Kinesin-like protein

Overview
NameKinesin-like protein
Smed IDSMED30011238
Length (bp)2560
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Kinesin-like protein (SMED30011238) t-SNE clustered cells

Violin plots show distribution of expression levels for Kinesin-like protein (SMED30011238) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Kinesin-like protein (SMED30011238) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Kinesin-like protein (SMED30011238) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011238

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30011238SMESG000035453.1 SmedASXL_015436SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30011238SMESG000035453.1 dd_Smed_v4_13424_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30011238SMESG000035453.1 dd_Smed_v4_13424_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30011238SMESG000035453.1 dd_Smed_v4_13424_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30011238SMESG000035453.1 dd_Smed_v4_10765_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30011238SMESG000035453.1 dd_Smed_v4_10765_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30011238SMESG000035453.1 dd_Smed_v4_10765_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30011238SMESG000035453.1 dd_Smed_v6_10765_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30011238SMESG000035453.1 dd_Smed_v6_13424_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30011238SMESG000035453.1 OX_Smed_1.0.03996ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30011238SMESG000035453.1 Contig29466newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30011238SMESG000035453.1 Contig29466uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30011238SMESG000035453.1 dd_Smed_v4_13424_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011238SMESG000035453.1 dd_Smed_v4_10765_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Kinesin-like protein vs. Ensembl Human
Match: KIF17 (kinesin family member 17 [Source:HGNC Symbol;Acc:HGNC:19167])

HSP 1 Score: 565.844 bits (1457), Expect = 0.000e+0
Identity = 286/453 (63.13%), Postives = 352/453 (77.70%), Query Frame = 3
Query:   24 MSGEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQMLAGQIPINMDAVSTAK-----PTDSSEK-------HRLTEIERXXXXXXXXXXXXXXXXQYSAEAADKAKLKSDMEKLKQYYDEKLMQLD 1346
            M+ EAVKV+VR RP+N+RE  L C+ ++ +D +R QC I+NP     P K F FDG+Y++D  TEQ+Y++I YPLVE VTEGYNGTIFAYGQTG GKSFTMQG+ +P +QRG+IPRAF+HVFE++  AEN+K+LV ASYLEIYNE++RDLL  D K KL+LKEHPEKGVYV GLSMH V +V  C+ +ME GWKNR+ G TLMN DSSRSHSIFTI +EM   DE  ++H++AGKLNLVDLAGSERQSKTGATG+RLKEATKINLSLSALGNVISALVDG+ KH+PYRDSKLTR+LQDSLGGNTKTLM+ACLSPADNNY+ETLSTLRYANRAKNI+NKP+INEDPKDALLRE+Q EI +LK +L  Q+  +  +   ++     P    EK           E E++ I+ EYE +L   +A Y AE   +A+L+ D+  ++  YD +L  L+
Sbjct:    1 MASEAVKVVVRCRPMNQRERELRCQPVVTVDCARAQCCIQNPGAADEPPKQFTFDGAYHVDHVTEQIYNEIAYPLVEGVTEGYNGTIFAYGQTGSGKSFTMQGLPDPPSQRGIIPRAFEHVFESVQCAENTKFLVRASYLEIYNEDVRDLLGADTKQKLELKEHPEKGVYVKGLSMHTVHSVAQCEHIMETGWKNRSVGYTLMNKDSSRSHSIFTISIEMSAVDERGKDHLRAGKLNLVDLAGSERQSKTGATGERLKEATKINLSLSALGNVISALVDGRCKHVPYRDSKLTRLLQDSLGGNTKTLMVACLSPADNNYDETLSTLRYANRAKNIRNKPRINEDPKDALLREYQEEIKKLKAILTQQMSPSSLSALLSRQVPPDPVQVEEKLLPQPVIQHDVEAEKQLIREEYEERLARLKADYKAEQESRARLEEDITAMRNSYDVRLSTLE 453          

HSP 2 Score: 102.449 bits (254), Expect = 1.742e-21
Identity = 78/246 (31.71%), Postives = 150/246 (60.98%), Query Frame = 3
Query: 1593 IHDKNELLSKLQYLQSTMVGGEQINNEVAKDXXXXXXXXXXXXXXXLMDSNERMEDDG---IMLGVFEDIQDELRVKSKLLQKEKNKNLSLIQEMSDINEEFHKERCDYLESIRKLDRENKLLQMMMEKIQPCIKKSCNYSNFDKIKSQAKFDEESGKWILPQLKLEDTQLP---------------NADEKIRDNVDENYYRKLARKPDP---SQEYFQNRKSGQLLN--------QRNSPNNIS 2243
            + D+ ++L++LQ L+  +VGGEQ  N+  K++H +RKR+A+E++++L+ + +  ++D    ++L V++ IQ+E+R KSKLL+K + K  +   E+ D+  EF  E+ DYL +IR+ +R++ LLQ ++E++QP I++ CNYSN +KI  ++ +DE++G W +P   +  T LP               +A +    N++++ YR +  + +    +  YF+++++ Q+L+          NSP  +S
Sbjct:  735 VVDQQQVLARLQLLEQQVVGGEQAKNKDLKEKHKRRKRYADERRKQLVAALQNSDEDSGDWVLLNVYDSIQEEVRAKSKLLEKMQRKLRAAEVEIKDLQSEFQLEKIDYLATIRRQERDSMLLQQLLEQVQPLIRRDCNYSNLEKILRESCWDEDNGFWKIPHPVITKTSLPVAVSTGPQNKPARKTSAADNGEPNMEDDRYRLMLSRSNSENIASNYFRSKRASQILSTDARKSLTHHNSPPGLS 980          
BLAST of Kinesin-like protein vs. Ensembl Human
Match: KIF17 (kinesin family member 17 [Source:HGNC Symbol;Acc:HGNC:19167])

HSP 1 Score: 565.844 bits (1457), Expect = 0.000e+0
Identity = 286/453 (63.13%), Postives = 352/453 (77.70%), Query Frame = 3
Query:   24 MSGEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQMLAGQIPINMDAVSTAK-----PTDSSEK-------HRLTEIERXXXXXXXXXXXXXXXXQYSAEAADKAKLKSDMEKLKQYYDEKLMQLD 1346
            M+ EAVKV+VR RP+N+RE  L C+ ++ +D +R QC I+NP     P K F FDG+Y++D  TEQ+Y++I YPLVE VTEGYNGTIFAYGQTG GKSFTMQG+ +P +QRG+IPRAF+HVFE++  AEN+K+LV ASYLEIYNE++RDLL  D K KL+LKEHPEKGVYV GLSMH V +V  C+ +ME GWKNR+ G TLMN DSSRSHSIFTI +EM   DE  ++H++AGKLNLVDLAGSERQSKTGATG+RLKEATKINLSLSALGNVISALVDG+ KH+PYRDSKLTR+LQDSLGGNTKTLM+ACLSPADNNY+ETLSTLRYANRAKNI+NKP+INEDPKDALLRE+Q EI +LK +L  Q+  +  +   ++     P    EK           E E++ I+ EYE +L   +A Y AE   +A+L+ D+  ++  YD +L  L+
Sbjct:    1 MASEAVKVVVRCRPMNQRERELRCQPVVTVDCARAQCCIQNPGAADEPPKQFTFDGAYHVDHVTEQIYNEIAYPLVEGVTEGYNGTIFAYGQTGSGKSFTMQGLPDPPSQRGIIPRAFEHVFESVQCAENTKFLVRASYLEIYNEDVRDLLGADTKQKLELKEHPEKGVYVKGLSMHTVHSVAQCEHIMETGWKNRSVGYTLMNKDSSRSHSIFTISIEMSAVDERGKDHLRAGKLNLVDLAGSERQSKTGATGERLKEATKINLSLSALGNVISALVDGRCKHVPYRDSKLTRLLQDSLGGNTKTLMVACLSPADNNYDETLSTLRYANRAKNIRNKPRINEDPKDALLREYQEEIKKLKAILTQQMSPSSLSALLSRQVPPDPVQVEEKLLPQPVIQHDVEAEKQLIREEYEERLARLKADYKAEQESRARLEEDITAMRNSYDVRLSTLE 453          

HSP 2 Score: 102.834 bits (255), Expect = 1.357e-21
Identity = 78/245 (31.84%), Postives = 150/245 (61.22%), Query Frame = 3
Query: 1593 IHDKNELLSKLQYLQSTMVGGEQINNEVAKDXXXXXXXXXXXXXXXLMDSNERMEDDG---IMLGVFEDIQDELRVKSKLLQKEKNKNLSLIQEMSDINEEFHKERCDYLESIRKLDRENKLLQMMMEKIQPCIKKSCNYSNFDKIKSQAKFDEESGKWILPQLKLEDTQLP--------------NADEKIRDNVDENYYRKLARKPDP---SQEYFQNRKSGQLLN--------QRNSPNNIS 2243
            + D+ ++L++LQ L+  +VGGEQ  N+  K++H +RKR+A+E++++L+ + +  ++D    ++L V++ IQ+E+R KSKLL+K + K  +   E+ D+  EF  E+ DYL +IR+ +R++ LLQ ++E++QP I++ CNYSN +KI  ++ +DE++G W +P   +  T LP              +A +    N++++ YR +  + +    +  YF+++++ Q+L+          NSP  +S
Sbjct:  735 VVDQQQVLARLQLLEQQVVGGEQAKNKDLKEKHKRRKRYADERRKQLVAALQNSDEDSGDWVLLNVYDSIQEEVRAKSKLLEKMQRKLRAAEVEIKDLQSEFQLEKIDYLATIRRQERDSMLLQQLLEQVQPLIRRDCNYSNLEKILRESCWDEDNGFWKIPHPVITKTSLPVVSTGPQNKPARKTSAADNGEPNMEDDRYRLMLSRSNSENIASNYFRSKRASQILSTDARKSLTHHNSPPGLS 979          
BLAST of Kinesin-like protein vs. Ensembl Human
Match: KIF3B (kinesin family member 3B [Source:HGNC Symbol;Acc:HGNC:6320])

HSP 1 Score: 435.647 bits (1119), Expect = 1.610e-140
Identity = 223/367 (60.76%), Postives = 279/367 (76.02%), Query Frame = 3
Query:   21 LMSGEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPND--NKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQML 1115
            L S E+V+V+VR RP+N +E   +   ++D+DV  GQ S++NP    ++ P K F FD  Y+ ++   +LY +   PLV++V +G+NGTIFAYGQTG GK++TM+GI     +RGVIP +FDH+F  IS ++N +YLV ASYLEIY EEIRDLL+KD   +L+LKE P+ GVYV  LS     +V++ + VM  G +NR+ G+T MN  SSRSH+IF I +E      + ENHI+ GKLNLVDLAGSERQ+KTGA G+RLKEATKINLSLSALGNVISALVDGKS HIPYRDSKLTR+LQDSLGGN KT+M+A + PA  N EETL+TLRYANRAKNI+NKP++NEDPKDALLREFQ EI RLK  L
Sbjct:    4 LKSSESVRVVVRCRPMNGKEKAASYDKVVDVDVKLGQVSVKNPKGTAHEMP-KTFTFDAVYDWNAKQFELYDETFRPLVDSVLQGFNGTIFAYGQTGTGKTYTMEGIRGDPEKRGVIPNSFDHIFTHISRSQNQQYLVRASYLEIYQEEIRDLLSKDQTKRLELKERPDTGVYVKDLSSFVTKSVKEIEHVMNVGNQNRSVGATNMNEHSSRSHAIFVITIECSEVGLDGENHIRVGKLNLVDLAGSERQAKTGAQGERLKEATKINLSLSALGNVISALVDGKSTHIPYRDSKLTRLLQDSLGGNAKTVMVANVGPASYNVEETLTTLRYANRAKNIKNKPRVNEDPKDALLREFQEEIARLKAQL 369          
BLAST of Kinesin-like protein vs. Ensembl Human
Match: KIF17 (kinesin family member 17 [Source:HGNC Symbol;Acc:HGNC:19167])

