36
Identity = 88/218 (40.37%), Postives = 110/218 (50.46%), Query Frame = 2
Query:  263 GSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIK---LKVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCD--------SKLKEVVTKMKLKIP---AISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPN 874
            G + CCP   AVCC D +HCCPQ T CNL   TCD     +    K   L+V A     V C DQ  C D ++CC    G++ CCP   AVCC D +HCCP+ T CN+ AG+CD        S      T++   +P   A    S+ C D +  C  G TCC L  G +GCCP   A CCSD + CCP    C+L   +C    KKP  L  T+ P 
Sbjct:  544 GDWGCCPLVKAVCCDDHEHCCPQGTTCNLPAQTCDKGALSLPWSTKTPALRV-AGEPNDVKCDDQVSCPDQTTCCKTGTGDWGCCPLVKAVCCDDHEHCCPEGTTCNVPAGSCDQGQLSLPWSSKTPARTRLTALLPASAAARGGSVRC-DSAYACPDGTTCCQLPQGQWGCCPLPLATCCSDFVHCCPSGYTCDLAQASC---IKKPHFL--TWAPK 754          
BLAST of Granulin precursor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001039.1 (pep scaffold:Pmarinus_7.0:GL484091:11570:24665:-1 gene:ENSPMAG00000000936.1 transcript:ENSPMAT00000001039.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 152.91 bits (385), Expect = 5.012e-41
Identity = 115/343 (33.53%), Postives = 150/343 (43.73%), Query Frame = 2
Query:  263 GSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTK-IKLKVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPV--NRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALE-IKISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKN 1279
            G + CC    A CCSD  HCCP  T C + +    + L   + K   L  P    L V C     C    +CC    G + CC    A CCSD  HCCP  T C +      + L   + K       + +  + C  G   C+   TCC    G +GCC    A CCSD + CCP     +L     +S    P L  +     PV  N V C   +Y C   QTCC+   G  +GCC    ATCCSD IHCCP  T C +    C   +EAL  +  S  L  ++   +   C +  TCC S    + CC    A CCSD  HCCP+ T C +  + C ++
Sbjct:  239 GMWGCCNGRRATCCSDGIHCCPSMTRCLVGQCVNSAALIPWLKKEAALSGPVGDNL-VHCGGGQYCRRWQTCCRSRCGMWGCCNGRKATCCSDGIHCCPSMTRCLVGQCVNSAALIPWLKKEAALSGPVGDNVVHC-GGGQYCRRWQTCCRSRRGMWGCCNGRRATCCSDGIHCCPSGASGDLKGQCVNSAALIPWLKKEAALSGPVGDNLVHCGGGQY-CRRWQTCCRSRRG-MWGCCNGRRATCCSDGIHCCPSMTRCLVPYRLCSRSSEALSGVAGSSTLSHALPYDSRVYCRRWQTCCRSRCGMWGCCNGRRATCCSDGIHCCPSMTRCLVPYRLCSRS 577          

HSP 2 Score: 149.058 bits (375), Expect = 1.059e-39
Identity = 121/352 (34.38%), Postives = 156/352 (44.32%), Query Frame = 2
Query:  254 TTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTK-IKLKVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTK-MKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPV--NRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEAL-----EIKIS-PILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKN 1279
            +  G + CC    A CCSD  HCCP  T C + +    + L   + K   L  P    + V C     C    +CC    G + CC    A CCSD  HCCP  T C +      + L   + K   L  P   NL + C  G   C+   TCC    G +GCC    A CCSD + CCP  T C L     +S    P L  +     PV  N V C   +Y C   QTCC+   G  +GCC    ATCCSD IHCCP     ++ KG C + A  +     E  +S P+    + C  G  C +  TCC S    + CC    A CCSD  HCCP+ T C +  + C ++
Sbjct:  160 SRRGMWGCCNGRRATCCSDGIHCCPSMTRCLVGQCVNSAALIPWLKKEAALSGPVGDNV-VHCGGGQYCRRWQTCCRSRCGMWGCCNGRRATCCSDGIHCCPSMTRCLVGQCVNSAALIPWLKKEAALSGPVGDNL-VHC-GGGQYCRRWQTCCRSRCGMWGCCNGRKATCCSDGIHCCPSMTRC-LVGQCVNSAALIPWLKKEAALSGPVGDNVVHCGGGQY-CRRWQTCCRSRRG-MWGCCNGRRATCCSDGIHCCPSGASGDL-KGQCVNSAALIPWLKKEAALSGPVGDNLVHCGGGQYCRRWQTCCRSRRGMWGCCNGRRATCCSDGIHCCPSMTRCLVPYRLCSRS 504          

HSP 3 Score: 149.058 bits (375), Expect = 1.146e-39
Identity = 117/353 (33.14%), Postives = 151/353 (42.78%), Query Frame = 2
Query:  263 GSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVV-CPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPV--NRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEAL-----EIKIS-PILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKF 1294
            G + CC    A CCSD  HCCP  T C +    C    + +     L        +VV C     C    +CC    G + CC    A CCSD  HCCP  T C +      + L   + K       + +  + C  G   C+   TCC    G +GCC    A CCSD + CCP  T C L     +S    P L  +     PV  N V C   +Y C   QTCC+   G  +GCC    ATCCSD IHCCP  T C +  G C + A  +     E  +S P+    + C  G  C +  TCC S    + CC    A CCSD  HCCP+  S  L  +  +   L+ +
Sbjct:   86 GMWGCCNGRKATCCSDGIHCCPSMTRCLVPYRLCSRSSEALSVLDYLSREQQDGYNVVHCGGGQYCRRWQTCCRSRRGMWGCCNGRRATCCSDGIHCCPSMTRCLVGQCVNSAALIPWLKKEAALSGPVGDNVVHC-GGGQYCRRWQTCCRSRCGMWGCCNGRRATCCSDGIHCCPSMTRC-LVGQCVNSAALIPWLKKEAALSGPVGDNLVHCGGGQY-CRRWQTCCRSRCG-MWGCCNGRKATCCSDGIHCCPSMTRCLV--GQCVNSAALIPWLKKEAALSGPVGDNVVHCGGGQYCRRWQTCCRSRRGMWGCCNGRRATCCSDGIHCCPSGASGDLKGQCVNSAALIPW 432          

HSP 4 Score: 147.132 bits (370), Expect = 5.583e-39
Identity = 117/341 (34.31%), Postives = 149/341 (43.70%), Query Frame = 2
Query:  263 GSYSCCPYSSAVCCSDKQHCCPQNTECNL-NKGTC---DSVLKEVVTKIKLKVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPV--NRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEAL-----EIKIS-PILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSC 1249
            G + CC    A CCSD  HCCP  T C +  +G C    +++  +  +  L  P    L V C     C    +CC    G + CC    A CCSD  HCCP  T C +    C    + +     L        ++    G   C+   TCC    G +GCC    A CCSD + CCP  T C L     +S    P L  +     PV  N V C   +Y C   QTCC+   G  +GCC    ATCCSD IHCCP  T C +  G C + A  +     E  +S P+    + C  G  C +  TCC S    + CC    A CCSD  HCCP+ T C
Sbjct:    7 GMWGCCNGRKATCCSDGIHCCPSMTRCLVPYRGQCVNSAALIPWLKKEAALSGPVGDNL-VHCGGGQYCRRWQTCCRSRCGMWGCCNGRKATCCSDGIHCCPSMTRCLVPYRLCSRSSEALSVLDYLSREQQDGYNVVHCGGGQYCRRWQTCCRSRRGMWGCCNGRRATCCSDGIHCCPSMTRC-LVGQCVNSAALIPWLKKEAALSGPVGDNVVHCGGGQY-CRRWQTCCRSRCG-MWGCCNGRRATCCSDGIHCCPSMTRCLV--GQCVNSAALIPWLKKEAALSGPVGDNLVHCGGGQYCRRWQTCCRSRCGMWGCCNGRKATCCSDGIHCCPSMTRC 341          

HSP 5 Score: 128.642 bits (322), Expect = 1.539e-32
Identity = 99/271 (36.53%), Postives = 127/271 (46.86%), Query Frame = 2
Query:  473 CCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNL-SAGTC---DSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLL--IKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEAL-----EIKIS-PILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSC 1249
            CC    G + CC    A CCSD  HCCP  T C +   G C    + +  +  +  L  P   NL + C  G   C+   TCC    G +GCC    A CCSD + CCP  T C +P   C   ++  S+L  +   Q +  N V C   +Y C   QTCC+   G  +GCC    ATCCSD IHCCP  T C +  G C + A  +     E  +S P+    + C  G  C +  TCC S    + CC    A CCSD  HCCP+ T C
Sbjct:    1 CCRSRCGMWGCCNGRKATCCSDGIHCCPSMTRCLVPYRGQCVNSAALIPWLKKEAALSGPVGDNL-VHC-GGGQYCRRWQTCCRSRCGMWGCCNGRKATCCSDGIHCCPSMTRCLVPYRLCSRSSEALSVLDYLSREQQDGYNVVHCGGGQY-CRRWQTCCRSRRG-MWGCCNGRRATCCSDGIHCCPSMTRCLV--GQCVNSAALIPWLKKEAALSGPVGDNVVHCGGGQYCRRWQTCCRSRCGMWGCCNGRRATCCSDGIHCCPSMTRC 265          

HSP 6 Score: 124.405 bits (311), Expect = 5.065e-31
Identity = 92/281 (32.74%), Postives = 122/281 (43.42%), Query Frame = 2
Query:  263 GSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTK-IKLKVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSK--LKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKISPI 1096
            G + CC    A CCSD  HCCP  T C + +    + L   + K   L  P    + V C     C    +CC    G + CC    A CCSD  HCCP     +L     +S   +  +  +  L  P   NL + C  G   C+   TCC    G +GCC    A CCSD + CCP  T C +P   C   ++    L      + ++  +  D++  C   QTCC+   G  +GCC    ATCCSD IHCCP  T C +    C   +EAL      I
Sbjct:  315 GMWGCCNGRKATCCSDGIHCCPSMTRCLVGQCVNSAALIPWLKKEAALSGPVGDNV-VHCGGGQYCRRWQTCCRSRRGMWGCCNGRRATCCSDGIHCCPSGASGDLKGQCVNSAALIPWLKKEAALSGPVGDNL-VHC-GGGQYCRRWQTCCRSRRGMWGCCNGRRATCCSDGIHCCPSMTRCLVPYRLC---SRSSEALSGVAGSSTLSHALPYDSRVYCRRWQTCCRSRCG-MWGCCNGRRATCCSDGIHCCPSMTRCLVPYRLCSRSSEALSGVAGRI 588          

HSP 7 Score: 67.3958 bits (163), Expect = 2.834e-12
Identity = 43/114 (37.72%), Postives = 58/114 (50.88%), Query Frame = 2
Query:  959 YGCCPYSAATCCSDKIHCCPQNTVCNI-NKGTCDHQAEAL-----EIKIS-PILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKN 1279
            +GCC    ATCCSD IHCCP  T C +  +G C + A  +     E  +S P+    + C  G  C +  TCC S    + CC    A CCSD  HCCP+ T C +  + C ++
Sbjct:    9 WGCCNGRKATCCSDGIHCCPSMTRCLVPYRGQCVNSAALIPWLKKEAALSGPVGDNLVHCGGGQYCRRWQTCCRSRCGMWGCCNGRKATCCSDGIHCCPSMTRCLVPYRLCSRS 122          
BLAST of Granulin precursor vs. Ensembl Nematostella
Match: EDO27824 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T870])

HSP 1 Score: 123.25 bits (308), Expect = 9.829e-33
Identity = 83/229 (36.24%), Postives = 111/229 (48.47%), Query Frame = 2
Query:  413 ASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCD-SKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIK--TFQPNP--------VNRVI------CPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKG 1048
            AS    + C D S C D  +CC ++ G++ CCP  +AVCCSD +HCCP    C++S+ TCD +K    +      +       I+C DGS  C TG TCCL+    YGCCP  +AVCC+D   CCP    CN  +G C        +  K  +  P P        ++  I         A   C    TCC   +     CCP   A+CCSD +HCCPQ  +C+  KG
Sbjct:    1 ASGANYITCNDGSHCYDYETCCELSTGSYGCCPLPNAVCCSDGKHCCPCGYHCDISSSTCDMAKDSTPMVSYHATVQRAGVGEIKCKDGSH-CNTGETCCLVGPTKYGCCPLPSAVCCADMQHCCPSGYTCNDKSGHCQRGRHVLPMFQKHPSVHPRPAVAKTPVIIDHTIRFVPRGGRGAGCACEPYHTCCGSSSAQQ-NCCPLPNASCCSDGLHCCPQGFICDDQKG 227          

HSP 2 Score: 119.783 bits (299), Expect = 2.286e-31
Identity = 74/201 (36.82%), Postives = 96/201 (47.76%), Query Frame = 2
Query:  263 GSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEV-VTKIKLKVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMK----------LKIPAISNLSIE-CPDGSS----TCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAG 817
            GSY CCP  +AVCCSD +HCCP    C+++  TCD       +      V  + +  + C D S C+ G +CC++    + CCP  SAVCC+D QHCCP    CN  +G C      +    K           K P I + +I   P G       C+   TCC  S     CCP  NA CCSD L CCPQ  +C+   G
Sbjct:   27 GSYGCCPLPNAVCCSDGKHCCPCGYHCDISSSTCDMAKDSTPMVSYHATVQRAGVGEIKCKDGSHCNTGETCCLVGPTKYGCCPLPSAVCCADMQHCCPSGYTCNDKSGHCQRGRHVLPMFQKHPSVHPRPAVAKTPVIIDHTIRFVPRGGRGAGCACEPYHTCCGSSSAQQNCCPLPNASCCSDGLHCCPQGFICDDQKG 227          