HSP 1 Score: 423.705 bits (1088), Expect = 7.795e-134
Identity = 225/353 (63.74%), Postives = 275/353 (77.90%), Query Frame = 3
Query:  324 MQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQMLAGQIPINMDAVSTAK-----PTDSSEK-------HRLTEIERXXXXXXXXXXXXXXXXQYSAEAADKAKLKSDMEKLKQYYDEKLMQLD 1346
            MQG+ +P +QRG+IPRAF+HVFE++  AEN+K+LV ASYLEIYNE++RDLL  D K KL+LKEHPEKGVYV GLSMH V +V  C+ +ME GWKNR+ G TLMN DSSRSHSIFTI +EM   DE  ++H++AGKLNLVDLAGSERQSKTGATG+RLKEATKINLSLSALGNVISALVDG+ KH+PYRDSKLTR+LQDSLGGNTKTLM+ACLSPADNNY+ETLSTLRYANRAKNI+NKP+INEDPKDALLRE+Q EI +LK +L  Q+  +  +   ++     P    EK           E E++ I+ EYE +L   +A Y AE   +A+L+ D+  ++  YD +L  L+
Sbjct:    1 MQGLPDPPSQRGIIPRAFEHVFESVQCAENTKFLVRASYLEIYNEDVRDLLGADTKQKLELKEHPEKGVYVKGLSMHTVHSVAQCEHIMETGWKNRSVGYTLMNKDSSRSHSIFTISIEMSAVDERGKDHLRAGKLNLVDLAGSERQSKTGATGERLKEATKINLSLSALGNVISALVDGRCKHVPYRDSKLTRLLQDSLGGNTKTLMVACLSPADNNYDETLSTLRYANRAKNIRNKPRINEDPKDALLREYQEEIKKLKAILTQQMSPSSLSALLSRQVPPDPVQVEEKLLPQPVIQHDVEAEKQLIREEYEERLARLKADYKAEQESRARLEEDITAMRNSYDVRLSTLE 353          

HSP 2 Score: 101.679 bits (252), Expect = 2.287e-21
Identity = 78/246 (31.71%), Postives = 150/246 (60.98%), Query Frame = 3
Query: 1593 IHDKNELLSKLQYLQSTMVGGEQINNEVAKDXXXXXXXXXXXXXXXLMDSNERMEDDG---IMLGVFEDIQDELRVKSKLLQKEKNKNLSLIQEMSDINEEFHKERCDYLESIRKLDRENKLLQMMMEKIQPCIKKSCNYSNFDKIKSQAKFDEESGKWILPQLKLEDTQLP---------------NADEKIRDNVDENYYRKLARKPDP---SQEYFQNRKSGQLLN--------QRNSPNNIS 2243
            + D+ ++L++LQ L+  +VGGEQ  N+  K++H +RKR+A+E++++L+ + +  ++D    ++L V++ IQ+E+R KSKLL+K + K  +   E+ D+  EF  E+ DYL +IR+ +R++ LLQ ++E++QP I++ CNYSN +KI  ++ +DE++G W +P   +  T LP               +A +    N++++ YR +  + +    +  YF+++++ Q+L+          NSP  +S
Sbjct:  635 VVDQQQVLARLQLLEQQVVGGEQAKNKDLKEKHKRRKRYADERRKQLVAALQNSDEDSGDWVLLNVYDSIQEEVRAKSKLLEKMQRKLRAAEVEIKDLQSEFQLEKIDYLATIRRQERDSMLLQQLLEQVQPLIRRDCNYSNLEKILRESCWDEDNGFWKIPHPVITKTSLPVAVSTGPQNKPARKTSAADNGEPNMEDDRYRLMLSRSNSENIASNYFRSKRASQILSTDARKSLTHHNSPPGLS 880          
BLAST of Kinesin-like protein vs. Ensembl Human
Match: KIF3A (kinesin family member 3A [Source:HGNC Symbol;Acc:HGNC:6319])

HSP 1 Score: 407.142 bits (1045), Expect = 4.710e-130
Identity = 210/364 (57.69%), Postives = 269/364 (73.90%), Query Frame = 3
Query:   27 SGEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAE-NSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQML 1115
            S + VKV+VR RPLNERE ++  K  + +D  RG  ++   + +  P K F FD  +  +S    +Y+    P++++V EGYNGTIFAYGQTG GK+FTM+G+      RG+IP +F H+F  I+ AE ++++LV  SYLEIYNEE+RDLL KD   +L++KE P+ GVY+  LS + V+N  D   +M  G KNR+ G+T MN  SSRSH+IFTI +E      +   H++ GKL+LVDLAGSERQ+KTGATG RLKEATKINLSLS LGNVISALVDGKS H+PYR+SKLTR+LQDSLGGN+KT+M A + PAD NY+ET+STLRYANRAKNI+NK +INEDPKDALLR+FQ EI  LK+ L
Sbjct:   11 SCDNVKVVVRCRPLNEREKSMCYKQAVSVDEMRGTITVHKTDSSNEPPKTFTFDTVFGPESKQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAIPELRGIIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQTQRLEVKERPDVGVYIKDLSAYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGIDGNMHVRMGKLHLVDLAGSERQAKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQFQKEIEELKKKL 374          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: osm-3 (Osmotic avoidance abnormal protein 3 [Source:UniProtKB/Swiss-Prot;Acc:P46873])

HSP 1 Score: 492.271 bits (1266), Expect = 1.944e-163
Identity = 266/439 (60.59%), Postives = 323/439 (73.58%), Query Frame = 3
Query:   30 GEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQMLAGQIPINMDAVSTAKPTDSSEKHRLTEIERXXXXXXXXXXXXXXXXQYSAEAADKAKLKSDMEKLKQYYDEKLMQLD 1346
             E+V+V VR RP N+RE +LN    + +  + GQ ++  P+      K F FDG+Y +DST EQ+Y+DIV+PLVENV EGYNGT+FAYGQTG GK+F+MQGI     QRGVIPRAFDH+F   +  EN K+LVH SYLEIYNEE+RDLL  D K KL++KE P++GVYV+GLSMH   +V  C+ +M RG+ NR  G+TLMN DSSRSHSIFT+Y+E       E   I+ GKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTR+LQDSLGGNTKT+MIAC+SP+ +NY+ETLSTLRYANRAKNI+NKP INEDPKDALLRE+Q EI RLK M      +   AV    P   +      E ER+K++ E+E  + +   +Y  E   KA+L+ D+E L+  Y+     LD
Sbjct:    2 AESVRVAVRCRPFNQREKDLNTTLCVGMTPNVGQVNLNAPDG---AAKDFTFDGAYFMDSTGEQIYNDIVFPLVENVIEGYNGTVFAYGQTGSGKTFSMQGIETIPAQRGVIPRAFDHIFTATATTENVKFLVHCSYLEIYNEEVRDLLGADNKQKLEIKEQPDRGVYVAGLSMHVCHDVPACKELMTRGFNNRHVGATLMNKDSSRSHSIFTVYVEGMT----ETGSIRMGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRLLQDSLGGNTKTIMIACVSPSSDNYDETLSTLRYANRAKNIKNKPTINEDPKDALLREYQEEIARLKSM------VQPGAVGVGAPAQDAFS---IEEERKKLREEFEEAMNDLRGEYEREQTSKAELQKDLESLRADYERANANLD 424          

HSP 2 Score: 111.694 bits (278), Expect = 5.150e-25
Identity = 77/229 (33.62%), Postives = 127/229 (55.46%), Query Frame = 3
Query: 1608 ELLSKLQYLQSTMVGGEQINNEVAKDXXXXXXXXXXXXXXXLMDSNERMEDDGIMLGVFEDIQDELRVKSKLLQKEKNKNLSLIQEMSDINEEFHKERCDYLESIRKLDRENKLLQMMMEKIQPCIKKSCNYSNFDKIKSQAKFDEESGKWILPQLKLEDTQLPNADEK------------IRDNVDENYYRKLAR--KPDPSQEYFQNRKSGQLLNQRNSPNNISNSQ 2252
            E   K+Q LQ   +GGE+  N   K +  K+ + AE K ++L  +    +DD  +L V+   Q++L   +  L+KE  K+    +E+ D++ EF  +R DYL++IRK D++ KLL  +M+KIQP IKK  NYSN D+IK +A ++E+  +WILP++ +  T LP A+              +R N D+    +LA+    + +  YF+  K   ++N+  S   +S S+
Sbjct:  430 EAAKKIQQLQDQFIGGEEAGNTQLKQKRMKQLKEAETKTQKLAAALNVHKDDP-LLQVYSTTQEKLDAVTSQLEKEVKKSKGYEREIEDLHGEFELDRLDYLDTIRKQDQQLKLLMQIMDKIQPIIKKDTNYSNVDRIKKEAVWNEDESRWILPEMSMSRTILPLANNGYMQEPARQENTLLRSNFDDKLRERLAKSDSENLANSYFKPVKQINVINKYKSDQKLSTSK 657          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: osm-3 (Osmotic avoidance abnormal protein 3 [Source:UniProtKB/Swiss-Prot;Acc:P46873])

HSP 1 Score: 469.544 bits (1207), Expect = 6.454e-155
Identity = 254/407 (62.41%), Postives = 304/407 (74.69%), Query Frame = 3
Query:  126 GQCSIRNPNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQMLAGQIPINMDAVSTAKPTDSSEKHRLTEIERXXXXXXXXXXXXXXXXQYSAEAADKAKLKSDMEKLKQYYDEKLMQLD 1346
            GQ ++  P+      K F FDG+Y +DST EQ+Y+DIV+PLVENV EGYNGT+FAYGQTG GK+F+MQGI     QRGVIPRAFDH+F   +  EN K+LVH SYLEIYNEE+RDLL  D K KL++KE P++GVYV+GLSMH   +V  C+ +M RG+ NR  G+TLMN DSSRSHSIFT+Y+E       E   I+ GKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTR+LQDSLGGNTKT+MIAC+SP+ +NY+ETLSTLRYANRAKNI+NKP INEDPKDALLRE+Q EI RLK M      +   AV    P   +      E ER+K++ E+E  + +   +Y  E   KA+L+ D+E L+  Y+     LD
Sbjct:    6 GQVNLNAPDG---AAKDFTFDGAYFMDSTGEQIYNDIVFPLVENVIEGYNGTVFAYGQTGSGKTFSMQGIETIPAQRGVIPRAFDHIFTATATTENVKFLVHCSYLEIYNEEVRDLLGADNKQKLEIKEQPDRGVYVAGLSMHVCHDVPACKELMTRGFNNRHVGATLMNKDSSRSHSIFTVYVEGMT----ETGSIRMGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRLLQDSLGGNTKTIMIACVSPSSDNYDETLSTLRYANRAKNIKNKPTINEDPKDALLREYQEEIARLKSM------VQPGAVGVGAPAQDAFS---IEEERKKLREEFEEAMNDLRGEYEREQTSKAELQKDLESLRADYERANANLD 396          

HSP 2 Score: 111.694 bits (278), Expect = 5.019e-25
Identity = 77/229 (33.62%), Postives = 127/229 (55.46%), Query Frame = 3
Query: 1608 ELLSKLQYLQSTMVGGEQINNEVAKDXXXXXXXXXXXXXXXLMDSNERMEDDGIMLGVFEDIQDELRVKSKLLQKEKNKNLSLIQEMSDINEEFHKERCDYLESIRKLDRENKLLQMMMEKIQPCIKKSCNYSNFDKIKSQAKFDEESGKWILPQLKLEDTQLPNADEK------------IRDNVDENYYRKLAR--KPDPSQEYFQNRKSGQLLNQRNSPNNISNSQ 2252
            E   K+Q LQ   +GGE+  N   K +  K+ + AE K ++L  +    +DD  +L V+   Q++L   +  L+KE  K+    +E+ D++ EF  +R DYL++IRK D++ KLL  +M+KIQP IKK  NYSN D+IK +A ++E+  +WILP++ +  T LP A+              +R N D+    +LA+    + +  YF+  K   ++N+  S   +S S+
Sbjct:  402 EAAKKIQQLQDQFIGGEEAGNTQLKQKRMKQLKEAETKTQKLAAALNVHKDDP-LLQVYSTTQEKLDAVTSQLEKEVKKSKGYEREIEDLHGEFELDRLDYLDTIRKQDQQLKLLMQIMDKIQPIIKKDTNYSNVDRIKKEAVWNEDESRWILPEMSMSRTILPLANNGYMQEPARQENTLLRSNFDDKLRERLAKSDSENLANSYFKPVKQINVINKYKSDQKLSTSK 629          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: klp-11 (Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc:E5QCG4])

HSP 1 Score: 419.083 bits (1076), Expect = 4.290e-134
Identity = 216/361 (59.83%), Postives = 262/361 (72.58%), Query Frame = 3
Query:   33 EAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQML 1115
            E VKVIVR RPL+ +EI  N   I+ +   RGQ  ++NP +   P K F FD  Y+ +ST   LY +    LV++V  GYN TIFAYGQTG GK+ TM+G  +   QRGVI +  DH+FE ++ + N +YLV ASYLEIY EE+RDLL  +   KL++KE P+ GVYV  L+      V +   VM RG  +R+ G T MN  SSRSH+IF I +E     E+ E+HI  G+LNLVDLAGSERQSKTGATG+R KEATKINLSLSALGNVISALVD KS HIPYRDSKLTR+LQDSLGGN+KT+M+AC+ PA  N+EETL TLRYANRAKNI+N+PKINEDPKDALLREFQ EI  L++ L
Sbjct:   12 ETVKVIVRCRPLSSQEIANNYSKIVHMRPQRGQIELKNPKEQDEPSKDFTFDAIYDENSTQSDLYEETFRDLVDSVLNGYNATIFAYGQTGTGKTHTMEGKSSDPEQRGVIYKCIDHIFEHMAASHNQEYLVRASYLEIYQEELRDLLEAESNKKLEIKERPDGGVYVKDLTSKLTRTVGEIHEVMIRGNGHRSVGRTNMNEHSSRSHAIFIITVECSRIGEDGESHITVGRLNLVDLAGSERQSKTGATGERFKEATKINLSLSALGNVISALVDAKSAHIPYRDSKLTRLLQDSLGGNSKTVMVACIGPASYNFEETLGTLRYANRAKNIKNQPKINEDPKDALLREFQEEIEMLREQL 372          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: klp-20 (Kinesin-like protein klp-20 [Source:UniProtKB/Swiss-Prot;Acc:Q965T6])

HSP 1 Score: 374.785 bits (961), Expect = 7.406e-119
Identity = 203/368 (55.16%), Postives = 260/368 (70.65%), Query Frame = 3
Query:   30 GEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAE-NSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQMLAGQIP 1130
             E VKV+VR RP++  E     K  +  +      +I++ +  + P + F+FD  ++ ++    +Y+    P+VENV +GYNGTIFAYGQTG GK+FTM G + P   RG+IP +F H+F+ I+  + ++ +LV  SYLEIYNEEIRDLL+KD    L++KE P+ GVYV  LS   V N    Q +ME G KNR  G+T MN++SSRSH++FT+ +E           +  GKL LVDLAGSERQSKTGA G+RLKEA KINLSLS LGNVIS+LVDGKS HIPYR+SKLTR+LQDSLGGN+KT+MIA + PA  NY+ETLSTLRYANRAKNIQN  KINEDPKDA LR+FQ EI  L+++L  + P
Sbjct:    4 AEKVKVVVRCRPISTTEKLQGHKIAVTCNDEEKAVNIKSLS-QEDPPRTFYFDAVFSPNTDQMTVYNVAARPIVENVLKGYNGTIFAYGQTGTGKTFTMAGDLEPVEMRGIIPNSFAHIFDHIAKCQHDTTFLVRVSYLEIYNEEIRDLLSKDHNGNLEIKERPDVGVYVRNLSNPTVENASKMQALMEFGSKNRKVGATAMNLESSRSHAMFTVTIESCRN-----GLVTQGKLQLVDLAGSERQSKTGAQGERLKEAAKINLSLSTLGNVISSLVDGKSTHIPYRNSKLTRLLQDSLGGNSKTVMIANVGPATYNYDETLSTLRYANRAKNIQNVAKINEDPKDAQLRKFQLEIEALRKILDEENP 365          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: klp-20 (Kinesin-like protein klp-20 [Source:UniProtKB/Swiss-Prot;Acc:Q965T6])

HSP 1 Score: 374.785 bits (961), Expect = 7.406e-119
Identity = 203/368 (55.16%), Postives = 260/368 (70.65%), Query Frame = 3
Query:   30 GEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAE-NSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQMLAGQIP 1130
             E VKV+VR RP++  E     K  +  +      +I++ +  + P + F+FD  ++ ++    +Y+    P+VENV +GYNGTIFAYGQTG GK+FTM G + P   RG+IP +F H+F+ I+  + ++ +LV  SYLEIYNEEIRDLL+KD    L++KE P+ GVYV  LS   V N    Q +ME G KNR  G+T MN++SSRSH++FT+ +E           +  GKL LVDLAGSERQSKTGA G+RLKEA KINLSLS LGNVIS+LVDGKS HIPYR+SKLTR+LQDSLGGN+KT+MIA + PA  NY+ETLSTLRYANRAKNIQN  KINEDPKDA LR+FQ EI  L+++L  + P
Sbjct:    4 AEKVKVVVRCRPISTTEKLQGHKIAVTCNDEEKAVNIKSLS-QEDPPRTFYFDAVFSPNTDQMTVYNVAARPIVENVLKGYNGTIFAYGQTGTGKTFTMAGDLEPVEMRGIIPNSFAHIFDHIAKCQHDTTFLVRVSYLEIYNEEIRDLLSKDHNGNLEIKERPDVGVYVRNLSNPTVENASKMQALMEFGSKNRKVGATAMNLESSRSHAMFTVTIESCRN-----GLVTQGKLQLVDLAGSERQSKTGAQGERLKEAAKINLSLSTLGNVISSLVDGKSTHIPYRNSKLTRLLQDSLGGNSKTVMIANVGPATYNYDETLSTLRYANRAKNIQNVAKINEDPKDAQLRKFQLEIEALRKILDEENP 365          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: Kif3C (gene:FBgn0039925 transcript:FBtr0089196)

HSP 1 Score: 412.92 bits (1060), Expect = 2.763e-133
Identity = 214/368 (58.15%), Postives = 264/368 (71.74%), Query Frame = 3
Query:   33 EAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIR---XXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLE----MFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQML 1115
            E +KV+VR RP+N+ E   NC+NI++I+      S+ NP+   + QK F FD  YN+ + TE +Y ++ Y LVE+  EGYNGTIFAYGQTGCGK+ TMQG  N S   G+IP+ FDH+FE IS+  N +YL   +YLEIYNE IR   +           LKE P  GV V  L+   V N   C   +  G KNR T +TLMN +SSRSH+IFTI LE    + +   +    I  GKL+LVDLAGSERQ KTGA GDRLKEA++INLSLSALGNVIS+LVDGK+KH+P+RDSKLTR+LQDSLGGNTKTLMI+C+SP D +Y+ET+STLRYA+RAKNI NKPKINEDPKDA LR++QNEI  LK+ML
Sbjct:    3 ENIKVVVRCRPMNQTEKERNCQNIVEIN--EFAVSVTNPSARISQQKKFIFDSVYNMKTDTEVIYDEMCYSLVESTIEGYNGTIFAYGQTGCGKTHTMQGDENFSNSTGIIPKCFDHIFERISMTTNVRYLALVTYLEIYNERIRDLLNKNENTNVINHFLKELPGIGVSVPTLTTQPVVNANQCYDWLHFGNKNRVTAATLMNKNSSRSHTIFTITLEQSPFLNSIGSDAFGGICRGKLSLVDLAGSERQRKTGAQGDRLKEASQINLSLSALGNVISSLVDGKAKHVPFRDSKLTRLLQDSLGGNTKTLMISCISPTDIHYDETISTLRYASRAKNISNKPKINEDPKDARLRQYQNEILYLKRML 368          

HSP 2 Score: 56.9954 bits (136), Expect = 5.676e-8
Identity = 50/174 (28.74%), Postives = 91/174 (52.30%), Query Frame = 3
Query: 1617 SKLQYLQSTMVGGEQINNEVAKDXXXXXXXXXXXXXXXLMDSNERM--EDDGIMLGVFEDIQDELRVKSKLLQKEKNKNLSLIQEMSDINEEFHKERCDYLESIRKLDRENKLLQMMMEKIQPCIKKSCNYSNFDK------IKSQAKFDEESGKWILPQLKLEDTQLPNADEK 2114
            S++  ++ +++GGE+I++   K++H  RK  A+     +  +  R+  ED  ++ G +  I  E+ +K+  ++K K K   L  E+SD+N EF  +R DYL+ IR L R+ K  Q +       +K S N   FD+      I   + ++++   W +P+  L   +LP A +K
Sbjct:  443 SRIDLIKRSLIGGERIHDFELKEKHMARKYAAQRHLSAIAIALSRVKCEDRDLLQGHYATITQEIDIKNDYIRKCKEKIKMLEMEVSDLNSEFQLDREDYLDEIRNLGRQVKFHQQLF------LKFSSNPGKFDRNWTPDTILQNSLWNDDLKMWRIPESDL--IKLPPATQK 608          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: Klp64D (gene:FBgn0004380 transcript:FBtr0077157)