HSP 3 Score: 115.931 bits (289), Expect = 5.407e-30
Identity = 91/230 (39.57%), Postives = 115/230 (50.00%), Query Frame = 2
Query:  659 IECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCD-SKTKKPSL-LIKTFQPNPVNRVICPDAKYQCSDGQTCCKL-PTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEAL-------------EIKISPILVE-SIK-CPNGS-----LCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKN 1279
            I C DGS  C    TCC LS GSYGCCP  NAVCCSD   CCP    C++ + TCD +K   P +    T Q   V  + C D  + C+ G+TCC + PT   YGCCP  +A CC+D  HCCP    CN   G C      L              +  +P++++ +I+  P G       C    TCC S++   +CCP PNA CCSD  HCCP    C  + K C K 
Sbjct:    7 ITCNDGSH-CYDYETCCELSTGSYGCCPLPNAVCCSDGKHCCPCGYHCDISSSTCDMAKDSTPMVSYHATVQRAGVGEIKCKDGSH-CNTGETCCLVGPT--KYGCCPLPSAVCCADMQHCCPSGYTCNDKSGHCQRGRHVLPMFQKHPSVHPRPAVAKTPVIIDHTIRFVPRGGRGAGCACEPYHTCCGSSSAQQNCCPLPNASCCSDGLHCCPQGFICD-DQKGCVKQ 231          

HSP 4 Score: 97.8265 bits (242), Expect = 1.943e-23
Identity = 60/151 (39.74%), Postives = 79/151 (52.32%), Query Frame = 2
Query:  878 VNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEA-----LEIKISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIINFHP 1315
             N + C D  + C D +TCC+L TG SYGCCP   A CCSD  HCCP    C+I+  TCD   ++         +    V  IKC +GS C    TCC      Y CCP P+AVCC+D  HCCP+  +C+  +  C +   +  P+   HP
Sbjct:    4 ANYITCNDGSH-CYDYETCCELSTG-SYGCCPLPNAVCCSDGKHCCPCGYHCDISSSTCDMAKDSTPMVSYHATVQRAGVGEIKCKDGSHCNTGETCCLVGPTKYGCCPLPSAVCCADMQHCCPSGYTCNDKSGHCQRGRHV-LPMFQKHP 151          
BLAST of Granulin precursor vs. Ensembl Medaka
Match: grnb (granulin precursor [Source:NCBI gene;Acc:101166910])

HSP 1 Score: 253.447 bits (646), Expect = 3.704e-76
Identity = 152/370 (41.08%), Postives = 204/370 (55.14%), Query Frame = 2
Query:  260 DGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSI---------LSVVCP-DQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSK---TKKPSLLIKTFQP---NPVNRVICP-DAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDH-QAEALEIKIS-----PILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPI 1300
            DGS+ CCP+  AVCC D++HCCP+ T C+L    C S   +    ++ KVPA  +          SVVCP  +S C +  +CC++  G+F CCPY  A CCSD  HCCP NT C+L  G C S    V     ++  + S   + CPD  S C  G TCC L++G++GCCP  NAVCCSD + CCP+ T C+L   TC S    T +  ++  +  P   +PV  +  P +A   C+DG TCC+   G  +GCCP   A CC D +HCCP  TVCN+   TCD     AL   +S     P   E+ +C   + C  + TCC +    ++CCP P AVCC DH HCCPN T C+L  ++CD    L  P+
Sbjct:   69 DGSWGCCPFPKAVCCEDQRHCCPEGTTCDLVHSKCASPSLQAFPMLQ-KVPAQRVGTLPVFAAAASVVCPGGKSSCPNSFTCCLLTSGDFGCCPYPQATCCSDHLHCCPGNTTCDLERGVCKSGEARV---EPIRAVSASPEDVLCPDQRSMCPDGTTCCQLNNGTFGCCPLPNAVCCSDHMHCCPEGTTCDLAHSTCVSAAGGTAEAVMVPVSGTPPKTHPVRGLAVPCNASVACADGSTCCRASRGQ-WGCCPLPEAVCCEDHLHCCPHGTVCNLVASTCDDPSGSALTPLLSNTPGFPYRSENGRCDESASCPGEATCCRTRAGGWACCPLPQAVCCDDHIHCCPNATICNLEAETCDDPSGLSPPL 433          

HSP 2 Score: 232.261 bits (591), Expect = 2.826e-68
Identity = 143/373 (38.34%), Postives = 190/373 (50.94%), Query Frame = 2
Query:  251 VTTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPDQ-SQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPA-------ISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKK---PSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQA----EALEIKISPIL---VESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIINFHP 1315
            + T G + CCPY  A CCSD  HCCP NT C+L +G C S    V     ++  ++S   V+CPDQ S C DG++CC + +G F CCP  +AVCCSD  HCCP+ T C+L+  TC S        + + +         +  L++ C + S  C  G+TCC  S G +GCCP   AVCC D L CCP  TVCNL A TCD  +     P L      P       C D    C    TCC+   G  + CCP   A CC D IHCCP  T+CN+   TCD  +        +   P L   +E  KC   ++C  + TCC +++  ++CCP P AVCCSD  HCCP    C+   ++C++      P     P
Sbjct:  151 LLTSGDFGCCPYPQATCCSDHLHCCPGNTTCDLERGVCKSGEARVE---PIRAVSASPEDVLCPDQRSMCPDGTTCCQLNNGTFGCCPLPNAVCCSDHMHCCPEGTTCDLAHSTCVSAAGGTAEAVMVPVSGTPPKTHPVRGLAVPC-NASVACADGSTCCRASRGQWGCCPLPEAVCCEDHLHCCPHGTVCNLVASTCDDPSGSALTPLLSNTPGFPYRSENGRC-DESASCPGEATCCRTRAG-GWACCPLPQAVCCDDHIHCCPNATICNLEAETCDDPSGLSPPLPWLTKRPRLTAGMEEEKCGKDAVCPGRTTCCKNSSGQWACCPLPQAVCCSDLDHCCPKGYKCNAFDRTCERPGGPSLPWRQKLP 517          

HSP 3 Score: 224.557 bits (571), Expect = 1.545e-65
Identity = 129/330 (39.09%), Postives = 184/330 (55.76%), Query Frame = 2
Query:  407 VPASSILSVVCPDQ-SQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPA---------ISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC----DHQAEALEIKIS-------PILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKF-PIINFHP*FNYY 1330
            +P + + +V+CPDQ S+C D ++CC + DG++ CCP+  AVCC D++HCCP+ T C+L    C S   +    ++ K+PA          +  S+ CP G S+C    TCCLL+ G +GCCP+  A CCSD L CCP NT C+L  G C S   +    I+    +P + V+CPD +  C DG TCC+L  G ++GCCP   A CCSD +HCCP+ T C++   TC       AEA+ + +S       P+   ++ C     C    TCC ++   + CCP P AVCC DH HCCP+ T C+L   +CD        P+++  P F Y 
Sbjct:   41 LPHTRVGAVICPDQESECPDETTCCQLPDGSWGCCPFPKAVCCEDQRHCCPEGTTCDLVHSKCASPSLQAFPMLQ-KVPAQRVGTLPVFAAAASVVCPGGKSSCPNSFTCCLLTSGDFGCCPYPQATCCSDHLHCCPGNTTCDLERGVCKSGEAR-VEPIRAVSASPED-VLCPDQRSMCPDGTTCCQLNNG-TFGCCPLPNAVCCSDHMHCCPEGTTCDLAHSTCVSAAGGTAEAVMVPVSGTPPKTHPVRGLAVPCNASVACADGSTCCRASRGQWGCCPLPEAVCCEDHLHCCPHGTVCNLVASTCDDPSGSALTPLLSNTPGFPYR 366          

HSP 4 Score: 208.764 bits (530), Expect = 9.767e-60
Identity = 130/372 (34.95%), Postives = 172/372 (46.24%), Query Frame = 2
Query:  254 TTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSV--VCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCD--SKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDS--------KTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEI------KISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIINFHP 1315
             + G + CCP   AVCC D  HCCP  T CNL   TCD      +T +    P     S    C + + C   ++CC    G +ACCP   AVCC D  HCCP  T+CNL A TCD  S L   +  +  +    + +  E     + C    TCC  S G + CCP   AVCCSD   CCP+   CN    TC+         + K P+L  ++ Q  PV      DA+  C    TCC +     +GCCP   A CC D  HCCP+   C  ++ +C   +  +           P  V  +KC N S C    TCCP     + CCP   AVCC+DH HCCP + +C++ T +C+K      P+    P
Sbjct:  309 ASRGQWGCCPLPEAVCCEDHLHCCPHGTVCNLVASTCDDPSGSALTPLLSNTPGFPYRSENGRCDESASCPGEATCCRTRAGGWACCPLPQAVCCDDHIHCCPNATICNLEAETCDDPSGLSPPLPWLTKRPRLTAGMEEEKCGKDAVCPGRTTCCKNSSGQWACCPLPQAVCCSDLDHCCPKGYKCNAFDRTCERPGGPSLPWRQKLPALQQRSGQTGPVENKC--DAQTSCPKDTTCCFMEQTLKWGCCPLPQAVCCGDGNHCCPRGHSCQPHRSSCSRGSHVVPWFTKVGALTEPSGVTDVKCDNKSSCASGTTCCPLQTGGWGCCPLVKAVCCADHEHCCPQSYTCNMQTGTCEKKAGQGLPLSRVVP 678          

HSP 5 Score: 201.445 bits (511), Expect = 4.547e-57
Identity = 145/412 (35.19%), Postives = 189/412 (45.87%), Query Frame = 2
Query:  131 HDVYRFSREFIKPITETNKIPVKVVNXXXXXXXXXXXXXXVTTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPAS-------SILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECP-DGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSK----------TKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCD----------HQAEALEIKISPILVESIKCPNGSLCGQKGTCCPSAND-SYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKN 1279
              V +     ++PI   +  P  V+     S+C DG++CC   +G++ CCP  +AVCCSD  HCCP+ T C+L   TC S        + + V  +         L+V C     C DGS+CC  + G + CCP   AVCC D  HCCP  TVCNL A TCD      +T +    P     S     D S++C   ATCC    G + CCP   AVCC D + CCP  T+CNL A TCD            TK+P L     +       +CP          TCCK  +G  + CCP   A CCSD  HCCP+   CN    TC+           +  AL+ +         KC   + C +  TCC       + CCP P AVCC D +HCCP   SC  +  SC + 
Sbjct:  185 RGVCKSGEARVEPIRAVSASPEDVLCPDQRSMCPDGTTCCQLNNGTFGCCPLPNAVCCSDHMHCCPEGTTCDLAHSTCVSAAGGTAEAVMVPVSGTPPKTHPVRGLAVPCNASVACADGSTCCRASRGQWGCCPLPEAVCCEDHLHCCPHGTVCNLVASTCDDPSGSALTPLLSNTPGFPYRSENGRCDESASCPGEATCCRTRAGGWACCPLPQAVCCDDHIHCCPNATICNLEAETCDDPSGLSPPLPWLTKRPRLTAGMEEEKCGKDAVCPGRT-------TCCKNSSGQ-WACCPLPQAVCCSDLDHCCPKGYKCNAFDRTCERPGGPSLPWRQKLPALQQRSGQTGPVENKCDAQTSCPKDTTCCFMEQTLKWGCCPLPQAVCCGDGNHCCPRGHSCQPHRSSCSRG 588          

HSP 6 Score: 186.808 bits (473), Expect = 1.094e-51
Identity = 128/370 (34.59%), Postives = 173/370 (46.76%), Query Frame = 2
Query:  254 TTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSV------LKEVVTKIKLKVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECP------DGSSTCKTGATCCLLSDG-SYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTF---QPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAE-----ALEIKISPILVESIKCPN-GSL-CGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKF 1294
            T  G ++CCP   AVCC D  HCCP  T CNL   TCD        L  +  + +L    + +    C   + C   ++CC  + G +ACCP   AVCCSD  HCCP+   CN    TC+      +   + K+PA+   S +        D  ++C    TCC +     +GCCP   AVCC D   CCP+   C     +C   +       K     +P+ V  V C D K  C+ G TCC L TG  +GCCP   A CC+D  HCCPQ+  CN+  GTC+ +A      +  +   P   + + C   G   C ++ TCC  +  ++ CCP P AVCC D  HCCP   SC L    C     L +
Sbjct:  387 TRAGGWACCPLPQAVCCDDHIHCCPNATICNLEAETCDDPSGLSPPLPWLTKRPRL---TAGMEEEKCGKDAVCPGRTTCCKNSSGQWACCPLPQAVCCSDLDHCCPKGYKCNAFDRTCERPGGPSL-PWRQKLPALQQRSGQTGPVENKCDAQTSCPKDTTCCFMEQTLKWGCCPLPQAVCCGDGNHCCPRGHSCQPHRSSCSRGSHVVPWFTKVGALTEPSGVTDVKC-DNKSSCASGTTCCPLQTG-GWGCCPLVKAVCCADHEHCCPQSYTCNMQTGTCEKKAGQGLPLSRVVPAQPQDTQDVPCDGTGEFKCPKQNTCCRISATAWGCCPSPGAVCCMDSKHCCPAGYSCDLKAGGCTLGPRLSW 750          

HSP 7 Score: 58.5362 bits (140), Expect = 7.764e-9
Identity = 34/102 (33.33%), Postives = 46/102 (45.10%), Query Frame = 2
Query: 1013 CPQNTVCNINKGTCDHQAEALEIKISPILVESIKCPNG-SLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIINFHP 1315
            CP   VC        +        +    V ++ CP+  S C  + TCC   + S+ CCP+P AVCC D  HCCP  T+C L    C    L  FP++   P
Sbjct:   17 CPDGAVCADGHKCFLNSHGGFTCPLPHTRVGAVICPDQESECPDETTCCQLPDGSWGCCPFPKAVCCEDQRHCCPEGTTCDLVHSKCASPSLQAFPMLQKVP 118          
BLAST of Granulin precursor vs. Ensembl Medaka
Match: grna (granulins [Source:NCBI gene;Acc:101162601])

HSP 1 Score: 237.654 bits (605), Expect = 5.603e-69
Identity = 144/365 (39.45%), Postives = 195/365 (53.42%), Query Frame = 2
Query:  254 TTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVV-----CPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPD----GSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIK--TFQPNPVNRVICP-DAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEI--------KISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILL 1288
            T +G + CCP+  AVCC D  HCCP+   CNL   TC+     V   +  KVP+ S +SV      C   + C D ++CC   +G + CCP+  AVCC D  HCCP+   CNL+A TC+     V   M  K+P+ SN+S++  D    GS++C    TCC   +G +GCCPF  AVCC D + CCP+   CNL A TC+       +L K  +F    V     P D    C D  TCCK   G  +GCCP+  A CC D IHCCP+   CN+   TC+    ++ +        K+S + +E + C   + C  + TCC + + ++ CCP P AVCC DH HCCP  T+C L+T SC K   L
Sbjct:  390 TQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSV--PMLEKVPSFSNVSVKMEDVPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSV--PMLEKVPSFSNVSVKMEDVPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLEKVPSFSNVSVKMEDVPCDGSTSCPDQTTCCKTQEG-GWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLEKVPSFSKVS-VKMEDVPCDGSTSCPDQTTCCKTKDGAWGCCPLPEAVCCDDHEHCCPTGTTCDLSTLSCLKASGL 748          

HSP 2 Score: 230.72 bits (587), Expect = 1.432e-66
Identity = 139/375 (37.07%), Postives = 194/375 (51.73%), Query Frame = 2
Query:  254 TTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVV-----CPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECP----DGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIK--TFQPNPVNRVICP-DAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKIS-------PILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKN-----ILLKFPIIN 1306
            T +G + CCP+  AVCC D  HCCP+   CNL   TC+     V   +  KVP+ S +SV      C   + C D ++CC   +G + CCP+  AVCC D  HCCP+   CNL+A TC+     V   M  K+P+ SN+S++      DGS++C    TCC   +G +GCCPF  AVCC D + CCP+   CNL A TC+       +L K  +F    V     P D    C D  TCCK   G  +GCCP+  A CC D IHCCP+   CN+   TC+    ++ +           + +E + C   + C  + TCC +    + CCP+P AVCC D  HCCP   +C+L  ++C+ +     +L K P  +
Sbjct:  311 TQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSV--PMLEKVPSFSKVSVKMEDVPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSV--PMLEKVPSFSNVSVKMEDVPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLEKVPSFSNVSVKMEDVPCDGSTSCPDQTTCCKTQEG-GWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLEKVPSFSNVSVKMEDVPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLEKVPSFS 680          

HSP 3 Score: 209.534 bits (532), Expect = 4.830e-59
Identity = 136/416 (32.69%), Postives = 195/416 (46.88%), Query Frame = 2
Query:  260 DGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTC----DSVL--------------------KEV------------VTKIKLKVPASSILS------------VVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPD----GSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIK--TFQPNPVNRVICP-DAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKIS-------PILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKN-----ILLKFPIIN 1306
            +G ++CCP   AVCC DK HCCP+ T C++ +  C    D  L                    KEV              ++    P  + L             + C + + C D ++CC   +G + CCP+  AVCC D  HCCP+   CNL+A TC+     V   M  K+P+ S +S++  D    GS++C    TCC   +G +GCCPF  AVCC D + CCP+   CNL A TC+       +L K  +F    V     P D    C D  TCCK   G  +GCCP+  A CC D IHCCP+   CN+   TC+    ++ +           + +E + C   + C  + TCC +    + CCP+P AVCC D  HCCP   +C+L  ++C+ +     +L K P  +
Sbjct:  189 EGKWACCPMPKAVCCDDKIHCCPEETTCDVEQMKCLSSSDKALPMWAKFPARTRADWENQKEGKEVSAVAVEGNETKNFPEVTTANPVPAFLEGSSVAGEASAKDIPCNETASCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSV--PMLEKVPSFSKVSVKMEDVPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLEKVPSFSNVSVKMEDVPCDGSTSCPDQTTCCKTQEG-GWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLEKVPSFSNVSVKMEDVPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLEKVPSFS 601          

HSP 4 Score: 202.986 bits (515), Expect = 8.534e-57
Identity = 140/410 (34.15%), Postives = 188/410 (45.85%), Query Frame = 2
Query:  254 TTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVV-----CPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPD----GSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNL-------PAGTCDSKTKKP---------SLLIKTFQP------NPVNR----------------VICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKISPILVESIK-------CPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIINFHP*F 1321
            T +G + CCP+  AVCC D  HCCP+   CNL   TC+     V   +  KVP+ S +SV      C   + C D ++CC   +G + CCP+  AVCC D  HCCP+   CNL+A TC+     V   M  K+P+ S +S++  D    GS++C    TCC   DG++GCCP   AVCC D   CCP  T C+L        +G      K P         S L+KT Q        P +R                +I  D+  QC    TCC +     +GCCP   A CC+D  HCCP +  C     +C      +         +SI+       C     C +  +CC      + CCP PNAVCC D  HCCP   +C L +KSC K + L+   +   P F
Sbjct:  548 TQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSV--PMLEKVPSFSNVSVKMEDVPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSV--PMLEKVPSFSKVSVKMEDVPCDGSTSCPDQTTCCKTKDGAWGCCPLPEAVCCDDHEHCCPTGTTCDLSTLSCLKASGLVPMSKKLPASTRTSSATSQLMKTGQETEEGENKPDDRDGQEDFDEEDKTDEEGIISCDSHTQCPQHTTCCFMKQVQKWGCCPLPKAVCCADGEHCCPADYKCKEEDTSCVKGEVVIPWYTKIPATDSIQADSSFVQCSAVHQCPEHMSCCRLFTGEWGCCPLPNAVCCGDKEHCCPEGYTCDLASKSCHKLLTLQLETVPLTPVF 953          

HSP 5 Score: 174.866 bits (442), Expect = 4.052e-47
Identity = 135/426 (31.69%), Postives = 193/426 (45.31%), Query Frame = 2
Query:  254 TTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVV-----CPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEV-VTKMKLKIPAISNLS----------------------------------------IECPDGSSTCKTGATCCLLSD-GSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPD-------AKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIK---ISPILVESIKCPNGSL------------CGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIINFHP*FN 1324
            T +G + CCP+  AVCC D  HCCP+   CNL   TC+     V   +  KVP+ S +SV      C   + C D ++CC   DG + CCP   AVCC D +HCCP  T C+LS  +C   LK   +  M  K+PA +  S                                        I C D  + C    TCC +     +GCCP   AVCC+D   CCP +  C       D+   K  ++I  +   P    I  D       A +QC +  +CC+L TG+ +GCCP   A CC DK HCCP+   C++   +C H+   L+++   ++P+ +   +  +G +            C    TCC +++ ++ CC  P AVCC D  HCCP+   C+    SC KN  L +  +N+H  F 
Sbjct:  627 TQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSV--PMLEKVPSFSKVSVKMEDVPCDGSTSCPDQTTCCKTKDGAWGCCPLPEAVCCDDHEHCCPTGTTCDLSTLSC---LKASGLVPMSKKLPASTRTSSATSQLMKTGQETEEGENKPDDRDGQEDFDEEDKTDEEGIISC-DSHTQCPQHTTCCFMKQVQKWGCCPLPKAVCCADGEHCCPADYKCKEE----DTSCVKGEVVIPWYTKIPATDSIQADSSFVQCSAVHQCPEHMSCCRLFTGE-WGCCPLPNAVCCGDKEHCCPEGYTCDLASKSC-HKLLTLQLETVPLTPVFLPDDQSQHGPVKPILNRCDDVYSCNVDETCCRTSHTTWGCCLSPKAVCCRDMKHCCPDGYRCT-KGGSCIKNTGLHW--LNWHTFFT 1037          

HSP 6 Score: 173.326 bits (438), Expect = 1.274e-46
Identity = 122/421 (28.98%), Postives = 186/421 (44.18%), Query Frame = 2
Query:  269 YSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSV------LKEVVTKIKLKVPASSILSV--------VCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTF----------------------------------QPNPV-----NRVICPDAKYQ---------CSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEI--------KISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKN-----ILLKFPIIN 1306
            Y CCP+  A CC D  HCCP++  C++   +C +       ++ V   +++   +  ++          +CPDQS+C    SC + A   + CCP +  V C D +HCCP+   C+L + +C       V K  +K       ++ C DG S C    TCC   +G + CCP   AVCC DK+ CCP+ T C++    C S + K   +   F                                    NPV        +  +A  +         C D  TCCK   G  +GCCP+  A CC D IHCCP+   CN+   TC+    ++ +        K+S + +E + C   + C  + TCC +    + CCP+P AVCC D  HCCP   +C+L  ++C+ +     +L K P  +
Sbjct:   40 YDCCPFDEAECCGDHIHCCPKDMLCDMTTSSCGNATLSMRWVERVSANLQMATKSFRMIRSYMGEDEDNICPDQSRCPAEFSC-LKALTRYGCCPLAQGVSCPDGKHCCPEGHQCSLDSRSC-------VKKESIK-------TVLCKDGVSECPDETTCCENQEGKWACCPMPKAVCCDDKIHCCPEETTCDVEQMKCLSSSDKALPMWAKFPARTRADWENQKEGKEVSAVAVEGNETKNFPEVTTANPVPAFLEGSSVAGEASAKDIPCNETASCPDQTTCCKTQEG-GWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLEKVPSFSKVS-VKMEDVPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLEKVPSFS 443          

HSP 7 Score: 169.859 bits (429), Expect = 2.323e-45
Identity = 127/417 (30.46%), Postives = 183/417 (43.88%), Query Frame = 2
Query:  269 YSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPDQ-SQCDDGSSCCVMADGNFACCPYSSAVCCSDKQ-------HCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPA--------------ISNLSIE------------------CPDGSS----------------TCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIK--TFQPNPVNRVICP-DAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKIS-------PILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKN-----ILLKFPIIN 1306
            Y CCP +  V C D +HCCP+  +C+L+  +C              V   SI +V+C D  S+C D ++CC   +G +ACCP         K        HCCP+ T C++    C S   + +  M  K PA              +S +++E                    +GSS                +C    TCC   +G +GCCPF  AVCC D + CCP+   CNL A TC+       +L K  +F    V     P D    C D  TCCK   G  +GCCP+  A CC D IHCCP+   CN+   TC+    ++ +           + +E + C   + C  + TCC +    + CCP+P AVCC D  HCCP   +C+L  ++C+ +     +L K P  +
Sbjct:  129 YGCCPLAQGVSCPDGKHCCPEGHQCSLDSRSC--------------VKKESIKTVLCKDGVSECPDETTCCENQEGKWACCPMP-------KAVCCDDKIHCCPEETTCDVEQMKCLSSSDKAL-PMWAKFPARTRADWENQKEGKEVSAVAVEGNETKNFPEVTTANPVPAFLEGSSVAGEASAKDIPCNETASCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLEKVPSFSKVSVKMEDVPCDGSTSCPDQTTCCKTQEG-GWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLEKVPSFSNVSVKMEDVPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLEKVPSFS 522          

HSP 8 Score: 137.502 bits (345), Expect = 1.843e-34
Identity = 99/369 (26.83%), Postives = 159/369 (43.09%), Query Frame = 2
Query:  407 VPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSK------LKEVVTKMKLKIPAISNL-SIECPDGSSTCKTGATC-----CLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC----------------------DHQAEALEIKI-------------------SPILVES-----------IKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKN-----ILLKFPIIN 1306
            V  + + + +CP+  +C+ G +CC     ++ CCP+  A CC D  HCCP++ +C+++  +C +       ++ V   +++   +   + S    D  + C   + C     CL +   YGCCP +  V C D   CCP+   C+L + +C    KK S          +  V+C D   +C D  TCC+   G  + CCP   A CC DKIHCCP+ T C++ +  C                      ++Q E  E+                      P  +E            I C   + C  + TCC +    + CCP+P AVCC D  HCCP   +C+L  ++C+ +     +L K P  +
Sbjct:   10 VSLALVAADMCPNGGKCEKGQTCCQSPSKDYDCCPFDEAECCGDHIHCCPKDMLCDMTTSSCGNATLSMRWVERVSANLQMATKSFRMIRSYMGEDEDNICPDQSRCPAEFSCLKALTRYGCCPLAQGVSCPDGKHCCPEGHQCSLDSRSC---VKKES----------IKTVLCKDGVSECPDETTCCENQEG-KWACCPMPKAVCCDDKIHCCPEETTCDVEQMKCLSSSDKALPMWAKFPARTRADWENQKEGKEVSAVAVEGNETKNFPEVTTANPVPAFLEGSSVAGEASAKDIPCNETASCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLEKVPSFS 364          

HSP 9 Score: 106.301 bits (264), Expect = 5.147e-24
Identity = 71/234 (30.34%), Postives = 109/234 (46.58%), Query Frame = 2
Query:  665 CPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKT----------------KKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKISPILVESIKCPNG-SLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIINFHP 1315
            CP+G   C+ G TCC      Y CCPF  A CC D + CCP++ +C++   +C + T                 K   +I+++     +  ICPD + +C    +C K  T   YGCCP +    C D  HCCP+   C+++  +C          +    ++++ C +G S C  + TCC +    ++CCP P AVCC D  HCCP  T+C +    C  +     P+    P
Sbjct:   20 CPNGGK-CEKGQTCCQSPSKDYDCCPFDEAECCGDHIHCCPKDMLCDMTTSSCGNATLSMRWVERVSANLQMATKSFRMIRSYMGEDEDN-ICPD-QSRCPAEFSCLKALT--RYGCCPLAQGVSCPDGKHCCPEGHQCSLDSRSC----------VKKESIKTVLCKDGVSECPDETTCCENQEGKWACCPMPKAVCCDDKIHCCPEETTCDVEQMKCLSSSDKALPMWAKFP 238          