HSP 1 Score: 393.66 bits (1010), Expect = 1.322e-125
Identity = 207/363 (57.02%), Postives = 262/363 (72.18%), Query Frame = 3
Query:   33 EAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKT-PQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLA-ENSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQML 1115
            E V+V+VR RP+++ E++    + I +D      ++  PN     P K ++FD  ++  S    LY D   P+V+ V EGYNGTI AYGQTG GK++TM G  +    +G+IP AF H+F  I+ A EN K+LV  SY+EIYNEE+RDLL KDV   L++KE P+ GV+V  LS + V N  D + +M  G KNRA G+T MN +SSRSH+IF+I +E     E +  H++ GKL LVDLAGSERQSKT A+G RLKEATKINLSLS LGNVISALVDGKS HIPYR+SKLTR+LQDSLGGN+KT+M A +SPAD+NY ET+STLRYA+RAKNIQN+  INE+PKDALLR FQ EI RL++ L
Sbjct:   19 ENVRVVVRTRPMDKNELSAGALSAISVDKINRAITVMKPNATANEPPKTYYFDNVFDGGSNQMDLYVDTARPIVDKVLEGYNGTILAYGQTGTGKTYTMSGNPDSPQTKGIIPNAFAHIFGHIAKAKENQKFLVRVSYMEIYNEEVRDLLGKDVGKSLEVKERPDIGVFVKDLSGYVVHNADDLENIMRLGNKNRAVGATKMNQESSRSHAIFSITVERSELGEGDVQHVRMGKLQLVDLAGSERQSKTQASGQRLKEATKINLSLSVLGNVISALVDGKSTHIPYRNSKLTRLLQDSLGGNSKTVMCATISPADSNYMETISTLRYASRAKNIQNRMHINEEPKDALLRHFQEEIARLRKQL 381          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: Klp68D (gene:FBgn0004381 transcript:FBtr0332129)

HSP 1 Score: 364.385 bits (934), Expect = 3.114e-113
Identity = 194/365 (53.15%), Postives = 258/365 (70.68%), Query Frame = 3
Query:   33 EAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPND-NKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQMLAGQ 1124
            E V+V+VR RP++ RE +     ++++  +RG   ++N  D NK  +K F +D +Y+  +T   LY ++V+PLV +V EG+NG IFAYGQTG GK+FTM+G+       G+IPR F+ ++  I+  EN ++LV  SYLEIY EE+RDLL  + K     +     GVYV  L      +V D   VM+ G KNR  G T MN  SSRSH+IF I +EM +T   E N IK GKLNL+DLAGSERQSKTGA+ +RLKEA+KINL+LS+LGNVISAL +  S H+PYRDSKLTR+LQDSLGGN+KT+MIA + P++ NY ETL+TLRYA+RAK+IQN+P  NEDP+DA L+E+Q EI RLK+++  Q
Sbjct:   18 ECVQVVVRCRPMSNRERSERSPEVVNVYPNRGVVELQNVVDGNKEQRKVFTYDAAYDASATQTTLYHEVVFPLVSSVLEGFNGCIFAYGQTGTGKTFTMEGVRGNDELMGIIPRTFEQIWLHINRTENFQFLVDVSYLEIYMEELRDLLKPNSKHLEVRERG--SGVYVPNLHAINCKSVEDMIKVMQVGNKNRTVGFTNMNEHSSRSHAIFMIKIEMCDT---ETNTIKVGKLNLIDLAGSERQSKTGASAERLKEASKINLALSSLGNVISALAES-SPHVPYRDSKLTRLLQDSLGGNSKTIMIANIGPSNYNYNETLTTLRYASRAKSIQNQPIKNEDPQDAKLKEYQEEIERLKRLIGPQ 376          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: Klp68D (gene:FBgn0004381 transcript:FBtr0076030)

HSP 1 Score: 364.385 bits (934), Expect = 3.114e-113
Identity = 194/365 (53.15%), Postives = 258/365 (70.68%), Query Frame = 3
Query:   33 EAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPND-NKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQMLAGQ 1124
            E V+V+VR RP++ RE +     ++++  +RG   ++N  D NK  +K F +D +Y+  +T   LY ++V+PLV +V EG+NG IFAYGQTG GK+FTM+G+       G+IPR F+ ++  I+  EN ++LV  SYLEIY EE+RDLL  + K     +     GVYV  L      +V D   VM+ G KNR  G T MN  SSRSH+IF I +EM +T   E N IK GKLNL+DLAGSERQSKTGA+ +RLKEA+KINL+LS+LGNVISAL +  S H+PYRDSKLTR+LQDSLGGN+KT+MIA + P++ NY ETL+TLRYA+RAK+IQN+P  NEDP+DA L+E+Q EI RLK+++  Q
Sbjct:   18 ECVQVVVRCRPMSNRERSERSPEVVNVYPNRGVVELQNVVDGNKEQRKVFTYDAAYDASATQTTLYHEVVFPLVSSVLEGFNGCIFAYGQTGTGKTFTMEGVRGNDELMGIIPRTFEQIWLHINRTENFQFLVDVSYLEIYMEELRDLLKPNSKHLEVRERG--SGVYVPNLHAINCKSVEDMIKVMQVGNKNRTVGFTNMNEHSSRSHAIFMIKIEMCDT---ETNTIKVGKLNLIDLAGSERQSKTGASAERLKEASKINLALSSLGNVISALAES-SPHVPYRDSKLTRLLQDSLGGNSKTIMIANIGPSNYNYNETLTTLRYASRAKSIQNQPIKNEDPQDAKLKEYQEEIERLKRLIGPQ 376          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: Klp98A (gene:FBgn0004387 transcript:FBtr0304671)

HSP 1 Score: 303.523 bits (776), Expect = 1.465e-87
Identity = 195/404 (48.27%), Postives = 245/404 (60.64%), Query Frame = 3
Query:   36 AVKVIVRVRPLNEREINLNCKNIIDIDVSRGQC------SIRNPN-DNKTPQKPFFFDGSY-NIDS------TTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSK--YLVHASYLEIYNEEIRXXXXXXXXXX-XXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYL--EMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVD------------------GKSK---HIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQMLAGQI 1127
            ++KV VRVRP N REI+++ + I++++  + +       SIR+   DN      F FD SY + D+      T EQ+YSD+   +V+   EGYN  +FAYGQTG GK+FTM G  N     G+IPR  + +F  + + + S   Y  HASYLEIYNE ++DLLA       L ++EH   G YV  LS H VS+  + Q  + RG   R T ST MN  SSRSH+IFTI     +F  D   E      K++LVDLAGSER + TGATG RLKE   IN SL  LG+VISAL +                  G SK   +IPYRDS LT +L+DSLGGN+KT+MIA LSPAD NY ETLSTLRYANRAKNI NKP +NED    L+RE + EIN+LK MLAG I
Sbjct:    3 SLKVAVRVRPFNSREIDMDAQLIMEMENKKTRLLKPRLQSIRDAGRDN---HHDFTFDYSYWSFDAEDPHFATQEQVYSDLGNDVVDCAYEGYNACVFAYGQTGSGKTFTMMGTPN---NPGLIPRICEELFARMRVGQESGTGYRTHASYLEIYNERVKDLLAAQSTGHGLRVREHRSLGPYVENLSQHAVSDFDEIQECIARGNAQRTTASTNMNDTSSRSHAIFTITFVQAVFMNDMPSET---VSKIHLVDLAGSERANATGATGQRLKEGAHINKSLVTLGSVISALAEQTGGGHNSSSSALATTPNGASKRVLYIPYRDSILTWLLKDSLGGNSKTIMIAALSPADCNYSETLSTLRYANRAKNIINKPTVNEDTNVKLIRELREEINKLKSMLAGDI 397          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: kif17 (kinesin family member 17 [Source:ZFIN;Acc:ZDB-GENE-080724-12])

HSP 1 Score: 649.818 bits (1675), Expect = 0.000e+0
Identity = 366/711 (51.48%), Postives = 497/711 (69.90%), Query Frame = 3
Query:   24 MSGEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQM-------------LAGQIPINMDAVSTAKPTDSSEKHRLTEIERXXXXXXXXXXXXXXXXQYSAEAADKAKLKSDMEKLKQYYDEKLMQLD----IRDIPNSDEVLRLFEPKIFTSSSNSGPQPIGQFEKDLGNPNLYDLNLADTSVVIVNPEGNYAPDIEPQRAVHVRTVPKQEVLIHDKNELLSKLQYLQSTMVGGEQINNEVAKDXXXXXXXXXXXXXXXLMDS-NERMED-DGIMLGVFEDIQDELRVKSKLLQKEKNKNLSLIQEMSDINEEFHKERCDYLESIRKLDRENKLLQMMMEKIQPCIKKSCNYSNFDKIKSQAKFDEESGKWILPQLKLEDTQLP 2099
            M+ E+VKV+VR RPLN RE  +NCK ++ +D +  QC I+ P D + P K F FDG+Y I+ +TE++Y++I YPLVE VTEGYNGTIFAYGQTG GKSFTMQG+ +P +QRG+IPRAF+H+FETI  AEN+K+LV ASYLEIY EEIRDLL KD+K K++LKEHPE+GVYV  L+M  V +V +C+ VM+ GW+NR+ G TLMN DSSRSHSIFTI+LE+ + D   + H++AGKLNLVDLAGSERQSKTGATGDRL+EATKINLSLSALGNVISALVDG+SK+IPYRDSKLTR+LQDSLGGNT+TLM+ACLSPADNNYEE++STLRYANRAK+IQN+P+INEDPKDALLRE+Q EI +L+ +             LAGQ      AV +   +++SE    +E E++KIK EYE KL   +A+Y AE   K KL+ D+  L+  Y+ +L  L+     R        L+  + +  T+S+ S  Q      +    P+  D  +          +G  + + +   +V V  +P Q     D+   L +LQ L+   VGGEQ+ NE  K RH +RK  A+++K++L+++ N+  ED D ++L V++ IQ+E+  KS+ L+  + K  +   E+ D+  EF  ER DYL +IR+L+RE +LLQ ++E++   +++ CNYSN D+++ +A +DEE G W LP + ++ T LP
Sbjct:    1 MASESVKVVVRCRPLNNREKAMNCKIVVSVDSTHCQCFIKKPGDTEEPPKQFTFDGTYYINHSTEEVYNEIAYPLVEGVTEGYNGTIFAYGQTGSGKSFTMQGVPDPPSQRGIIPRAFEHIFETIQCAENTKFLVRASYLEIYKEEIRDLLGKDIKQKMELKEHPERGVYVRDLTMQTVHSVGECERVMDLGWRNRSVGYTLMNKDSSRSHSIFTIHLEICSIDTAGDEHLRAGKLNLVDLAGSERQSKTGATGDRLQEATKINLSLSALGNVISALVDGRSKYIPYRDSKLTRLLQDSLGGNTRTLMVACLSPADNNYEESISTLRYANRAKSIQNRPRINEDPKDALLREYQEEIKKLRALISGQLGSGNLSSFLAGQKSGEASAVVSRPQSNTSE----SEAEKDKIKEEYEKKLARLQAEYDAEQESKVKLQEDIAALRTSYETRLSSLERSRGSRTHTTGGVHLQQHKEEPITASAASQEQAKIDHSESEERPSSVDATV----------KGAASGESQILDSV-VVDIPGQ----LDQKLALERLQQLEQEFVGGEQVRNEELKQRHKQRKTLADQRKKQLIEALNQSSEDGDSVLLNVYDSIQEEVHAKSRHLENTQKKLKAAKLEIRDLQAEFEMERNDYLATIRRLEREGQLLQGILERMVSLVRRDCNYSNLDRLRKEAVWDEEGGTWRLPDVLVQKTTLP 692          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: kif3cb (kinesin family member 3Cb [Source:ZFIN;Acc:ZDB-GENE-080709-4])