HSP 10 Score: 104.76 bits (260), Expect = 1.620e-23
Identity = 75/229 (32.75%), Postives = 100/229 (43.67%), Query Frame = 2
Query:  269 YSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILS-----VVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSS----------------TCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVI 892
            + CCP   AVCC+D +HCCP + +C     +C  V  EVV     K+PA+  +      V C    QC +  SCC +  G + CCP  +AVCC DK+HCCP+         TCD   K     + L++  +    +  PD  S                +C    TCC  S  ++GCC    AVCC D   CCP    C    G+C   T    L   TF  N    +I
Sbjct:  826 WGCCPLPKAVCCADGEHCCPADYKCKEEDTSC--VKGEVVIPWYTKIPATDSIQADSSFVQCSAVHQCPEHMSCCRLFTGEWGCCPLPNAVCCGDKEHCCPEGY-------TCDLASKSCHKLLTLQLETVPLTPVFLPDDQSQHGPVKPILNRCDDVYSCNVDETCCRTSHTTWGCCLSPKAVCCRDMKHCCPDGYRCTK-GGSCIKNTGLHWLNWHTFFTNKRKAII 1044          
BLAST of Granulin precursor vs. Ensembl Medaka
Match: grna (granulins [Source:NCBI gene;Acc:101162601])

HSP 1 Score: 234.958 bits (598), Expect = 6.707e-68
Identity = 143/365 (39.18%), Postives = 194/365 (53.15%), Query Frame = 2
Query:  254 TTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVV-----CPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPD----GSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIK--TFQPNPVNRVICP-DAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEI--------KISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILL 1288
            T +G + CCP+  AVCC D  HCCP+   CNL   TC+     V   +  KVP+ S +SV      C   + C D ++CC   +G + CCP+  AVCC D  HCCP+   CNL+A TC+     V   M  K+P+ S +S++  D    GS++C    TCC   +G +GCCPF  AVCC D + CCP+   CNL A TC+       +L K  +F    V     P D    C D  TCCK   G  +GCCP+  A CC D IHCCP+   CN+   TC+    ++ +        K+S + +E + C   + C  + TCC + + ++ CCP P AVCC DH HCCP  T+C L+T SC K   L
Sbjct:  469 TQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSV--PMLEKVPSFSNVSVKMEDVPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSV--PMLEKVPSFSKVSVKMEDVPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLEKVPSFSNVSVKMEDVPCDGSTSCPDQTTCCKTQEG-GWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLEKVPSFSKVS-VKMEDVPCDGSTSCPDQTTCCKTKDGAWGCCPLPEAVCCDDHEHCCPTGTTCDLSTLSCLKASGL 827          

HSP 2 Score: 231.876 bits (590), Expect = 8.185e-67
Identity = 141/376 (37.50%), Postives = 197/376 (52.39%), Query Frame = 2
Query:  254 TTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVV-----CPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECP----DGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIK--TFQPNPVNRVICP-DAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEI--------KISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKN-----ILLKFPIIN 1306
            T +G + CCP+  AVCC D  HCCP+   CNL   TC+     V   +  KVP+ S +SV      C   + C D ++CC   +G + CCP+  AVCC D  HCCP+   CNL+A TC+     V   M  K+P+ SN+S++      DGS++C    TCC   +G +GCCPF  AVCC D + CCP+   CNL A TC+       +L K  +F    V     P D    C D  TCCK   G  +GCCP+  A CC D IHCCP+   CN+   TC+    ++ +        K+S + +E + C   + C  + TCC +    + CCP+P AVCC D  HCCP   +C+L  ++C+ +     +L K P  +
Sbjct:  311 TQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSV--PMLEKVPSFSKVSVKMEDVPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSV--PMLEKVPSFSNVSVKMEDVPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLEKVPSFSNVSVKMEDVPCDGSTSCPDQTTCCKTQEG-GWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLEKVPSFSKVS-VKMEDVPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLEKVPSFS 680          

HSP 3 Score: 209.149 bits (531), Expect = 8.568e-59
Identity = 136/416 (32.69%), Postives = 195/416 (46.88%), Query Frame = 2
Query:  260 DGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTC----DSVL--------------------KEV------------VTKIKLKVPASSILS------------VVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPD----GSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIK--TFQPNPVNRVICP-DAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKIS-------PILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKN-----ILLKFPIIN 1306
            +G ++CCP   AVCC DK HCCP+ T C++ +  C    D  L                    KEV              ++    P  + L             + C + + C D ++CC   +G + CCP+  AVCC D  HCCP+   CNL+A TC+     V   M  K+P+ S +S++  D    GS++C    TCC   +G +GCCPF  AVCC D + CCP+   CNL A TC+       +L K  +F    V     P D    C D  TCCK   G  +GCCP+  A CC D IHCCP+   CN+   TC+    ++ +           + +E + C   + C  + TCC +    + CCP+P AVCC D  HCCP   +C+L  ++C+ +     +L K P  +
Sbjct:  189 EGKWACCPMPKAVCCDDKIHCCPEETTCDVEQMKCLSSSDKALPMWAKFPARTRADWENQKEGKEVSAVAVEGNETKNFPEVTTANPVPAFLEGSSVAGEASAKDIPCNETASCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSV--PMLEKVPSFSKVSVKMEDVPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLEKVPSFSNVSVKMEDVPCDGSTSCPDQTTCCKTQEG-GWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLEKVPSFSNVSVKMEDVPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLEKVPSFS 601          

HSP 4 Score: 202.601 bits (514), Expect = 1.506e-56
Identity = 140/410 (34.15%), Postives = 188/410 (45.85%), Query Frame = 2
Query:  254 TTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVV-----CPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPD----GSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNL-------PAGTCDSKTKKP---------SLLIKTFQP------NPVNR----------------VICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKISPILVESIK-------CPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIINFHP*F 1321
            T +G + CCP+  AVCC D  HCCP+   CNL   TC+     V   +  KVP+ S +SV      C   + C D ++CC   +G + CCP+  AVCC D  HCCP+   CNL+A TC+     V   M  K+P+ S +S++  D    GS++C    TCC   DG++GCCP   AVCC D   CCP  T C+L        +G      K P         S L+KT Q        P +R                +I  D+  QC    TCC +     +GCCP   A CC+D  HCCP +  C     +C      +         +SI+       C     C +  +CC      + CCP PNAVCC D  HCCP   +C L +KSC K + L+   +   P F
Sbjct:  627 TQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSV--PMLEKVPSFSNVSVKMEDVPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSV--PMLEKVPSFSKVSVKMEDVPCDGSTSCPDQTTCCKTKDGAWGCCPLPEAVCCDDHEHCCPTGTTCDLSTLSCLKASGLVPMSKKLPASTRTSSATSQLMKTGQETEEGENKPDDRDGQEDFDEEDKTDEEGIISCDSHTQCPQHTTCCFMKQVQKWGCCPLPKAVCCADGEHCCPADYKCKEEDTSCVKGEVVIPWYTKIPATDSIQADSSFVQCSAVHQCPEHMSCCRLFTGEWGCCPLPNAVCCGDKEHCCPEGYTCDLASKSCHKLLTLQLETVPLTPVF 1032          

HSP 5 Score: 174.481 bits (441), Expect = 6.309e-47
Identity = 135/426 (31.69%), Postives = 193/426 (45.31%), Query Frame = 2
Query:  254 TTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVV-----CPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEV-VTKMKLKIPAISNLS----------------------------------------IECPDGSSTCKTGATCCLLSD-GSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPD-------AKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIK---ISPILVESIKCPNGSL------------CGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIINFHP*FN 1324
            T +G + CCP+  AVCC D  HCCP+   CNL   TC+     V   +  KVP+ S +SV      C   + C D ++CC   DG + CCP   AVCC D +HCCP  T C+LS  +C   LK   +  M  K+PA +  S                                        I C D  + C    TCC +     +GCCP   AVCC+D   CCP +  C       D+   K  ++I  +   P    I  D       A +QC +  +CC+L TG+ +GCCP   A CC DK HCCP+   C++   +C H+   L+++   ++P+ +   +  +G +            C    TCC +++ ++ CC  P AVCC D  HCCP+   C+    SC KN  L +  +N+H  F 
Sbjct:  706 TQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSV--PMLEKVPSFSKVSVKMEDVPCDGSTSCPDQTTCCKTKDGAWGCCPLPEAVCCDDHEHCCPTGTTCDLSTLSC---LKASGLVPMSKKLPASTRTSSATSQLMKTGQETEEGENKPDDRDGQEDFDEEDKTDEEGIISC-DSHTQCPQHTTCCFMKQVQKWGCCPLPKAVCCADGEHCCPADYKCKEE----DTSCVKGEVVIPWYTKIPATDSIQADSSFVQCSAVHQCPEHMSCCRLFTGE-WGCCPLPNAVCCGDKEHCCPEGYTCDLASKSC-HKLLTLQLETVPLTPVFLPDDQSQHGPVKPILNRCDDVYSCNVDETCCRTSHTTWGCCLSPKAVCCRDMKHCCPDGYRCT-KGGSCIKNTGLHW--LNWHTFFT 1116          

HSP 6 Score: 172.94 bits (437), Expect = 2.195e-46
Identity = 122/421 (28.98%), Postives = 186/421 (44.18%), Query Frame = 2
Query:  269 YSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSV------LKEVVTKIKLKVPASSILSV--------VCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTF----------------------------------QPNPV-----NRVICPDAKYQ---------CSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEI--------KISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKN-----ILLKFPIIN 1306
            Y CCP+  A CC D  HCCP++  C++   +C +       ++ V   +++   +  ++          +CPDQS+C    SC + A   + CCP +  V C D +HCCP+   C+L + +C       V K  +K       ++ C DG S C    TCC   +G + CCP   AVCC DK+ CCP+ T C++    C S + K   +   F                                    NPV        +  +A  +         C D  TCCK   G  +GCCP+  A CC D IHCCP+   CN+   TC+    ++ +        K+S + +E + C   + C  + TCC +    + CCP+P AVCC D  HCCP   +C+L  ++C+ +     +L K P  +
Sbjct:   40 YDCCPFDEAECCGDHIHCCPKDMLCDMTTSSCGNATLSMRWVERVSANLQMATKSFRMIRSYMGEDEDNICPDQSRCPAEFSC-LKALTRYGCCPLAQGVSCPDGKHCCPEGHQCSLDSRSC-------VKKESIK-------TVLCKDGVSECPDETTCCENQEGKWACCPMPKAVCCDDKIHCCPEETTCDVEQMKCLSSSDKALPMWAKFPARTRADWENQKEGKEVSAVAVEGNETKNFPEVTTANPVPAFLEGSSVAGEASAKDIPCNETASCPDQTTCCKTQEG-GWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLEKVPSFSKVS-VKMEDVPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLEKVPSFS 443          

HSP 7 Score: 169.088 bits (427), Expect = 3.688e-45
Identity = 127/417 (30.46%), Postives = 183/417 (43.88%), Query Frame = 2
Query:  269 YSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPDQ-SQCDDGSSCCVMADGNFACCPYSSAVCCSDKQ-------HCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPA--------------ISNLSIE------------------CPDGSS----------------TCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIK--TFQPNPVNRVICP-DAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKIS-------PILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKN-----ILLKFPIIN 1306
            Y CCP +  V C D +HCCP+  +C+L+  +C              V   SI +V+C D  S+C D ++CC   +G +ACCP         K        HCCP+ T C++    C S   + +  M  K PA              +S +++E                    +GSS                +C    TCC   +G +GCCPF  AVCC D + CCP+   CNL A TC+       +L K  +F    V     P D    C D  TCCK   G  +GCCP+  A CC D IHCCP+   CN+   TC+    ++ +           + +E + C   + C  + TCC +    + CCP+P AVCC D  HCCP   +C+L  ++C+ +     +L K P  +
Sbjct:  129 YGCCPLAQGVSCPDGKHCCPEGHQCSLDSRSC--------------VKKESIKTVLCKDGVSECPDETTCCENQEGKWACCPMP-------KAVCCDDKIHCCPEETTCDVEQMKCLSSSDKAL-PMWAKFPARTRADWENQKEGKEVSAVAVEGNETKNFPEVTTANPVPAFLEGSSVAGEASAKDIPCNETASCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLEKVPSFSKVSVKMEDVPCDGSTSCPDQTTCCKTQEG-GWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLEKVPSFSNVSVKMEDVPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLEKVPSFS 522          

HSP 8 Score: 137.117 bits (344), Expect = 3.038e-34
Identity = 99/369 (26.83%), Postives = 159/369 (43.09%), Query Frame = 2
Query:  407 VPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSK------LKEVVTKMKLKIPAISNL-SIECPDGSSTCKTGATC-----CLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC----------------------DHQAEALEIKI-------------------SPILVES-----------IKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKN-----ILLKFPIIN 1306
            V  + + + +CP+  +C+ G +CC     ++ CCP+  A CC D  HCCP++ +C+++  +C +       ++ V   +++   +   + S    D  + C   + C     CL +   YGCCP +  V C D   CCP+   C+L + +C    KK S          +  V+C D   +C D  TCC+   G  + CCP   A CC DKIHCCP+ T C++ +  C                      ++Q E  E+                      P  +E            I C   + C  + TCC +    + CCP+P AVCC D  HCCP   +C+L  ++C+ +     +L K P  +
Sbjct:   10 VSLALVAADMCPNGGKCEKGQTCCQSPSKDYDCCPFDEAECCGDHIHCCPKDMLCDMTTSSCGNATLSMRWVERVSANLQMATKSFRMIRSYMGEDEDNICPDQSRCPAEFSCLKALTRYGCCPLAQGVSCPDGKHCCPEGHQCSLDSRSC---VKKES----------IKTVLCKDGVSECPDETTCCENQEG-KWACCPMPKAVCCDDKIHCCPEETTCDVEQMKCLSSSDKALPMWAKFPARTRADWENQKEGKEVSAVAVEGNETKNFPEVTTANPVPAFLEGSSVAGEASAKDIPCNETASCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLEKVPSFS 364          

HSP 9 Score: 105.531 bits (262), Expect = 7.783e-24
Identity = 71/234 (30.34%), Postives = 109/234 (46.58%), Query Frame = 2
Query:  665 CPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKT----------------KKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKISPILVESIKCPNG-SLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIINFHP 1315
            CP+G   C+ G TCC      Y CCPF  A CC D + CCP++ +C++   +C + T                 K   +I+++     +  ICPD + +C    +C K  T   YGCCP +    C D  HCCP+   C+++  +C          +    ++++ C +G S C  + TCC +    ++CCP P AVCC D  HCCP  T+C +    C  +     P+    P
Sbjct:   20 CPNGGK-CEKGQTCCQSPSKDYDCCPFDEAECCGDHIHCCPKDMLCDMTTSSCGNATLSMRWVERVSANLQMATKSFRMIRSYMGEDEDN-ICPD-QSRCPAEFSCLKALT--RYGCCPLAQGVSCPDGKHCCPEGHQCSLDSRSC----------VKKESIKTVLCKDGVSECPDETTCCENQEGKWACCPMPKAVCCDDKIHCCPEETTCDVEQMKCLSSSDKALPMWAKFP 238          

HSP 10 Score: 104.375 bits (259), Expect = 2.175e-23
Identity = 75/229 (32.75%), Postives = 100/229 (43.67%), Query Frame = 2
Query:  269 YSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILS-----VVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSS----------------TCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVI 892
            + CCP   AVCC+D +HCCP + +C     +C  V  EVV     K+PA+  +      V C    QC +  SCC +  G + CCP  +AVCC DK+HCCP+         TCD   K     + L++  +    +  PD  S                +C    TCC  S  ++GCC    AVCC D   CCP    C    G+C   T    L   TF  N    +I
Sbjct:  905 WGCCPLPKAVCCADGEHCCPADYKCKEEDTSC--VKGEVVIPWYTKIPATDSIQADSSFVQCSAVHQCPEHMSCCRLFTGEWGCCPLPNAVCCGDKEHCCPEGY-------TCDLASKSCHKLLTLQLETVPLTPVFLPDDQSQHGPVKPILNRCDDVYSCNVDETCCRTSHTTWGCCLSPKAVCCRDMKHCCPDGYRCTK-GGSCIKNTGLHWLNWHTFFTNKRKAII 1123          
BLAST of Granulin precursor vs. Ensembl Medaka
Match: ENSORLT00000005071.2 (granulins [Source:NCBI gene;Acc:101168633])

HSP 1 Score: 104.375 bits (259), Expect = 8.173e-25
Identity = 86/285 (30.18%), Postives = 117/285 (41.05%), Query Frame = 2
Query:  623 MKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPS----LLIKTFQPNP------VNRV---------------ICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC--------------------------DHQAEALEIKISPILVES--------IKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPI 1300
            + L +   +  SIECPDG   C   +TCCL   G + CCP   AVCCSDK  CCP    CNL    C+ KT +P     +L K     P       N V               +  D+ Y C D  TCC+ P G ++ CCPY    CC D  HCCP    C++    C                          +  +  LE  ++ +   S        I+C +   C    +CC  A   ++CCPYP   CC+D  HCC    +C   + +C K   L +P+
Sbjct:   12 VGLSVCGFAFCSIECPDGK-LCPDLSTCCLTGHG-FSCCPLPEAVCCSDKAHCCPSGYRCNLATMMCE-KTDQPWVSLPMLTKEAAEEPPALDLSTNLVEELKNDNGLAQKSTGVQCDSFYMCPDRTTCCRHPKG-AWFCCPYYPGRCCLDGFHCCPYGYDCDLTYTHCIRDGFKYPFYYKQALTSVPAALISHPEENSIQLEKSLTALTEASDAPSEHGVIRCDSKFFCPAGTSCCKGAEGQWTCCPYPLGKCCADGRHCCQYGYTCDATSATCRK---LSYPV 289          

HSP 2 Score: 103.99 bits (258), Expect = 1.099e-24
Identity = 84/274 (30.66%), Postives = 112/274 (40.88%), Query Frame = 2
Query:  395 IKLKVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVV-----TKMKLKIPAISNLS-------------------IECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTC------------DSKTKKPSLLIKTFQPNPV------------------NRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC 1054
            + L V   +  S+ CPD   C D S+CC+   G F+CCP   AVCCSDK HCCP    CNL+   C+   +  V     TK   + P   +LS                   ++C D    C    TCC    G++ CCP+    CC D   CCP    C+L    C             + T  P+ LI   + N +                  + VI  D+K+ C  G +CCK   G  + CCPY    CC+D  HCC     C+    TC
Sbjct:   12 VGLSVCGFAFCSIECPDGKLCPDLSTCCLTGHG-FSCCPLPEAVCCSDKAHCCPSGYRCNLATMMCEKTDQPWVSLPMLTKEAAEEPPALDLSTNLVEELKNDNGLAQKSTGVQC-DSFYMCPDRTTCCRHPKGAWFCCPYYPGRCCLDGFHCCPYGYDCDLTYTHCIRDGFKYPFYYKQALTSVPAALISHPEENSIQLEKSLTALTEASDAPSEHGVIRCDSKFFCPAGTSCCKGAEG-QWTCCPYPLGKCCADGRHCCQYGYTCDATSATC 282          

HSP 3 Score: 86.6557 bits (213), Expect = 1.134e-18
Identity = 70/243 (28.81%), Postives = 96/243 (39.51%), Query Frame = 2
Query:  257 TDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDS-----VLKEVVTKIKLKVPASSILS-------------------VVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTC----------------------DSKLKEVVTKMKLKIPAISNLS--------IECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTC 823
            T   +SCCP   AVCCSDK HCCP    CNL    C+      V   ++TK   + P +  LS                   V C     C D ++CC    G + CCPY    CC D  HCCP    C+L+   C                       S  +E   +++  + A++  S        I C D    C  G +CC  ++G + CCP+    CC+D   CC     C+  + TC
Sbjct:   41 TGHGFSCCPLPEAVCCSDKAHCCPSGYRCNLATMMCEKTDQPWVSLPMLTKEAAEEPPALDLSTNLVEELKNDNGLAQKSTGVQCDSFYMCPDRTTCCRHPKGAWFCCPYYPGRCCLDGFHCCPYGYDCDLTYTHCIRDGFKYPFYYKQALTSVPAALISHPEENSIQLEKSLTALTEASDAPSEHGVIRC-DSKFFCPAGTSCCKGAEGQWTCCPYPLGKCCADGRHCCQYGYTCDATSATC 282          
BLAST of Granulin precursor vs. Ensembl Medaka
Match: ENSORLT00000029765.1 (granulins [Source:NCBI gene;Acc:101168633])

HSP 1 Score: 103.99 bits (258), Expect = 1.022e-24
Identity = 84/274 (30.66%), Postives = 112/274 (40.88%), Query Frame = 2
Query:  395 IKLKVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVV-----TKMKLKIPAISNLS-------------------IECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTC------------DSKTKKPSLLIKTFQPNPV------------------NRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC 1054
            + L V   +  S+ CPD   C D S+CC+   G F+CCP   AVCCSDK HCCP    CNL+   C+   +  V     TK   + P   +LS                   ++C D    C    TCC    G++ CCP+    CC D   CCP    C+L    C             + T  P+ LI   + N +                  + VI  D+K+ C  G +CCK   G  + CCPY    CC+D  HCC     C+    TC
Sbjct:   10 VGLSVCGFAFCSIECPDGKLCPDLSTCCLTGHG-FSCCPLPEAVCCSDKAHCCPSGYRCNLATMMCEKTDQPWVSLPMLTKEAAEEPPALDLSTNLVEELKNDNGLAQKSTGVQC-DSFYMCPDRTTCCRHPKGAWFCCPYYPGRCCLDGFHCCPYGYDCDLTYTHCIRDGFKYPFYYKQALTSVPAALISHPEENSIQLEKSLTALTEASDAPSEHGVIRCDSKFFCPAGTSCCKGAEG-QWTCCPYPLGKCCADGRHCCQYGYTCDATSATC 280          

HSP 2 Score: 102.834 bits (255), Expect = 2.206e-24
Identity = 84/277 (30.32%), Postives = 113/277 (40.79%), Query Frame = 2
Query:  623 MKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPS----LLIKTFQPNP------VNRV---------------ICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC--------------------------DHQAEALEIKISPILVES--------IKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDK 1276
            + L +   +  SIECPDG   C   +TCCL   G + CCP   AVCCSDK  CCP    CNL    C+ KT +P     +L K     P       N V               +  D+ Y C D  TCC+ P G ++ CCPY    CC D  HCCP    C++    C                          +  +  LE  ++ +   S        I+C +   C    +CC  A   ++CCPYP   CC+D  HCC    +C   + +C K
Sbjct:   10 VGLSVCGFAFCSIECPDGK-LCPDLSTCCLTGHG-FSCCPLPEAVCCSDKAHCCPSGYRCNLATMMCE-KTDQPWVSLPMLTKEAAEEPPALDLSTNLVEELKNDNGLAQKSTGVQCDSFYMCPDRTTCCRHPKG-AWFCCPYYPGRCCLDGFHCCPYGYDCDLTYTHCIRDGFKYPFYYKQALTSVPAALISHPEENSIQLEKSLTALTEASDAPSEHGVIRCDSKFFCPAGTSCCKGAEGQWTCCPYPLGKCCADGRHCCQYGYTCDATSATCRK 282          

HSP 3 Score: 86.6557 bits (213), Expect = 1.156e-18
Identity = 70/243 (28.81%), Postives = 96/243 (39.51%), Query Frame = 2
Query:  257 TDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDS-----VLKEVVTKIKLKVPASSILS-------------------VVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTC----------------------DSKLKEVVTKMKLKIPAISNLS--------IECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTC 823
            T   +SCCP   AVCCSDK HCCP    CNL    C+      V   ++TK   + P +  LS                   V C     C D ++CC    G + CCPY    CC D  HCCP    C+L+   C                       S  +E   +++  + A++  S        I C D    C  G +CC  ++G + CCP+    CC+D   CC     C+  + TC
Sbjct:   39 TGHGFSCCPLPEAVCCSDKAHCCPSGYRCNLATMMCEKTDQPWVSLPMLTKEAAEEPPALDLSTNLVEELKNDNGLAQKSTGVQCDSFYMCPDRTTCCRHPKGAWFCCPYYPGRCCLDGFHCCPYGYDCDLTYTHCIRDGFKYPFYYKQALTSVPAALISHPEENSIQLEKSLTALTEASDAPSEHGVIRC-DSKFFCPAGTSCCKGAEGQWTCCPYPLGKCCADGRHCCQYGYTCDATSATC 280          
BLAST of Granulin precursor vs. Planmine SMEST
Match: SMESG000029882.1 (SMESG000029882.1)

HSP 1 Score: 655.596 bits (1690), Expect = 0.000e+0
Identity = 332/351 (94.59%), Postives = 342/351 (97.44%), Query Frame = 2
Query:  263 GSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIINFHP 1315
            GSY+CCPYSSAVCCSDK+HCCPQNT CNL+ GTCDS LKEVVTK+KLKVPASSILSVVCPDQSQC+DGS+CC +A G++ACCPYSSAVCCSDK+HCCPQNTVCNL AGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNL AGTCDSKTKKPSLLIKTFQPNPVNRVICP AKYQCSDGQTCCKLP GDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIINFHP
Sbjct:  364 GSYACCPYSSAVCCSDKRHCCPQNTVCNLDAGTCDSKLKEVVTKMKLKVPASSILSVVCPDQSQCNDGSTCCAVAGGSYACCPYSSAVCCSDKRHCCPQNTVCNLDAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLSAGTCDSKTKKPSLLIKTFQPNPVNRVICPGAKYQCSDGQTCCKLPAGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPIINFHP 714          

HSP 2 Score: 535.028 bits (1377), Expect = 0.000e+0
Identity = 302/413 (73.12%), Postives = 339/413 (82.08%), Query Frame = 2
Query:   86 MWKFIFVVLISSVVCHDVYRFSREFIKPITETNKIPVKVVNXXXXXXXXXXXXXXVTTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQP-NPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEA----LEIKISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCD---KNILLKFPI 1300
            MWKFIFVVLISSVVCHDVYRFSREFIKPITETNKIP KVVNCPDDSVCDDGSSCCVTTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPDQSQCDDGSSCCVMADGN+ACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLK+PA S LS+ CPD  S C  G+TCC ++ GSY CCP+S+AVCCSDK  CCPQNTVCNL AGTCDSK K+    +K   P + +  V+CPD + QC+DG TCC++  G SY CCPYS+A CCSDK HCCPQNTVCN++ GTCD + +     +++K+    + S+ CP+ S C    TCC  A  SY+CCPY +AVCCSD  HCCP NT C+L+  +CD   K ++ K  +
Sbjct:    1 MWKFIFVVLISSVVCHDVYRFSREFIKPITETNKIPAKVVNCPDDSVCDDGSSCCVTTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPDQSQCDDGSSCCVMADGNYACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKVPASSILSVVCPD-QSQCNDGSTCCEVAGGSYACCPYSSAVCCSDKRHCCPQNTVCNLDAGTCDSKLKEVVTKMKLKVPASSILSVVCPD-QSQCNDGSTCCEV-AGGSYACCPYSSAVCCSDKRHCCPQNTVCNLDAGTCDSKLKEVVTKMKLKVPASSILSVVCPDQSQCNDGSTCCAVAGGSYACCPYSSAVCCSDKRHCCPQNTVCNLDAGTCDSKLKEVVTKMKL 410          