HSP 1 Score: 422.935 bits (1086), Expect = 1.200e-135
Identity = 218/361 (60.39%), Postives = 269/361 (74.52%), Query Frame = 3
Query:   33 EAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQML 1115
            EAVKV+VR RPLN++E  +N + I+++DV  GQ S+RNP  + +  K F FD  Y++ S   +LY     PL+++V  G+NGTIFAYGQTG GK++TM+G+      RGVIP +F H+F  IS ++N +YLV  SY+EIY EEIRDLL KD   KL+LKE+PE GVYV  LS     N+++ + VM  G ++R+ G T MN  SSRSH+IF I +E      + E+HI+ GKLN+VDLAGSERQSKTG  G R KEA KINLSLSALGNVISALVDGKS H+PYRDSKLTR+LQDSLGGN KT+M+A + PA   Y+ETL+TLRYANRAKNI+NKPKINEDPKDALLREFQ EI RLK  L
Sbjct:   20 EAVKVVVRCRPLNKKEEAMNQERIVEVDVRLGQVSVRNPKSSGSLVKSFTFDAVYDVSSKQNELYDYACKPLIDSVLLGFNGTIFAYGQTGTGKTYTMEGVPTDPETRGVIPNSFQHIFTQISRSQNQQYLVRVSYIEIYQEEIRDLLCKDNNKKLELKENPELGVYVKDLSCVVTKNIKEIEHVMNLGNQSRSVGFTKMNERSSRSHAIFVITIECSEMGIDGEDHIRVGKLNMVDLAGSERQSKTGVQGRRFKEAAKINLSLSALGNVISALVDGKSTHVPYRDSKLTRLLQDSLGGNAKTVMVATVGPASCYYDETLTTLRYANRAKNIKNKPKINEDPKDALLREFQEEIARLKAQL 380          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: kif3ca (kinesin family member 3Ca [Source:ZFIN;Acc:ZDB-GENE-111214-2])

HSP 1 Score: 421.779 bits (1083), Expect = 2.690e-135
Identity = 221/367 (60.22%), Postives = 272/367 (74.11%), Query Frame = 3
Query:   27 SGEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRN----PNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQML 1115
            +GE+VKV+VR RPLN +E +   +NI+ +DV  GQ ++RN    P D     K F FD  Y+  S    LY + V PL+++V  G+NGTIFAYGQTG GK++TMQG    + +RG+IP +F+H+F  IS ++N +YLV ASYLEIY EEIRDLL KD   KL+LKE  + GVY+  LS     NV++ + VM  G + R+ G T MN  SSRSH+IF I +E      + +NHI+ GKLNLVDLAGSERQ+KTG  G+RLKEATKINLSLSALGNVISALVDG+S H+PYRDSKLTR+LQDSLGGN KT+M+A L PA  NYEETL+TLRYANRAKNI+NKP++NEDPKDALLREFQ EI RLK  L
Sbjct:    7 TGESVKVVVRCRPLNRKEESSGYENIVQMDVKLGQVALRNAKAGPGD---LLKTFTFDAVYDECSKQGDLYDETVRPLIDSVLRGFNGTIFAYGQTGTGKTYTMQGQWLDAERRGIIPNSFEHIFTHISRSQNQQYLVRASYLEIYQEEIRDLLTKDHSKKLELKESADSGVYIKDLSSFVTKNVKEIEHVMNVGNQTRSVGFTNMNEHSSRSHAIFIITVECSQLGPDGQNHIRVGKLNLVDLAGSERQTKTGVQGERLKEATKINLSLSALGNVISALVDGRSSHVPYRDSKLTRLLQDSLGGNAKTIMVATLGPASYNYEETLTTLRYANRAKNIKNKPRVNEDPKDALLREFQEEIARLKAQL 370          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: kif3b (kinesin family member 3B [Source:ZFIN;Acc:ZDB-GENE-050119-3])

HSP 1 Score: 420.624 bits (1080), Expect = 6.145e-135
Identity = 215/356 (60.39%), Postives = 269/356 (75.56%), Query Frame = 3
Query:   54 RVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQKP--FFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQML 1115
            R RP+NE+E   N   ++ +DV  GQ ++ NP    + + P  F FD  Y+ +S   +LY +   PLV++V  G+NGTIFAYGQTG GK++TM+G+ N   +RGVIP +F+H+F  IS ++N +YLV ASYLEIY EEIRDLL+KD   +L+LKE P+ GVYV  LS     +VR+ + VM  G +NR+ G+T MN  SSRSH+IF I +E      + ENHI+ GKLNLVDLAGSERQ+KTGA G+RLKEATKINLSLSALGNVISALVDG+S HIPYRDSKLTR+LQDSLGGN +T+M+A + PA  N EETL+TLRYANRAKNI+NKP++NEDPKDALLREFQ EI RLK+ L
Sbjct:   15 RCRPMNEKERVANFNRVVSVDVKLGQVAVCNPRGASSHEHPKVFTFDSVYDWNSKQMELYDETFRPLVDSVLFGFNGTIFAYGQTGTGKTYTMEGVRNDPERRGVIPNSFEHIFTHISRSQNQQYLVRASYLEIYQEEIRDLLSKDQARRLELKERPDTGVYVKDLSSFVTKSVREIEHVMNVGNQNRSVGATNMNEHSSRSHAIFVITIECSELGPDGENHIRVGKLNLVDLAGSERQTKTGAQGERLKEATKINLSLSALGNVISALVDGRSTHIPYRDSKLTRLLQDSLGGNARTVMVANIGPASYNVEETLTTLRYANRAKNIKNKPRVNEDPKDALLREFQEEIARLKEQL 370          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: kif3b (kinesin family member 3B [Source:ZFIN;Acc:ZDB-GENE-050119-3])

HSP 1 Score: 420.239 bits (1079), Expect = 1.923e-134
Identity = 215/356 (60.39%), Postives = 269/356 (75.56%), Query Frame = 3
Query:   54 RVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQKP--FFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQML 1115
            R RP+NE+E   N   ++ +DV  GQ ++ NP    + + P  F FD  Y+ +S   +LY +   PLV++V  G+NGTIFAYGQTG GK++TM+G+ N   +RGVIP +F+H+F  IS ++N +YLV ASYLEIY EEIRDLL+KD   +L+LKE P+ GVYV  LS     +VR+ + VM  G +NR+ G+T MN  SSRSH+IF I +E      + ENHI+ GKLNLVDLAGSERQ+KTGA G+RLKEATKINLSLSALGNVISALVDG+S HIPYRDSKLTR+LQDSLGGN +T+M+A + PA  N EETL+TLRYANRAKNI+NKP++NEDPKDALLREFQ EI RLK+ L
Sbjct:   15 RCRPMNEKERVANFNRVVSVDVKLGQVAVCNPRGASSHEHPKVFTFDSVYDWNSKQMELYDETFRPLVDSVLFGFNGTIFAYGQTGTGKTYTMEGVRNDPERRGVIPNSFEHIFTHISRSQNQQYLVRASYLEIYQEEIRDLLSKDQARRLELKERPDTGVYVKDLSSFVTKSVREIEHVMNVGNQNRSVGATNMNEHSSRSHAIFVITIECSELGPDGENHIRVGKLNLVDLAGSERQTKTGAQGERLKEATKINLSLSALGNVISALVDGRSTHIPYRDSKLTRLLQDSLGGNARTVMVANIGPASYNVEETLTTLRYANRAKNIKNKPRVNEDPKDALLREFQEEIARLKEQL 370          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: KIF3C (kinesin family member 3C [Source:NCBI gene;Acc:100491018])

HSP 1 Score: 424.091 bits (1089), Expect = 5.394e-136
Identity = 221/364 (60.71%), Postives = 268/364 (73.63%), Query Frame = 3
Query:   27 SGEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTP-QKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQML 1115
            S EA+KV+VR RP N +E     + I+D+D+  GQ ++R+P  N     K F FD  Y+  S    LY + V PL+++V +G+NGTIFAYGQTG GK++TMQG+     +RGVIP  FDH+F  IS ++N +YLV ASYLEIY EEIRDLL KD   KL+LKE+PE GVY+  LS     NV++ + VM  G ++R+   T MN  SSRSH+IF I +E      + E HI+ GKLNLVDLAGSERQSKTG  GDR KEA+KINLSLSALGNVISALVDG+S HIPYRDSKLTR+LQDSLGGN KT+M+A L PA  NY+ETLSTLR+ANRAKNI+NKP+INEDPKD LLREFQ EI RLK  L
Sbjct:    7 SSEALKVVVRCRPTNRKEEAAGYEGIVDMDIKLGQVTMRHPRANPGELAKTFTFDAVYDASSKQADLYDETVRPLIDSVLQGFNGTIFAYGQTGTGKTYTMQGVWAEPEKRGVIPNTFDHIFTHISRSQNQQYLVRASYLEIYQEEIRDLLCKDQNRKLELKENPETGVYIKDLSSFVTKNVKEIEHVMNLGNQSRSVACTYMNEYSSRSHTIFVITVECSEIGVDGEEHIRVGKLNLVDLAGSERQSKTGINGDRPKEASKINLSLSALGNVISALVDGRSTHIPYRDSKLTRLLQDSLGGNAKTIMVATLGPASVNYDETLSTLRFANRAKNIKNKPRINEDPKDTLLREFQEEIARLKAQL 370          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: insm2 (insulinoma-associated 2 [Source:Xenbase;Acc:XB-GENE-986609])

HSP 1 Score: 422.935 bits (1086), Expect = 1.140e-135
Identity = 217/365 (59.45%), Postives = 276/365 (75.62%), Query Frame = 3
Query:   27 SGEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIR--NPNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQML 1115
            S E+V+V+VR RP+N +E+    + ++D+DV  GQ +++      N+ P K F FD  Y+ +S   +LY +   PLV++V  G+NGTIFAYGQTG GK++TM+G+     +RGVIP +F+H+F  IS ++N +YLV ASYLEIY EEIRDLL+KD   +L+LKE P+ GVYV  LS     +V++ + VM  G +NR+ G+T MN  SSRSH+IF I +E      + ENHI+ GKLNLVDLAGSERQ+KTGA G+RLKEATKINLSLSALGNVISALVDG+S HIPYRDSKLTR+LQDSLGGN KT+M+A + PA  N EETL+TLRY+NRAKNI+NKP++NEDPKDALLREFQ EI RLK  L
Sbjct:    6 SSESVRVVVRCRPMNSKELAAGYERVVDVDVKLGQVAVKVHKGAANELP-KTFTFDAVYDSNSKQVELYDETFRPLVDSVLLGFNGTIFAYGQTGTGKTYTMEGVRIDPEKRGVIPNSFEHIFTHISRSQNQQYLVRASYLEIYQEEIRDLLSKDQSKRLELKERPDTGVYVKDLSSFVTKSVKEIEHVMNVGNQNRSVGATNMNEHSSRSHAIFMITIECSQIGLDGENHIRVGKLNLVDLAGSERQTKTGAQGERLKEATKINLSLSALGNVISALVDGRSTHIPYRDSKLTRLLQDSLGGNAKTVMVANIGPASYNVEETLTTLRYSNRAKNIKNKPRVNEDPKDALLREFQEEIARLKAQL 369          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: insm2 (insulinoma-associated 2 [Source:Xenbase;Acc:XB-GENE-986609])