HSP 3 Score: 406.371 bits (1043), Expect = 1.664e-135
Identity = 228/343 (66.47%), Postives = 258/343 (75.22%), Query Frame = 2
Query:  263 GSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVI-CPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAE--ALEIK-ISPILVESIKCPNGSL-CGQKGTCCP-SANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCD 1273
            GSY+CCPYSSAVCCSDK+HCCPQNT CNL+ GTCDS LKEVVTK+KLKVPASSILSVVCPDQSQC+DGS+CC +A G++ACCPYSSAVCCSDK+HCCPQNTVCNL AGTCDSKLKEVVTKMKLK+PA S LS+ CPD  S C  G+TCC ++ GSY CCP+S+AVCCSDK  CCPQNTVCNL AGTCDSK K+    +K   P   N  I CPD    C  G TCC L  G SYGCCP+S A CCSDK+ CCPQNTVCN++ GTCD + +  +L IK   P  V  + CP     C    TCC   A DSY CCPY  A CCSD  HCCP NT C++N  +CD
Sbjct:  288 GSYACCPYSSAVCCSDKRHCCPQNTVCNLDAGTCDSKLKEVVTKMKLKVPASSILSVVCPDQSQCNDGSTCCAVAGGSYACCPYSSAVCCSDKRHCCPQNTVCNLDAGTCDSKLKEVVTKMKLKVPASSILSVVCPD-QSQCNDGSTCCAVAGGSYACCPYSSAVCCSDKRHCCPQNTVCNLDAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDG-SYGCCPFSNAVCCSDKLSCCPQNTVCNLSAGTCDSKTKKPSLLIKTFQPNPVNRVICPGAKYQCSDGQTCCKLPAGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCD 628          

HSP 4 Score: 176.022 bits (445), Expect = 3.267e-48
Identity = 106/209 (50.72%), Postives = 135/209 (64.59%), Query Frame = 2
Query:  251 VTTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIKLKVPASSILSVVCPD-QSQCDDGSSCCVMADGN-FACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQP 871
            + +DGSY CCP+S+AVCCSDK  CCPQNT CNL+ GTCDS  K+    IK   P + +  V+CP  + QC DG +CC +  G+ + CCPYS+A CCSDK HCCPQNTVCN++ GTCD + +     +++KI  I   SI+CP+G S C    TCC  ++ SY CCP+ NAVCCSD   CCP NT C+L   +CD K       I  F P
Sbjct:  513 LLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLSAGTCDSKTKKPSLLIKTFQP-NPVNRVICPGAKYQCSDGQTCCKLPAGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEA----LEIKISPILVESIKCPNG-SLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCD-KNILLKFPIINFHP 714          
BLAST of Granulin precursor vs. Planmine SMEST
Match: SMESG000018770.1 (SMESG000018770.1)

HSP 1 Score: 205.297 bits (521), Expect = 4.472e-61
Identity = 139/431 (32.25%), Postives = 209/431 (48.49%), Query Frame = 2
Query:   95 FIFVVLISSVVCHDVYRFSREFIKPITETNKIPVKVVNXXXXXXXXXXXXXXVTTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDS---------VLKEVVTKIKLKVPASSIL--------------SVVCPD-QSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTC-----------DSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRV--ICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQ---------AEALEIKISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSC 1249
             I  +++   +   ++ F++     ++E N+     V   + + C +  +CCVT   SY CC Y +A+CC DK HCCP  + C+  K  C           V++E +    L +  SS L               + CP+ +++C D  +CC+   GN+ CCP+ +AVCCSDK +CCP+NT C+L    C           +  LK         +  +  L  +CP+    C     CC +S G +GCC F+  +CC D  +CCP NT C+     C SK+   + +    QP    ++  ICPD   +C   +TCC +  G  YGCCP+  ATCCSD   CCP N VC++ K  C ++         +++L    S I ++ I CP+ + C     CC   ++ Y CC Y N VCC+D   CCPN T C
Sbjct:    7 MILTIIVDYALTDGIFSFNKASQDQVSEKNE----NVCPNNRTKCKETQTCCVTKHNSYHCCRYPNAICCPDKYHCCPSGSTCDAAKKRCTRNVEGPMEWPVVEENLPVKMLDLKPSSTLHGFESNSETLRVNDDITCPNNKTKCKDTKTCCITKHGNYYCCPHKNAVCCSDKYNCCPENTKCDLKNKKCLDSSAVFNSYKNPGLKSANLYTFYSLLNVDKLEKKCPNSEKQCPGQKKCCPMSGGHFGCCKFNKGICCPDMKTCCPHNTDCDSAKKACVSKSSDLTEIPNELQPEAQIKLNNICPDKHVECQSFETCCSVGDG-LYGCCPFKNATCCSDNASCCPHNKVCDLEKKVCKNKETSQPSITKSKSLLHFYSEIGLKVI-CPDQTKCENDSVCCQMDDNQYGCCSYKNGVCCADKQTCCPNGTQC 431          

HSP 2 Score: 152.91 bits (385), Expect = 1.969e-41
Identity = 107/321 (33.33%), Postives = 160/321 (49.84%), Query Frame = 2
Query:  434 VCPD-QSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTC----DSKLKEVVTKMKLKIPAIS-------------------NLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTC-DSKT-----KKPSL----LIKTFQPNPVNRV--ICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEAL-----EIKISPILVESIKCPNGSL-CGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSC 1270
            VCP+ +++C +  +CCV    ++ CC Y +A+CC DK HCCP  + C+ +   C    +  ++  V +  L +  +                    N  I CP+  + CK   TCC+   G+Y CCP  NAVCCSDK +CCP+NT C+L    C DS       K P L    L   +    V+++   CP+++ QC   + CC + +G  +GCC ++   CC D   CCP NT C+  K  C  ++  L     E++    +  +  CP+  + C    TCC   +  Y CCP+ NA CCSD++ CCP+N  C L  K C
Sbjct:   39 VCPNNRTKCKETQTCCVTKHNSYHCCRYPNAICCPDKYHCCPSGSTCDAAKKRCTRNVEGPMEWPVVEENLPVKMLDLKPSSTLHGFESNSETLRVNDDITCPNNKTKCKDTKTCCITKHGNYYCCPHKNAVCCSDKYNCCPENTKCDLKNKKCLDSSAVFNSYKNPGLKSANLYTFYSLLNVDKLEKKCPNSEKQCPGQKKCCPM-SGGHFGCCKFNKGICCPDMKTCCPHNTDCDSAKKACVSKSSDLTEIPNELQPEAQIKLNNICPDKHVECQSFETCCSVGDGLYGCCPFKNATCCSDNASCCPHNKVCDLEKKVC 358          

HSP 3 Score: 97.8265 bits (242), Expect = 6.697e-22
Identity = 72/243 (29.63%), Postives = 105/243 (43.21%), Query Frame = 2
Query:  665 CPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTK-------------------KPSLLIKTFQPNPV-----NRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKISPIL-------------VESI--KCPNGS-LCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCD 1273
            CP+  + CK   TCC+    SY CC + NA+CC DK  CCP  + C+     C    +                   KPS  +  F+ N       + + CP+ K +C D +TCC    G+ Y CCP+  A CCSDK +CCP+NT C++    C   +       +P L             V+ +  KCPN    C  +  CCP +   + CC +   +CC       P+  +C  +   CD
Sbjct:   40 CPNNRTKCKETQTCCVTKHNSYHCCRYPNAICCPDKYHCCPSGSTCDAAKKRCTRNVEGPMEWPVVEENLPVKMLDLKPSSTLHGFESNSETLRVNDDITCPNNKTKCKDTKTCCITKHGNYY-CCPHKNAVCCSDKYNCCPENTKCDLKNKKCLDSSAVFNSYKNPGLKSANLYTFYSLLNVDKLEKKCPNSEKQCPGQKKCCPMSGGHFGCCKFNKGICC-------PDMKTCCPHNTDCD 274          

HSP 4 Score: 88.1965 bits (217), Expect = 1.045e-18
Identity = 59/163 (36.20%), Postives = 78/163 (47.85%), Query Frame = 2
Query:  866 QPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEA---------------LEIKISPILV------------ESIKCPNG-SLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSC 1270
            Q +  N  +CP+ + +C + QTCC +   +SY CC Y  A CC DK HCCP  + C+  K  C    E                L++K S  L             + I CPN  + C    TCC + + +Y CCP+ NAVCCSD  +CCP NT C L  K C
Sbjct:   31 QVSEKNENVCPNNRTKCKETQTCC-VTKHNSYHCCRYPNAICCPDKYHCCPSGSTCDAAKKRCTRNVEGPMEWPVVEENLPVKMLDLKPSSTLHGFESNSETLRVNDDITCPNNKTKCKDTKTCCITKHGNYYCCPHKNAVCCSDKYNCCPENTKCDLKNKKC 192          

HSP 5 Score: 56.6102 bits (135), Expect = 1.964e-8
Identity = 27/66 (40.91%), Postives = 43/66 (65.15%), Query Frame = 2
Query: 1115 CPNG-SLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNIL--LKFPII 1303
            CPN  + C +  TCC + ++SY CC YPNA+CC D  HCCP+ ++C    K C +N+   +++P++
Sbjct:   40 CPNNRTKCKETQTCCVTKHNSYHCCRYPNAICCPDKYHCCPSGSTCDAAKKRCTRNVEGPMEWPVV 105          
BLAST of Granulin precursor vs. Planmine SMEST
Match: SMESG000018770.1 (SMESG000018770.1)

HSP 1 Score: 205.297 bits (521), Expect = 4.878e-61
Identity = 139/431 (32.25%), Postives = 209/431 (48.49%), Query Frame = 2
Query:   95 FIFVVLISSVVCHDVYRFSREFIKPITETNKIPVKVVNXXXXXXXXXXXXXXVTTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDS---------VLKEVVTKIKLKVPASSIL--------------SVVCPD-QSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTC-----------DSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRV--ICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQ---------AEALEIKISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSC 1249
             I  +++   +   ++ F++     ++E N+     V   + + C +  +CCVT   SY CC Y +A+CC DK HCCP  + C+  K  C           V++E +    L +  SS L               + CP+ +++C D  +CC+   GN+ CCP+ +AVCCSDK +CCP+NT C+L    C           +  LK         +  +  L  +CP+    C     CC +S G +GCC F+  +CC D  +CCP NT C+     C SK+   + +    QP    ++  ICPD   +C   +TCC +  G  YGCCP+  ATCCSD   CCP N VC++ K  C ++         +++L    S I ++ I CP+ + C     CC   ++ Y CC Y N VCC+D   CCPN T C
Sbjct:    1 MILTIIVDYALTDGIFSFNKASQDQVSEKNE----NVCPNNRTKCKETQTCCVTKHNSYHCCRYPNAICCPDKYHCCPSGSTCDAAKKRCTRNVEGPMEWPVVEENLPVKMLDLKPSSTLHGFESNSETLRVNDDITCPNNKTKCKDTKTCCITKHGNYYCCPHKNAVCCSDKYNCCPENTKCDLKNKKCLDSSAVFNSYKNPGLKSANLYTFYSLLNVDKLEKKCPNSEKQCPGQKKCCPMSGGHFGCCKFNKGICCPDMKTCCPHNTDCDSAKKACVSKSSDLTEIPNELQPEAQIKLNNICPDKHVECQSFETCCSVGDG-LYGCCPFKNATCCSDNASCCPHNKVCDLEKKVCKNKETSQPSITKSKSLLHFYSEIGLKVI-CPDQTKCENDSVCCQMDDNQYGCCSYKNGVCCADKQTCCPNGTQC 425          

HSP 2 Score: 152.525 bits (384), Expect = 2.656e-41
Identity = 111/332 (33.43%), Postives = 164/332 (49.40%), Query Frame = 2
Query:  434 VCPD-QSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTC----DSKLKEVVTKMKLKIPAIS-------------------NLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTC-DSKT-----KKPSL----LIKTFQPNPVNRV--ICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEAL-----EIKISPILVESIKCPNGSL-CGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNILLKFPII 1303
            VCP+ +++C +  +CCV    ++ CC Y +A+CC DK HCCP  + C+ +   C    +  ++  V +  L +  +                    N  I CP+  + CK   TCC+   G+Y CCP  NAVCCSDK +CCP+NT C+L    C DS       K P L    L   +    V+++   CP+++ QC   + CC + +G  +GCC ++   CC D   CCP NT C+  K  C  ++  L     E++    +  +  CP+  + C    TCC   +  Y CCP+ NA CCSD++ CCP+N  C L  K C KN     P I
Sbjct:   33 VCPNNRTKCKETQTCCVTKHNSYHCCRYPNAICCPDKYHCCPSGSTCDAAKKRCTRNVEGPMEWPVVEENLPVKMLDLKPSSTLHGFESNSETLRVNDDITCPNNKTKCKDTKTCCITKHGNYYCCPHKNAVCCSDKYNCCPENTKCDLKNKKCLDSSAVFNSYKNPGLKSANLYTFYSLLNVDKLEKKCPNSEKQCPGQKKCCPM-SGGHFGCCKFNKGICCPDMKTCCPHNTDCDSAKKACVSKSSDLTEIPNELQPEAQIKLNNICPDKHVECQSFETCCSVGDGLYGCCPFKNATCCSDNASCCPHNKVCDLEKKVC-KNKETSQPSI 362          

HSP 3 Score: 87.8113 bits (216), Expect = 1.380e-18
Identity = 59/163 (36.20%), Postives = 78/163 (47.85%), Query Frame = 2
Query:  866 QPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEA---------------LEIKISPILV------------ESIKCPNG-SLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSC 1270
            Q +  N  +CP+ + +C + QTCC +   +SY CC Y  A CC DK HCCP  + C+  K  C    E                L++K S  L             + I CPN  + C    TCC + + +Y CCP+ NAVCCSD  +CCP NT C L  K C
Sbjct:   25 QVSEKNENVCPNNRTKCKETQTCC-VTKHNSYHCCRYPNAICCPDKYHCCPSGSTCDAAKKRCTRNVEGPMEWPVVEENLPVKMLDLKPSSTLHGFESNSETLRVNDDITCPNNKTKCKDTKTCCITKHGNYYCCPHKNAVCCSDKYNCCPENTKCDLKNKKC 186          
BLAST of Granulin precursor vs. Planmine SMEST
Match: SMESG000018770.1 (SMESG000018770.1)