HSP 1 Score: 422.55 bits (1085), Expect = 2.239e-135
Identity = 217/365 (59.45%), Postives = 276/365 (75.62%), Query Frame = 3
Query:   27 SGEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIR--NPNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQML 1115
            S E+V+V+VR RP+N +E+    + ++D+DV  GQ +++      N+ P K F FD  Y+ +S   +LY +   PLV++V  G+NGTIFAYGQTG GK++TM+G+     +RGVIP +F+H+F  IS ++N +YLV ASYLEIY EEIRDLL+KD   +L+LKE P+ GVYV  LS     +V++ + VM  G +NR+ G+T MN  SSRSH+IF I +E      + ENHI+ GKLNLVDLAGSERQ+KTGA G+RLKEATKINLSLSALGNVISALVDG+S HIPYRDSKLTR+LQDSLGGN KT+M+A + PA  N EETL+TLRY+NRAKNI+NKP++NEDPKDALLREFQ EI RLK  L
Sbjct:    6 SSESVRVVVRCRPMNSKELAAGYERVVDVDVKLGQVAVKVHKGAANELP-KTFTFDAVYDSNSKQVELYDETFRPLVDSVLLGFNGTIFAYGQTGTGKTYTMEGVRIDPEKRGVIPNSFEHIFTHISRSQNQQYLVRASYLEIYQEEIRDLLSKDQSKRLELKERPDTGVYVKDLSSFVTKSVKEIEHVMNVGNQNRSVGATNMNEHSSRSHAIFMITIECSQIGLDGENHIRVGKLNLVDLAGSERQTKTGAQGERLKEATKINLSLSALGNVISALVDGRSTHIPYRDSKLTRLLQDSLGGNAKTVMVANIGPASYNVEETLTTLRYSNRAKNIKNKPRVNEDPKDALLREFQEEIARLKAQL 369          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: cbll1 (Cbl proto-oncogene-like 1, E3 ubiquitin protein ligase [Source:Xenbase;Acc:XB-GENE-6458353])

HSP 1 Score: 408.297 bits (1048), Expect = 1.059e-130
Identity = 213/364 (58.52%), Postives = 268/364 (73.63%), Query Frame = 3
Query:   27 SGEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAE-NSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQML 1115
            S + VKV+VR RPLNERE  +N K  + +D  RG  ++   +    P K F FD  +  DS    +Y+    P++++V EGYNGTIFAYGQTG GK+FTM+G+      RG+IP +F HVF  I+ AE ++++LV  SYLEIYNEE+RDLL KD   +L++KE P+ GVY+  LS + V+N  D   +M  G KNR+ G+T MN  SSRSH+IFTI +E      +   H++ GKL+LVDLAGSERQ+KTGATG RLKEATKINLSLS LGNVISALVDGKS H+PYR+SKLTR+LQDSLGGN+KT+M A + PAD NY+ET+STLRYANRAKNI+NK +INEDPKDALLR+FQ EI  LK+ L
Sbjct:   13 SCDNVKVVVRCRPLNERERAMNSKMAVGVDEMRGTITVHKVDSMNEPPKTFTFDTVFGPDSNQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAVPELRGIIPNSFAHVFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQSQRLEVKERPDVGVYIKDLSGYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGADGNIHVRMGKLHLVDLAGSERQAKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQFQKEIEDLKKKL 376          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: cbll1 (Cbl proto-oncogene-like 1, E3 ubiquitin protein ligase [Source:Xenbase;Acc:XB-GENE-6458353])

HSP 1 Score: 408.297 bits (1048), Expect = 1.713e-130
Identity = 213/364 (58.52%), Postives = 268/364 (73.63%), Query Frame = 3
Query:   27 SGEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAE-NSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQML 1115
            S + VKV+VR RPLNERE  +N K  + +D  RG  ++   +    P K F FD  +  DS    +Y+    P++++V EGYNGTIFAYGQTG GK+FTM+G+      RG+IP +F HVF  I+ AE ++++LV  SYLEIYNEE+RDLL KD   +L++KE P+ GVY+  LS + V+N  D   +M  G KNR+ G+T MN  SSRSH+IFTI +E      +   H++ GKL+LVDLAGSERQ+KTGATG RLKEATKINLSLS LGNVISALVDGKS H+PYR+SKLTR+LQDSLGGN+KT+M A + PAD NY+ET+STLRYANRAKNI+NK +INEDPKDALLR+FQ EI  LK+ L
Sbjct:   12 SCDNVKVVVRCRPLNERERAMNSKMAVGVDEMRGTITVHKVDSMNEPPKTFTFDTVFGPDSNQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAVPELRGIIPNSFAHVFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQSQRLEVKERPDVGVYIKDLSGYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGADGNIHVRMGKLHLVDLAGSERQAKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQFQKEIEDLKKKL 375          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Kif17 (kinesin family member 17 [Source:MGI Symbol;Acc:MGI:1098229])

HSP 1 Score: 577.785 bits (1488), Expect = 0.000e+0
Identity = 303/495 (61.21%), Postives = 381/495 (76.97%), Query Frame = 3
Query:   24 MSGEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQMLAGQI-PINMDAVSTAK----PTDSSEK-------HRLTEIERXXXXXXXXXXXXXXXXQYSAEAADKAKLKSDMEKLKQYYDEKL--MQLDIRDIPNSDEVLR---LFEPKIFTSSS-NSGPQ--PIGQFE 1448
            M+ E+VKV+VR RP+N+RE  L+C++++ +D +RGQC I+NP     P K F FDG+Y I+  TEQ+Y++I YPLVE VTEGYNGTIFAYGQTG GKSFTMQG+ +P  QRG+IPRAF+HVFE++  AEN+K+LV ASYLEIYNE++ DLL  D K +L+LKEHPEKGVYV GLSMH V NV  C+ VME GWKNRA G TLMN DSSRSHSIFTI +E++  DE  ++H++AGKLNLVDLAGSERQSKTGATG+RLKEATKINLSLSALGNVISALVDG+ KHIPYRDSKLTR+LQDSLGGNTKTLM+ACLSPADNNY+ETLSTLRYANRAKNI+NKP+INEDPKDALLRE+Q EI RLK +LA Q+ P N+ A+ + +    P  S EK        + TE E++ I+ EYE +L   +A Y AE   + +L+ D+  ++  YD KL  +Q ++R    ++ +L+   L + ++ + +   SGP+  P  Q+E
Sbjct:    1 MASESVKVVVRCRPMNKRERELSCQSVVTVDSARGQCFIQNPGAADEPPKQFTFDGAYYIEHFTEQIYNEIAYPLVEGVTEGYNGTIFAYGQTGSGKSFTMQGLPDPPCQRGIIPRAFEHVFESVQCAENTKFLVRASYLEIYNEDVHDLLGADTKQRLELKEHPEKGVYVKGLSMHTVHNVAQCERVMETGWKNRAVGYTLMNKDSSRSHSIFTINIEIYAVDERGKDHLRAGKLNLVDLAGSERQSKTGATGERLKEATKINLSLSALGNVISALVDGRCKHIPYRDSKLTRLLQDSLGGNTKTLMVACLSPADNNYDETLSTLRYANRAKNIKNKPRINEDPKDALLREYQEEIKRLKAILAQQMGPGNLSALLSTQTPPGPVQSEEKLLSPTTVQQDTEAEKQLIREEYEERLARLKADYEAEQESRVRLQEDITAMRNSYDVKLSTLQENLRKEKETEAILKAEVLCKTEVMSRAELASGPEYSPPLQYE 495          

HSP 2 Score: 127.487 bits (319), Expect = 1.823e-29
Identity = 95/314 (30.25%), Postives = 179/314 (57.01%), Query Frame = 3
Query: 1554 AVHVRTVPKQEVLIHDKNELLSKLQYLQSTMVGGEQINNEVAKDXXXXXXXXXXXXXXXLMDSNERMEDDG---IMLGVFEDIQDELRVKSKLLQKEKNKNLSLIQEMSDINEEFHKERCDYLESIRKLDRENKLLQMMMEKIQPCIKKSCNYSNFDKIKSQAKFDEESGKWILPQLKLEDTQLPNADEKIRDNVDENYYRKLARKP---DPSQEYFQNRKSGQLLNQRNSPNNISNSQYNSQLGYVSVNNSNLQKLSDHQYEA---NSYSNDFRAAEVHGQFQLNPDVPTRRGAYRLDAIQT-VTKPRKKSSK 2465
             V V  + ++E+   D+ ++L++LQ L+  +VGGEQ  N+  +++H +RKR+A+E+K++L+ + +  ++DG   ++L V++ IQ+E+R KSKLL+K + K  +   E+ D+  EF  E+ DYL +IR+ +R++ L Q ++E++QP I++ CNYSN +KI+ ++ +DE++G W +P   +  T LP         V      K ARK    D  + + Q     +L+  R+   NI+++ + S+     ++   ++ L+ H       +S SN+             P++P  R  +RL+++    +K ++K SK
Sbjct:  731 GVEVAVLTEEELQPVDQQQVLARLQLLEQQVVGGEQAKNKDLREKHKRRKRYADERKKQLVAALQNSDEDGGDWVLLNVYDSIQEEVRAKSKLLEKMQRKLRAAEVEIKDLQSEFQLEKIDYLATIRRQERDSMLFQQLLEQVQPLIRRDCNYSNLEKIRRESSWDEDNGFWKIPDPIILKTSLP--------VVPTGTQNKPARKTSAVDSGEPHMQEEDRYKLMLSRSDSENIASNYFRSKRASQILSTDPMKSLTYHNSPPGLNSSLSNNSALPPTQ-----TPEMPQPR-PFRLESLDIPFSKAKRKKSK 1030          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Kif17 (kinesin family member 17 [Source:MGI Symbol;Acc:MGI:1098229])

HSP 1 Score: 566.229 bits (1458), Expect = 0.000e+0
Identity = 275/391 (70.33%), Postives = 327/391 (83.63%), Query Frame = 3
Query:   24 MSGEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQMLAGQI-PINMDAVSTAK----PTDSSEK 1181
            M+ E+VKV+VR RP+N+RE  L+C++++ +D +RGQC I+NP     P K F FDG+Y I+  TEQ+Y++I YPLVE VTEGYNGTIFAYGQTG GKSFTMQG+ +P  QRG+IPRAF+HVFE++  AEN+K+LV ASYLEIYNE++ DLL  D K +L+LKEHPEKGVYV GLSMH V NV  C+ VME GWKNRA G TLMN DSSRSHSIFTI +E++  DE  ++H++AGKLNLVDLAGSERQSKTGATG+RLKEATKINLSLSALGNVISALVDG+ KHIPYRDSKLTR+LQDSLGGNTKTLM+ACLSPADNNY+ETLSTLRYANRAKNI+NKP+INEDPKDALLRE+Q EI RLK +LA Q+ P N+ A+ + +    P  S EK
Sbjct:    1 MASESVKVVVRCRPMNKRERELSCQSVVTVDSARGQCFIQNPGAADEPPKQFTFDGAYYIEHFTEQIYNEIAYPLVEGVTEGYNGTIFAYGQTGSGKSFTMQGLPDPPCQRGIIPRAFEHVFESVQCAENTKFLVRASYLEIYNEDVHDLLGADTKQRLELKEHPEKGVYVKGLSMHTVHNVAQCERVMETGWKNRAVGYTLMNKDSSRSHSIFTINIEIYAVDERGKDHLRAGKLNLVDLAGSERQSKTGATGERLKEATKINLSLSALGNVISALVDGRCKHIPYRDSKLTRLLQDSLGGNTKTLMVACLSPADNNYDETLSTLRYANRAKNIKNKPRINEDPKDALLREYQEEIKRLKAILAQQMGPGNLSALLSTQTPPGPVQSEEK 391          

HSP 2 Score: 123.25 bits (308), Expect = 2.100e-28
Identity = 69/185 (37.30%), Postives = 127/185 (68.65%), Query Frame = 3
Query: 1554 AVHVRTVPKQEVLIHDKNELLSKLQYLQSTMVGGEQINNEVAKDXXXXXXXXXXXXXXXLMDSNERMEDDG---IMLGVFEDIQDELRVKSKLLQKEKNKNLSLIQEMSDINEEFHKERCDYLESIRKLDRENKLLQMMMEKIQPCIKKSCNYSNFDKIKSQAKFDEESGKWILPQLKLEDTQLP 2099
             V V  + ++E+   D+ ++L++LQ L+  +VGGEQ  N+  +++H +RKR+A+E+K++L+ + +  ++DG   ++L V++ IQ+E+R KSKLL+K + K  +   E+ D+  EF  E+ DYL +IR+ +R++ L Q ++E++QP I++ CNYSN +KI+ ++ +DE++G W +P   +  T LP
Sbjct:  494 GVEVAVLTEEELQPVDQQQVLARLQLLEQQVVGGEQAKNKDLREKHKRRKRYADERKKQLVAALQNSDEDGGDWVLLNVYDSIQEEVRAKSKLLEKMQRKLRAAEVEIKDLQSEFQLEKIDYLATIRRQERDSMLFQQLLEQVQPLIRRDCNYSNLEKIRRESSWDEDNGFWKIPDPIILKTSLP 678          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Kif3b (kinesin family member 3B [Source:MGI Symbol;Acc:MGI:107688])

HSP 1 Score: 434.491 bits (1116), Expect = 3.882e-140
Identity = 222/367 (60.49%), Postives = 279/367 (76.02%), Query Frame = 3
Query:   21 LMSGEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNP--NDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQML 1115
            L S E+V+V+VR RP+N +E   +   ++D+DV  GQ S++NP    ++ P K F FD  Y+ ++   +LY +   PLV++V +G+NGTIFAYGQTG GK++TM+G+     +RGVIP +FDH+F  IS ++N +YLV ASYLEIY EEIRDLL+KD   +L+LKE P+ GVYV  LS     +V++ + VM  G +NR+ G+T MN  SSRSH+IF I +E      + ENHI+ GKLNLVDLAGSERQ+KTGA G+RLKEATKINLSLSALGNVISALVDGKS HIPYRDSKLTR+LQDSLGGN KT+M+A + PA  N EETL+TLRYANRAKNI+NKP++NEDPKDALLREFQ EI RLK  L
Sbjct:    4 LKSSESVRVVVRCRPMNGKEKAASYDKVVDVDVKLGQVSVKNPKGTSHEMP-KTFTFDAVYDWNAKQFELYDETFRPLVDSVLQGFNGTIFAYGQTGTGKTYTMEGVRGDPEKRGVIPNSFDHIFTHISRSQNQQYLVRASYLEIYQEEIRDLLSKDQTKRLELKERPDTGVYVKDLSSFVTKSVKEIEHVMNVGNQNRSVGATNMNEHSSRSHAIFVITIECSEVGLDGENHIRVGKLNLVDLAGSERQAKTGAQGERLKEATKINLSLSALGNVISALVDGKSTHIPYRDSKLTRLLQDSLGGNAKTVMVANVGPASYNVEETLTTLRYANRAKNIKNKPRVNEDPKDALLREFQEEIARLKAQL 369          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Kif3a (kinesin family member 3A [Source:MGI Symbol;Acc:MGI:107689])

HSP 1 Score: 406.757 bits (1044), Expect = 3.090e-130
Identity = 210/364 (57.69%), Postives = 269/364 (73.90%), Query Frame = 3
Query:   27 SGEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAE-NSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQML 1115
            S + VKV+VR RPLNERE ++  +  + +D  RG  ++   + +  P K F FD  +  +S    +Y+    P++++V EGYNGTIFAYGQTG GK+FTM+G+      RGVIP +F H+F  I+ AE ++++LV  SYLEIYNEE+RDLL KD   +L++KE P+ GVY+  LS + V+N  D   +M  G KNR+ G+T MN  SSRSH+IFTI +E      +   H++ GKL+LVDLAGSERQ+KTGATG RLKEATKINLSLS LGNVISALVDGKS H+PYR+SKLTR+LQDSLGGN+KT+M A + PAD NY+ET+STLRYANRAKNI+NK +INEDPKDALLR+FQ EI  LK+ L
Sbjct:   11 SCDNVKVVVRCRPLNEREKSMCYRQAVSVDEMRGTITVHKTDSSNEPPKTFTFDTVFGPESKQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAVPGLRGVIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQTQRLEVKERPDVGVYIKDLSAYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGVDGNMHVRMGKLHLVDLAGSERQAKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQFQKEIEELKKKL 374          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Kif3a (kinesin family member 3A [Source:MGI Symbol;Acc:MGI:107689])

HSP 1 Score: 406.757 bits (1044), Expect = 3.423e-130
Identity = 210/364 (57.69%), Postives = 269/364 (73.90%), Query Frame = 3
Query:   27 SGEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAE-NSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQML 1115
            S + VKV+VR RPLNERE ++  +  + +D  RG  ++   + +  P K F FD  +  +S    +Y+    P++++V EGYNGTIFAYGQTG GK+FTM+G+      RGVIP +F H+F  I+ AE ++++LV  SYLEIYNEE+RDLL KD   +L++KE P+ GVY+  LS + V+N  D   +M  G KNR+ G+T MN  SSRSH+IFTI +E      +   H++ GKL+LVDLAGSERQ+KTGATG RLKEATKINLSLS LGNVISALVDGKS H+PYR+SKLTR+LQDSLGGN+KT+M A + PAD NY+ET+STLRYANRAKNI+NK +INEDPKDALLR+FQ EI  LK+ L
Sbjct:   11 SCDNVKVVVRCRPLNEREKSMCYRQAVSVDEMRGTITVHKTDSSNEPPKTFTFDTVFGPESKQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAVPGLRGVIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQTQRLEVKERPDVGVYIKDLSAYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGVDGNMHVRMGKLHLVDLAGSERQAKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQFQKEIEELKKKL 374          
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Match: sp|Q99PW8|KIF17_MOUSE (Kinesin-like protein KIF17 OS=Mus musculus OX=10090 GN=Kif17 PE=1 SV=1)

HSP 1 Score: 577.785 bits (1488), Expect = 0.000e+0
Identity = 303/495 (61.21%), Postives = 381/495 (76.97%), Query Frame = 3
Query:   24 MSGEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQMLAGQI-PINMDAVSTAK----PTDSSEK-------HRLTEIERXXXXXXXXXXXXXXXXQYSAEAADKAKLKSDMEKLKQYYDEKL--MQLDIRDIPNSDEVLR---LFEPKIFTSSS-NSGPQ--PIGQFE 1448
            M+ E+VKV+VR RP+N+RE  L+C++++ +D +RGQC I+NP     P K F FDG+Y I+  TEQ+Y++I YPLVE VTEGYNGTIFAYGQTG GKSFTMQG+ +P  QRG+IPRAF+HVFE++  AEN+K+LV ASYLEIYNE++ DLL  D K +L+LKEHPEKGVYV GLSMH V NV  C+ VME GWKNRA G TLMN DSSRSHSIFTI +E++  DE  ++H++AGKLNLVDLAGSERQSKTGATG+RLKEATKINLSLSALGNVISALVDG+ KHIPYRDSKLTR+LQDSLGGNTKTLM+ACLSPADNNY+ETLSTLRYANRAKNI+NKP+INEDPKDALLRE+Q EI RLK +LA Q+ P N+ A+ + +    P  S EK        + TE E++ I+ EYE +L   +A Y AE   + +L+ D+  ++  YD KL  +Q ++R    ++ +L+   L + ++ + +   SGP+  P  Q+E
Sbjct:    1 MASESVKVVVRCRPMNKRERELSCQSVVTVDSARGQCFIQNPGAADEPPKQFTFDGAYYIEHFTEQIYNEIAYPLVEGVTEGYNGTIFAYGQTGSGKSFTMQGLPDPPCQRGIIPRAFEHVFESVQCAENTKFLVRASYLEIYNEDVHDLLGADTKQRLELKEHPEKGVYVKGLSMHTVHNVAQCERVMETGWKNRAVGYTLMNKDSSRSHSIFTINIEIYAVDERGKDHLRAGKLNLVDLAGSERQSKTGATGERLKEATKINLSLSALGNVISALVDGRCKHIPYRDSKLTRLLQDSLGGNTKTLMVACLSPADNNYDETLSTLRYANRAKNIKNKPRINEDPKDALLREYQEEIKRLKAILAQQMGPGNLSALLSTQTPPGPVQSEEKLLSPTTVQQDTEAEKQLIREEYEERLARLKADYEAEQESRVRLQEDITAMRNSYDVKLSTLQENLRKEKETEAILKAEVLCKTEVMSRAELASGPEYSPPLQYE 495          

HSP 2 Score: 127.487 bits (319), Expect = 1.275e-28
Identity = 95/314 (30.25%), Postives = 179/314 (57.01%), Query Frame = 3
Query: 1554 AVHVRTVPKQEVLIHDKNELLSKLQYLQSTMVGGEQINNEVAKDXXXXXXXXXXXXXXXLMDSNERMEDDG---IMLGVFEDIQDELRVKSKLLQKEKNKNLSLIQEMSDINEEFHKERCDYLESIRKLDRENKLLQMMMEKIQPCIKKSCNYSNFDKIKSQAKFDEESGKWILPQLKLEDTQLPNADEKIRDNVDENYYRKLARKP---DPSQEYFQNRKSGQLLNQRNSPNNISNSQYNSQLGYVSVNNSNLQKLSDHQYEA---NSYSNDFRAAEVHGQFQLNPDVPTRRGAYRLDAIQT-VTKPRKKSSK 2465
             V V  + ++E+   D+ ++L++LQ L+  +VGGEQ  N+  +++H +RKR+A+E+K++L+ + +  ++DG   ++L V++ IQ+E+R KSKLL+K + K  +   E+ D+  EF  E+ DYL +IR+ +R++ L Q ++E++QP I++ CNYSN +KI+ ++ +DE++G W +P   +  T LP         V      K ARK    D  + + Q     +L+  R+   NI+++ + S+     ++   ++ L+ H       +S SN+             P++P  R  +RL+++    +K ++K SK
Sbjct:  731 GVEVAVLTEEELQPVDQQQVLARLQLLEQQVVGGEQAKNKDLREKHKRRKRYADERKKQLVAALQNSDEDGGDWVLLNVYDSIQEEVRAKSKLLEKMQRKLRAAEVEIKDLQSEFQLEKIDYLATIRRQERDSMLFQQLLEQVQPLIRRDCNYSNLEKIRRESSWDEDNGFWKIPDPIILKTSLP--------VVPTGTQNKPARKTSAVDSGEPHMQEEDRYKLMLSRSDSENIASNYFRSKRASQILSTDPMKSLTYHNSPPGLNSSLSNNSALPPTQ-----TPEMPQPR-PFRLESLDIPFSKAKRKKSK 1030          
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Match: sp|Q9P2E2|KIF17_HUMAN (Kinesin-like protein KIF17 OS=Homo sapiens OX=9606 GN=KIF17 PE=2 SV=3)