HSP 1 Score: 205.297 bits (521), Expect = 5.284e-61
Identity = 139/431 (32.25%), Postives = 209/431 (48.49%), Query Frame = 2
Query:   95 FIFVVLISSVVCHDVYRFSREFIKPITETNKIPVKVVNXXXXXXXXXXXXXXVTTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDS---------VLKEVVTKIKLKVPASSIL--------------SVVCPD-QSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTC-----------DSKLKEVVTKMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRV--ICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQ---------AEALEIKISPILVESIKCPNGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSC 1249
             I  +++   +   ++ F++     ++E N+     V   + + C +  +CCVT   SY CC Y +A+CC DK HCCP  + C+  K  C           V++E +    L +  SS L               + CP+ +++C D  +CC+   GN+ CCP+ +AVCCSDK +CCP+NT C+L    C           +  LK         +  +  L  +CP+    C     CC +S G +GCC F+  +CC D  +CCP NT C+     C SK+   + +    QP    ++  ICPD   +C   +TCC +  G  YGCCP+  ATCCSD   CCP N VC++ K  C ++         +++L    S I ++ I CP+ + C     CC   ++ Y CC Y N VCC+D   CCPN T C
Sbjct:   10 MILTIIVDYALTDGIFSFNKASQDQVSEKNE----NVCPNNRTKCKETQTCCVTKHNSYHCCRYPNAICCPDKYHCCPSGSTCDAAKKRCTRNVEGPMEWPVVEENLPVKMLDLKPSSTLHGFESNSETLRVNDDITCPNNKTKCKDTKTCCITKHGNYYCCPHKNAVCCSDKYNCCPENTKCDLKNKKCLDSSAVFNSYKNPGLKSANLYTFYSLLNVDKLEKKCPNSEKQCPGQKKCCPMSGGHFGCCKFNKGICCPDMKTCCPHNTDCDSAKKACVSKSSDLTEIPNELQPEAQIKLNNICPDKHVECQSFETCCSVGDG-LYGCCPFKNATCCSDNASCCPHNKVCDLEKKVCKNKETSQPSITKSKSLLHFYSEIGLKVI-CPDQTKCENDSVCCQMDDNQYGCCSYKNGVCCADKQTCCPNGTQC 434          

HSP 2 Score: 152.91 bits (385), Expect = 2.396e-41
Identity = 107/321 (33.33%), Postives = 160/321 (49.84%), Query Frame = 2
Query:  434 VCPD-QSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTC----DSKLKEVVTKMKLKIPAIS-------------------NLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTC-DSKT-----KKPSL----LIKTFQPNPVNRV--ICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEAL-----EIKISPILVESIKCPNGSL-CGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSC 1270
            VCP+ +++C +  +CCV    ++ CC Y +A+CC DK HCCP  + C+ +   C    +  ++  V +  L +  +                    N  I CP+  + CK   TCC+   G+Y CCP  NAVCCSDK +CCP+NT C+L    C DS       K P L    L   +    V+++   CP+++ QC   + CC + +G  +GCC ++   CC D   CCP NT C+  K  C  ++  L     E++    +  +  CP+  + C    TCC   +  Y CCP+ NA CCSD++ CCP+N  C L  K C
Sbjct:   42 VCPNNRTKCKETQTCCVTKHNSYHCCRYPNAICCPDKYHCCPSGSTCDAAKKRCTRNVEGPMEWPVVEENLPVKMLDLKPSSTLHGFESNSETLRVNDDITCPNNKTKCKDTKTCCITKHGNYYCCPHKNAVCCSDKYNCCPENTKCDLKNKKCLDSSAVFNSYKNPGLKSANLYTFYSLLNVDKLEKKCPNSEKQCPGQKKCCPM-SGGHFGCCKFNKGICCPDMKTCCPHNTDCDSAKKACVSKSSDLTEIPNELQPEAQIKLNNICPDKHVECQSFETCCSVGDGLYGCCPFKNATCCSDNASCCPHNKVCDLEKKVC 361          

HSP 3 Score: 97.8265 bits (242), Expect = 7.730e-22
Identity = 72/243 (29.63%), Postives = 105/243 (43.21%), Query Frame = 2
Query:  665 CPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTK-------------------KPSLLIKTFQPNPV-----NRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKISPIL-------------VESI--KCPNGS-LCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCD 1273
            CP+  + CK   TCC+    SY CC + NA+CC DK  CCP  + C+     C    +                   KPS  +  F+ N       + + CP+ K +C D +TCC    G+ Y CCP+  A CCSDK +CCP+NT C++    C   +       +P L             V+ +  KCPN    C  +  CCP +   + CC +   +CC       P+  +C  +   CD
Sbjct:   43 CPNNRTKCKETQTCCVTKHNSYHCCRYPNAICCPDKYHCCPSGSTCDAAKKRCTRNVEGPMEWPVVEENLPVKMLDLKPSSTLHGFESNSETLRVNDDITCPNNKTKCKDTKTCCITKHGNYY-CCPHKNAVCCSDKYNCCPENTKCDLKNKKCLDSSAVFNSYKNPGLKSANLYTFYSLLNVDKLEKKCPNSEKQCPGQKKCCPMSGGHFGCCKFNKGICC-------PDMKTCCPHNTDCD 277          

HSP 4 Score: 88.1965 bits (217), Expect = 1.092e-18
Identity = 59/163 (36.20%), Postives = 78/163 (47.85%), Query Frame = 2
Query:  866 QPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEA---------------LEIKISPILV------------ESIKCPNG-SLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSC 1270
            Q +  N  +CP+ + +C + QTCC +   +SY CC Y  A CC DK HCCP  + C+  K  C    E                L++K S  L             + I CPN  + C    TCC + + +Y CCP+ NAVCCSD  +CCP NT C L  K C
Sbjct:   34 QVSEKNENVCPNNRTKCKETQTCC-VTKHNSYHCCRYPNAICCPDKYHCCPSGSTCDAAKKRCTRNVEGPMEWPVVEENLPVKMLDLKPSSTLHGFESNSETLRVNDDITCPNNKTKCKDTKTCCITKHGNYYCCPHKNAVCCSDKYNCCPENTKCDLKNKKC 195          

HSP 5 Score: 56.6102 bits (135), Expect = 1.958e-8
Identity = 27/66 (40.91%), Postives = 43/66 (65.15%), Query Frame = 2
Query: 1115 CPNG-SLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNIL--LKFPII 1303
            CPN  + C +  TCC + ++SY CC YPNA+CC D  HCCP+ ++C    K C +N+   +++P++
Sbjct:   43 CPNNRTKCKETQTCCVTKHNSYHCCRYPNAICCPDKYHCCPSGSTCDAAKKRCTRNVEGPMEWPVV 108          
BLAST of Granulin precursor vs. Planmine SMEST
Match: SMESG000018760.1 (SMESG000018760.1)

HSP 1 Score: 186.808 bits (473), Expect = 1.811e-52
Identity = 127/407 (31.20%), Postives = 195/407 (47.91%), Query Frame = 2
Query:  254 TTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIK-----LKVPASS------ILSVVCPD-QSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTC------DSKLKEVVTKMKLK-------IPAISNLSIE--------CPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVI-------------CPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC---------------------DHQAEALEIKISPILVESIKCPNG-SLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSC 1270
            T   SY CC Y++AVCC DK HCCP  T C+     C+  ++   + I+     +++P         I    CP+ +++C D  +CCV   G++ CC +++AVCC DK HCCP+ + C+     C      + ++++++  +K++       + A  N   E        CP+  + C    TCC     SY CC ++NAVCC DK  CCP  T C+     C+   +     I+T  P P+   +             CP+ + +C D QTCC    G SY CC ++ A CC DK HCCP+ + C+  +  C                     + +   LE K++    + + CPN  + C    TCC + +++Y CCP+ NAVCCSD   CCP  T+C +  K C
Sbjct:   33 TKHNSYHCCKYANAVCCPDKFHCCPNGTSCDSVHKKCNRNIEATKSPIQTTPEPMEMPVIEETDVKIITDQTCPNNRTKCQDSQTCCVTKHGSYHCCKFANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMRKLIPALKVEDEPKTNILEAKVNEKDENKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPNGTSCDSVHKKCNRNIEATKSPIQT-TPEPMEMPVIEETDVKIITDQTCPNNRTKCQDSQTCCVTKHG-SYHCCKFANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVENELKTNILEAKVNE--KDEVMCPNNKTKCKDTKTCCITKHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKC 435          

HSP 2 Score: 176.407 bits (446), Expect = 1.160e-48
Identity = 123/397 (30.98%), Postives = 188/397 (47.36%), Query Frame = 2
Query:  254 TTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEVVTKIK-----LKVPASS------ILSVVCPD-QSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTC------DSKLKEVVTKMKLKIPAISNL---------SIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDA------------KYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTC-----DHQAEALEIKISPILVESIKCP-NGSLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSC---DKNILLKFPI 1300
            T   SY CC Y++AVCC DK HCCP  T C+     C+  ++   + I+     +++P         I    CP+ +++C D  +CCV   G++ CC +++AVCC DK HCCP+ + C+     C      + ++ +++  +K++    +N+          + CP+  + CK   TCC+    +Y CCP  NAVCCSDK  CCP+ T C++    C S       +        ++     +             K + S     C +  G S G C +SA TCCSD   CCPQ+T C+     C     D   E  +   +   + ++ CP N + C    TCC  ++ SY CC   NAVCC+D   CCP+N  C + T SC   + N    FP+
Sbjct:  219 TKHNSYHCCKYANAVCCPDKFHCCPNGTSCDSVHKKCNRNIEATKSPIQTTPEPMEMPVIEETDVKIITDQTCPNNRTKCQDSQTCCVTKHGSYHCCKFANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVENELKTNILEAKVNEKDEVMCPNNKTKCKDTKTCCITKHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEIAHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRS-GRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPNTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPL 614          

HSP 3 Score: 173.326 bits (438), Expect = 1.503e-47
Identity = 123/411 (29.93%), Postives = 195/411 (47.45%), Query Frame = 2
Query:  251 VTTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTC------DSVLKEVVTKIKLK-VPASSILSV--------------VCPD-QSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMK-----LKIPAISNLSIE------CPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCN-------------------LPAGTCDSKTKKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCD---HQAEALEIKISPILV-ESIKCPNGS------LCGQKGTC------CPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKN 1279
            VT  GSY CC +++AVCC DK HCCP+ + C+  +  C      +  +++++  +K++  P ++IL                +CP+ +++C +  +CC     ++ CC Y++AVCC DK HCCP  T C+     C+  ++   + ++     +++P I    ++      CP+  + C+   TCC+   GSY CC F+NAVCC DK  CCP+ + C+                   +PA   +++ K   L  K    N  + V+CP+ K +C D +TCC +   ++Y CCP+  A CCSDK  CCP+ T C+I    C    H    +  +++  L+ +S K           L G K         CP  N     C +    CCSD   CCP +T C      C  N
Sbjct:  120 VTKHGSYHCCKFANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMRKLIPALKVEDEPKTNILEAKVNEKDENKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPNGTSCDSVHKKCNRNIEATKSPIQTTPEPMEMPVIEETDVKIITDQTCPNNRTKCQDSQTCCVTKHGSYHCCKFANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVENELKTNILEAKV---NEKDEVMCPNNKTKCKDTKTCC-ITKHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEIAHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLN 526          

HSP 4 Score: 164.851 bits (416), Expect = 1.539e-44
Identity = 107/345 (31.01%), Postives = 165/345 (47.83%), Query Frame = 2
Query:  392 KIKLKVPASSILSVVCPD-QSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMK-----LKIPAISNLSIE------CPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCN-------------------LPAGTCDSKTKKPSLLIKTFQPNPVNRV---ICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKIS--------PILVES-------IKCPNG-SLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDK 1276
            K+    P    +  +CP+ +++C +  +CC     ++ CC Y++AVCC DK HCCP  T C+     C+  ++   + ++     +++P I    ++      CP+  + C+   TCC+   GSY CC F+NAVCC DK  CCP+ + C+                   +PA   + + K   L  K  + +        ICP+ + +C++ QTCC+    +SY CC Y+ A CC DK HCCP  T C+     C+   EA +  I         P++ E+         CPN  + C    TCC + + SY CC + NAVCC D  HCCP  ++C      C K
Sbjct:    2 KLNKSAPNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPNGTSCDSVHKKCNRNIEATKSPIQTTPEPMEMPVIEETDVKIITDQTCPNNRTKCQDSQTCCVTKHGSYHCCKFANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMRKLIPALKVEDEPKTNILEAKVNEKDENKETVGNICPNKRTKCTERQTCCQT-KHNSYHCCKYANAVCCPDKFHCCPNGTSCDSVHKKCNRNIEATKSPIQTTPEPMEMPVIEETDVKIITDQTCPNNRTKCQDSQTCCVTKHGSYHCCKFANAVCCPDKFHCCPEGSTCDAKQHKCVK 345          

HSP 5 Score: 130.183 bits (326), Expect = 2.121e-32
Identity = 92/267 (34.46%), Postives = 126/267 (47.19%), Query Frame = 2
Query:  620 KMKLKIPAISNLSIECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKTKKPSLLIKTFQPNPVNRVI-------------CPDAKYQCSDGQTCCKLPTGDSYGCCPYSAATCCSDKIHCCPQNTVCNINKGTCDHQAE----------ALEIKISP---ILVESIK------------CPNG-SLCGQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNI-LLKFPI 1300
            K+    P    +   CP+  + C    TCC     SY CC ++NAVCC DK  CCP  T C+     C+   +     I+T  P P+   +             CP+ + +C D QTCC    G SY CC ++ A CC DK HCCP+ + C+  +  C   A+          AL+++  P   IL   +             CPN  + C ++ TCC + ++SY CC Y NAVCC D  HCCPN TSC    K C++NI   K PI
Sbjct:    2 KLNKSAPNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPNGTSCDSVHKKCNRNIEATKSPIQT-TPEPMEMPVIEETDVKIITDQTCPNNRTKCQDSQTCCVTKHG-SYHCCKFANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMRKLIPALKVEDEPKTNILEAKVNEKDENKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPNGTSCDSVHKKCNRNIEATKSPI 266          

HSP 6 Score: 120.553 bits (301), Expect = 4.159e-29
Identity = 74/234 (31.62%), Postives = 115/234 (49.15%), Query Frame = 2
Query:  251 VTTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDS-------VLKEVVTKI-----KLKVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCSDKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLS-IECPDGSSTCKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTC-DSKTKKPSLLIKTFQPNPVNRVICPDAKY 910
            +T   +Y CCP+ +AVCCSDK  CCP+ T C++    C S       +  E+  ++     K +     I+S++   + +       C + +G    C +S+  CCSD + CCPQ+T C+     C     +  T+     P  + LS + CPD  + C +  TCC +SD SYGCC   NAVCC+D++SCCP N  C++   +C ++ + K      TF      R    D  +
Sbjct:  398 ITKHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEIAHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPNTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSKFRKTLNDGNH 631          
The following BLAST results are available for this feature:
BLAST of Granulin precursor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRN6.315e-7137.81granulin precursor [Source:HGNC Symbol;Acc:HGNC:46... [more]
GRN3.424e-7040.00granulin precursor [Source:HGNC Symbol;Acc:HGNC:46... [more]
GRN3.692e-5933.88granulin precursor [Source:HGNC Symbol;Acc:HGNC:46... [more]
GRN1.809e-5839.14granulin precursor [Source:HGNC Symbol;Acc:HGNC:46... [more]
GRN3.773e-1535.71granulin precursor [Source:HGNC Symbol;Acc:HGNC:46... [more]
back to top
BLAST of Granulin precursor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
pgrn-14.735e-2734.15ProGRaNulin homolog [Source:UniProtKB/TrEMBL;Acc:... [more]
pgrn-13.404e-2543.41ProGRaNulin homolog [Source:UniProtKB/TrEMBL;Acc:... [more]
T02B11.87.657e-635.00pep chromosome:WBcel235:V:877530:878667:-1 gene:WB... [more]
back to top
BLAST of Granulin precursor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Granulin precursor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grnb4.209e-7137.88granulin b [Source:ZFIN;Acc:ZDB-GENE-030131-7393][more]
grna8.784e-6337.28granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434][more]
grna3.213e-6235.66granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434][more]
grna3.516e-6236.34granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434][more]
grna2.724e-3737.91granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434][more]
back to top
BLAST of Granulin precursor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
trappc111.973e-5739.29trafficking protein particle complex 11 [Source:Xe... [more]
trappc111.991e-5739.29trafficking protein particle complex 11 [Source:Xe... [more]
trappc112.109e-5336.89trafficking protein particle complex 11 [Source:Xe... [more]
trappc111.689e-5235.83trafficking protein particle complex 11 [Source:Xe... [more]
back to top
BLAST of Granulin precursor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Grn3.037e-6838.01granulin [Source:MGI Symbol;Acc:MGI:95832][more]
Grn1.565e-2529.46granulin [Source:MGI Symbol;Acc:MGI:95832][more]
Grn1.907e-2439.01granulin [Source:MGI Symbol;Acc:MGI:95832][more]
Grn3.511e-2335.63granulin [Source:MGI Symbol;Acc:MGI:95832][more]
back to top
BLAST of Granulin precursor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P28799|GRN_HUMAN1.644e-6940.00Progranulin OS=Homo sapiens OX=9606 GN=GRN PE=1 SV... [more]
sp|P28798|GRN_MOUSE1.498e-6738.01Progranulin OS=Mus musculus OX=10090 GN=Grn PE=1 S... [more]
sp|P23785|GRN_RAT2.426e-6738.01Progranulin OS=Rattus norvegicus OX=10116 GN=Grn P... [more]
sp|P28797|GRN_CAVPO1.138e-5239.52Progranulin OS=Cavia porcellus OX=10141 GN=GRN PE=... [more]
sp|Q54QR7|GRN_DICDI5.189e-1147.69Granulin OS=Dictyostelium discoideum OX=44689 GN=g... [more]
back to top
BLAST of Granulin precursor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4ARK51.460e-8244.60Uncharacterized protein (Fragment) OS=Lottia gigan... [more]
K1PAM62.791e-8241.71Uncharacterized protein OS=Crassostrea gigas OX=29... [more]
A0A087Y6316.432e-8142.55Granulin b OS=Poecilia formosa OX=48698 PE=4 SV=2[more]
A0A2G8L0S48.065e-8143.80Putative fibrillin-1 isoform X4 (Fragment) OS=Stic... [more]
A0A4W5RTY14.753e-8043.47Granulin b OS=Hucho hucho OX=62062 PE=4 SV=1[more]
back to top
BLAST of Granulin precursor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grnb1.831e-6440.00granulins-like [Source:NCBI gene;Acc:103046308][more]
grnb1.831e-6440.00granulins-like [Source:NCBI gene;Acc:103046308][more]
grna1.260e-6337.73granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434][more]
grna1.291e-6237.47granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434][more]
grna2.583e-6237.57granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434][more]
back to top
BLAST of Granulin precursor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000009302.15.691e-7943.13pep scaffold:Pmarinus_7.0:GL483232:1183:11161:1 ge... [more]
ENSPMAT00000001039.15.012e-4133.53pep scaffold:Pmarinus_7.0:GL484091:11570:24665:-1 ... [more]
back to top
BLAST of Granulin precursor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Granulin precursor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO278249.829e-3336.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Granulin precursor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grnb3.704e-7641.08granulin precursor [Source:NCBI gene;Acc:101166910... [more]
grna5.603e-6939.45granulins [Source:NCBI gene;Acc:101162601][more]
grna6.707e-6839.18granulins [Source:NCBI gene;Acc:101162601][more]
ENSORLT00000005071.28.173e-2530.18granulins [Source:NCBI gene;Acc:101168633][more]
ENSORLT00000029765.11.022e-2430.66granulins [Source:NCBI gene;Acc:101168633][more]
back to top
BLAST of Granulin precursor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000029882.11.664e-13594.59SMESG000029882.1[more]
SMESG000018770.14.472e-6132.25SMESG000018770.1[more]
SMESG000018770.14.878e-6132.25SMESG000018770.1[more]
SMESG000018770.15.284e-6132.25SMESG000018770.1[more]
SMESG000018760.11.811e-5231.20SMESG000018760.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011250 ID=SMED30011250|Name=Granulin precursor|organism=Schmidtea mediterranea sexual|type=transcript|length=1335bp
TTATATATAAGTTAGCTTTATTTTAAAATTCCAAATTAGTTGGTATTCAT
AATTGATATTACTTCTTTAAAATTTAGCTGCAAATATGTGGAAATTTATT
TTTGTAGTACTAATATCTTCGGTTGTCTGCCATGATGTTTACAGATTTAG
TCGTGAATTTATCAAACCCATTACAGAAACAAATAAAATACCGGTGAAAG
TAGTCAATTGTCCAGATGATTCTGTATGTGATGATGGGTCATCATGCTGT
GTAACGACCGATGGAAGCTACTCATGTTGTCCATACTCATCAGCGGTTTG
CTGCTCTGATAAGCAGCATTGTTGCCCACAAAACACTGAGTGTAATTTGA
ATAAAGGAACTTGTGATTCTGTATTGAAGGAAGTAGTTACAAAAATAAAA
CTCAAAGTTCCAGCCTCTTCAATTCTTTCCGTGGTATGTCCAGATCAATC
TCAATGTGATGATGGGTCGTCATGCTGTGTAATGGCCGATGGAAACTTCG
CATGTTGCCCATACTCATCAGCGGTCTGTTGTTCTGATAAACAGCATTGT
TGTCCACAGAATACTGTCTGTAATTTATCTGCTGGCACTTGTGATTCGAA
ATTGAAGGAAGTGGTCACAAAAATGAAGCTCAAAATTCCTGCCATTTCAA
ATCTTTCCATCGAATGTCCAGATGGGTCATCGACATGTAAAACTGGAGCT
ACGTGTTGTCTATTATCTGACGGTAGCTATGGATGTTGTCCATTCTCCAA
TGCCGTATGTTGTAGCGATAAGTTGAGTTGCTGCCCACAGAATACTGTTT
GTAATTTACCTGCTGGCACTTGTGATTCGAAAACCAAAAAGCCGAGCTTA
TTGATAAAAACATTCCAACCGAATCCAGTGAACCGAGTAATTTGTCCGGA
TGCGAAATATCAGTGCAGTGATGGTCAGACCTGTTGCAAATTACCTACCG
GTGATTCCTATGGATGTTGCCCGTATTCTGCCGCTACGTGTTGTTCCGAT
AAAATTCATTGCTGTCCTCAAAATACTGTTTGTAATATAAATAAGGGAAC
TTGTGATCACCAAGCTGAAGCATTGGAGATTAAAATTTCCCCGATTTTAG
TTGAATCTATCAAATGCCCTAACGGAAGCCTGTGTGGACAGAAAGGTACA
TGTTGTCCATCTGCTAACGACAGCTACAGTTGTTGTCCGTATCCTAATGC
CGTCTGCTGCAGCGATCACAGCCATTGTTGCCCTAATAACACGTCATGCA
GCCTCAACACGAAATCCTGTGACAAAAATATTTTATTGAAATTCCCTATT
ATAAATTTCCATCCATAATTTAACTATTATTTATT
back to top

protein sequence of SMED30011250-orf-1

>SMED30011250-orf-1 ID=SMED30011250-orf-1|Name=SMED30011250-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=411bp
MWKFIFVVLISSVVCHDVYRFSREFIKPITETNKIPVKVVNCPDDSVCDD
GSSCCVTTDGSYSCCPYSSAVCCSDKQHCCPQNTECNLNKGTCDSVLKEV
VTKIKLKVPASSILSVVCPDQSQCDDGSSCCVMADGNFACCPYSSAVCCS
DKQHCCPQNTVCNLSAGTCDSKLKEVVTKMKLKIPAISNLSIECPDGSST
CKTGATCCLLSDGSYGCCPFSNAVCCSDKLSCCPQNTVCNLPAGTCDSKT
KKPSLLIKTFQPNPVNRVICPDAKYQCSDGQTCCKLPTGDSYGCCPYSAA
TCCSDKIHCCPQNTVCNINKGTCDHQAEALEIKISPILVESIKCPNGSLC
GQKGTCCPSANDSYSCCPYPNAVCCSDHSHCCPNNTSCSLNTKSCDKNIL
LKFPIINFHP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0051087chaperone binding
GO:0003723RNA binding
GO:0005125cytokine activity
GO:0005515protein binding
GO:0008083growth factor activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: cellular component
TermDefinition
GO:0005765lysosomal membrane
GO:0005770late endosome
GO:0005794Golgi apparatus
GO:0005886plasma membrane
GO:0016020membrane
GO:0005576extracellular region
GO:0005615extracellular space
GO:0005764lysosome
GO:0005768endosome
GO:0005783endoplasmic reticulum
GO:0035578azurophil granule lumen
GO:0070062extracellular exosome
Vocabulary: biological process
TermDefinition
GO:0007041lysosomal transport
GO:0007042lysosomal lumen acidification
GO:0007186G-protein coupled receptor signaling pathway
GO:0030335positive regulation of cell migration
GO:0043524negative regulation of neuron apoptotic process
GO:0050679positive regulation of epithelial cell proliferation
GO:0050821protein stabilization
GO:0060266negative regulation of respiratory burst involved in inflammatory response
GO:1902564negative regulation of neutrophil activation
GO:1905247positive regulation of aspartic-type peptidase activity
GO:1905673positive regulation of lysosome organization
GO:0007165signal transduction
GO:0043312neutrophil degranulation
Vocabulary: INTERPRO
TermDefinition
IPR037277Granulin_sf
IPR039036Granulin_fam
IPR000118Granulin
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000118GranulinSMARTSM00277GRAN_2coord: 270..323
e-value: 7.3E-20
score: 82.0
coord: 118..169
e-value: 5.5E-18
score: 75.8
coord: 42..93
e-value: 1.2E-14
score: 64.6
coord: 194..246
e-value: 2.0E-20
score: 83.8
coord: 344..395
e-value: 1.1E-11
score: 54.8
IPR000118GranulinPFAMPF00396Granulincoord: 53..93
e-value: 3.7E-13
score: 49.6
coord: 206..246
e-value: 2.5E-14
score: 53.3
coord: 355..395
e-value: 9.3E-13
score: 48.3
coord: 282..323
e-value: 2.9E-13
score: 49.9
coord: 129..169
e-value: 3.6E-13
score: 49.6
IPR000118GranulinPROSITEPS00799GRANULINScoord: 303..316
IPR000118GranulinPROSITEPS00799GRANULINScoord: 149..162
IPR000118GranulinPROSITEPS00799GRANULINScoord: 73..86
IPR000118GranulinPROSITEPS00799GRANULINScoord: 375..388
IPR037277Granulin superfamilyGENE3DG3DSA:3.10.20.500coord: 115..182
e-value: 1.7E-17
score: 65.3
coord: 267..334
e-value: 1.8E-17
score: 65.2
coord: 38..105
e-value: 4.1E-17
score: 64.1
coord: 340..403
e-value: 6.8E-17
score: 63.4
IPR037277Granulin superfamilyGENE3DG3DSA:3.10.20.500coord: 190..250
e-value: 2.0E-17
score: 65.2
IPR039036Granulin familyPANTHERPTHR12274GRANULINcoord: 35..180
coord: 262..398
coord: 192..326
NoneNo IPR availablePRODOMPD968187coord: 66..391
e-value: 1.0E-4
score: 111.0
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..15
score: 0.74
NoneNo IPR availableSUPERFAMILYSSF57277Granulin repeatcoord: 116..144
NoneNo IPR availableSUPERFAMILYSSF57277Granulin repeatcoord: 40..67
NoneNo IPR availableSUPERFAMILYSSF57277Granulin repeatcoord: 194..221