HSP 1 Score: 565.844 bits (1457), Expect = 0.000e+0
Identity = 286/453 (63.13%), Postives = 352/453 (77.70%), Query Frame = 3
Query:   24 MSGEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQMLAGQIPINMDAVSTAK-----PTDSSEK-------HRLTEIERXXXXXXXXXXXXXXXXQYSAEAADKAKLKSDMEKLKQYYDEKLMQLD 1346
            M+ EAVKV+VR RP+N+RE  L C+ ++ +D +R QC I+NP     P K F FDG+Y++D  TEQ+Y++I YPLVE VTEGYNGTIFAYGQTG GKSFTMQG+ +P +QRG+IPRAF+HVFE++  AEN+K+LV ASYLEIYNE++RDLL  D K KL+LKEHPEKGVYV GLSMH V +V  C+ +ME GWKNR+ G TLMN DSSRSHSIFTI +EM   DE  ++H++AGKLNLVDLAGSERQSKTGATG+RLKEATKINLSLSALGNVISALVDG+ KH+PYRDSKLTR+LQDSLGGNTKTLM+ACLSPADNNY+ETLSTLRYANRAKNI+NKP+INEDPKDALLRE+Q EI +LK +L  Q+  +  +   ++     P    EK           E E++ I+ EYE +L   +A Y AE   +A+L+ D+  ++  YD +L  L+
Sbjct:    1 MASEAVKVVVRCRPMNQRERELRCQPVVTVDCARAQCCIQNPGAADEPPKQFTFDGAYHVDHVTEQIYNEIAYPLVEGVTEGYNGTIFAYGQTGSGKSFTMQGLPDPPSQRGIIPRAFEHVFESVQCAENTKFLVRASYLEIYNEDVRDLLGADTKQKLELKEHPEKGVYVKGLSMHTVHSVAQCEHIMETGWKNRSVGYTLMNKDSSRSHSIFTISIEMSAVDERGKDHLRAGKLNLVDLAGSERQSKTGATGERLKEATKINLSLSALGNVISALVDGRCKHVPYRDSKLTRLLQDSLGGNTKTLMVACLSPADNNYDETLSTLRYANRAKNIRNKPRINEDPKDALLREYQEEIKKLKAILTQQMSPSSLSALLSRQVPPDPVQVEEKLLPQPVIQHDVEAEKQLIREEYEERLARLKADYKAEQESRARLEEDITAMRNSYDVRLSTLE 453          

HSP 2 Score: 102.449 bits (254), Expect = 8.367e-21
Identity = 78/246 (31.71%), Postives = 150/246 (60.98%), Query Frame = 3
Query: 1593 IHDKNELLSKLQYLQSTMVGGEQINNEVAKDXXXXXXXXXXXXXXXLMDSNERMEDDG---IMLGVFEDIQDELRVKSKLLQKEKNKNLSLIQEMSDINEEFHKERCDYLESIRKLDRENKLLQMMMEKIQPCIKKSCNYSNFDKIKSQAKFDEESGKWILPQLKLEDTQLP---------------NADEKIRDNVDENYYRKLARKPDP---SQEYFQNRKSGQLLN--------QRNSPNNIS 2243
            + D+ ++L++LQ L+  +VGGEQ  N+  K++H +RKR+A+E++++L+ + +  ++D    ++L V++ IQ+E+R KSKLL+K + K  +   E+ D+  EF  E+ DYL +IR+ +R++ LLQ ++E++QP I++ CNYSN +KI  ++ +DE++G W +P   +  T LP               +A +    N++++ YR +  + +    +  YF+++++ Q+L+          NSP  +S
Sbjct:  735 VVDQQQVLARLQLLEQQVVGGEQAKNKDLKEKHKRRKRYADERRKQLVAALQNSDEDSGDWVLLNVYDSIQEEVRAKSKLLEKMQRKLRAAEVEIKDLQSEFQLEKIDYLATIRRQERDSMLLQQLLEQVQPLIRRDCNYSNLEKILRESCWDEDNGFWKIPHPVITKTSLPVAVSTGPQNKPARKTSAADNGEPNMEDDRYRLMLSRSNSENIASNYFRSKRASQILSTDARKSLTHHNSPPGLS 980          
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Match: sp|P46873|OSM3_CAEEL (Osmotic avoidance abnormal protein 3 OS=Caenorhabditis elegans OX=6239 GN=osm-3 PE=1 SV=4)

HSP 1 Score: 492.271 bits (1266), Expect = 2.472e-162
Identity = 266/439 (60.59%), Postives = 323/439 (73.58%), Query Frame = 3
Query:   30 GEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQMLAGQIPINMDAVSTAKPTDSSEKHRLTEIERXXXXXXXXXXXXXXXXQYSAEAADKAKLKSDMEKLKQYYDEKLMQLD 1346
             E+V+V VR RP N+RE +LN    + +  + GQ ++  P+      K F FDG+Y +DST EQ+Y+DIV+PLVENV EGYNGT+FAYGQTG GK+F+MQGI     QRGVIPRAFDH+F   +  EN K+LVH SYLEIYNEE+RDLL  D K KL++KE P++GVYV+GLSMH   +V  C+ +M RG+ NR  G+TLMN DSSRSHSIFT+Y+E       E   I+ GKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTR+LQDSLGGNTKT+MIAC+SP+ +NY+ETLSTLRYANRAKNI+NKP INEDPKDALLRE+Q EI RLK M      +   AV    P   +      E ER+K++ E+E  + +   +Y  E   KA+L+ D+E L+  Y+     LD
Sbjct:    2 AESVRVAVRCRPFNQREKDLNTTLCVGMTPNVGQVNLNAPDG---AAKDFTFDGAYFMDSTGEQIYNDIVFPLVENVIEGYNGTVFAYGQTGSGKTFSMQGIETIPAQRGVIPRAFDHIFTATATTENVKFLVHCSYLEIYNEEVRDLLGADNKQKLEIKEQPDRGVYVAGLSMHVCHDVPACKELMTRGFNNRHVGATLMNKDSSRSHSIFTVYVEGMT----ETGSIRMGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRLLQDSLGGNTKTIMIACVSPSSDNYDETLSTLRYANRAKNIKNKPTINEDPKDALLREYQEEIARLKSM------VQPGAVGVGAPAQDAFS---IEEERKKLREEFEEAMNDLRGEYEREQTSKAELQKDLESLRADYERANANLD 424          

HSP 2 Score: 111.694 bits (278), Expect = 6.551e-24
Identity = 77/229 (33.62%), Postives = 127/229 (55.46%), Query Frame = 3
Query: 1608 ELLSKLQYLQSTMVGGEQINNEVAKDXXXXXXXXXXXXXXXLMDSNERMEDDGIMLGVFEDIQDELRVKSKLLQKEKNKNLSLIQEMSDINEEFHKERCDYLESIRKLDRENKLLQMMMEKIQPCIKKSCNYSNFDKIKSQAKFDEESGKWILPQLKLEDTQLPNADEK------------IRDNVDENYYRKLAR--KPDPSQEYFQNRKSGQLLNQRNSPNNISNSQ 2252
            E   K+Q LQ   +GGE+  N   K +  K+ + AE K ++L  +    +DD  +L V+   Q++L   +  L+KE  K+    +E+ D++ EF  +R DYL++IRK D++ KLL  +M+KIQP IKK  NYSN D+IK +A ++E+  +WILP++ +  T LP A+              +R N D+    +LA+    + +  YF+  K   ++N+  S   +S S+
Sbjct:  430 EAAKKIQQLQDQFIGGEEAGNTQLKQKRMKQLKEAETKTQKLAAALNVHKDDP-LLQVYSTTQEKLDAVTSQLEKEVKKSKGYEREIEDLHGEFELDRLDYLDTIRKQDQQLKLLMQIMDKIQPIIKKDTNYSNVDRIKKEAVWNEDESRWILPEMSMSRTILPLANNGYMQEPARQENTLLRSNFDDKLRERLAKSDSENLANSYFKPVKQINVINKYKSDQKLSTSK 657          
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Match: sp|O15066|KIF3B_HUMAN (Kinesin-like protein KIF3B OS=Homo sapiens OX=9606 GN=KIF3B PE=1 SV=1)

HSP 1 Score: 435.647 bits (1119), Expect = 7.732e-140
Identity = 223/367 (60.76%), Postives = 279/367 (76.02%), Query Frame = 3
Query:   21 LMSGEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPND--NKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQML 1115
            L S E+V+V+VR RP+N +E   +   ++D+DV  GQ S++NP    ++ P K F FD  Y+ ++   +LY +   PLV++V +G+NGTIFAYGQTG GK++TM+GI     +RGVIP +FDH+F  IS ++N +YLV ASYLEIY EEIRDLL+KD   +L+LKE P+ GVYV  LS     +V++ + VM  G +NR+ G+T MN  SSRSH+IF I +E      + ENHI+ GKLNLVDLAGSERQ+KTGA G+RLKEATKINLSLSALGNVISALVDGKS HIPYRDSKLTR+LQDSLGGN KT+M+A + PA  N EETL+TLRYANRAKNI+NKP++NEDPKDALLREFQ EI RLK  L
Sbjct:    4 LKSSESVRVVVRCRPMNGKEKAASYDKVVDVDVKLGQVSVKNPKGTAHEMP-KTFTFDAVYDWNAKQFELYDETFRPLVDSVLQGFNGTIFAYGQTGTGKTYTMEGIRGDPEKRGVIPNSFDHIFTHISRSQNQQYLVRASYLEIYQEEIRDLLSKDQTKRLELKERPDTGVYVKDLSSFVTKSVKEIEHVMNVGNQNRSVGATNMNEHSSRSHAIFVITIECSEVGLDGENHIRVGKLNLVDLAGSERQAKTGAQGERLKEATKINLSLSALGNVISALVDGKSTHIPYRDSKLTRLLQDSLGGNAKTVMVANVGPASYNVEETLTTLRYANRAKNIKNKPRVNEDPKDALLREFQEEIARLKAQL 369          
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Match: sp|P46871|KRP95_STRPU (Kinesin-II 95 kDa subunit OS=Strongylocentrotus purpuratus OX=7668 GN=KRP95 PE=1 SV=1)

HSP 1 Score: 434.876 bits (1117), Expect = 1.476e-139
Identity = 229/369 (62.06%), Postives = 277/369 (75.07%), Query Frame = 3
Query:   27 SGEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDN-KTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQMLAGQIP 1130
            S E VKV+VR RP+N +EI+   K I+++D  RG   + NP      P K F FD  Y+ +S    LY +    LVE+V +G+NGTIFAYGQTG GK+FTM+G+ +    RGVIP +F+H+F  I+  +N ++LV ASYLEIY EEIRDLLAKD K +LDLKE P+ GVYV  LS     +V++ + VM  G  NR+ GST MN  SSRSH+IF I +E      + ENHI+ GKLNLVDLAGSERQ+KTGATGDRLKEATKINLSLSALGNVISALVDGKS HIPYRDSKLTR+LQDSLGGN KT+M+A + PA  N++ET++TLRYANRAKNI+NKPKINEDPKDALLREFQ EI+RLKQ L  + P
Sbjct:    5 SAETVKVVVRCRPMNSKEISQGHKRIVEMDNKRGLVEVTNPKGPPGEPNKSFTFDTVYDWNSKQIDLYDETFRSLVESVLQGFNGTIFAYGQTGTGKTFTMEGVRSNPELRGVIPNSFEHIFTHIARTQNQQFLVRASYLEIYQEEIRDLLAKDQKKRLDLKERPDTGVYVKDLSSFVTKSVKEIEHVMTVGNNNRSVGSTNMNEHSSRSHAIFIITIECSELGVDGENHIRVGKLNLVDLAGSERQAKTGATGDRLKEATKINLSLSALGNVISALVDGKSSHIPYRDSKLTRLLQDSLGGNAKTVMVANMGPASYNFDETITTLRYANRAKNIKNKPKINEDPKDALLREFQEEISRLKQALDKKGP 373          
BLAST of Kinesin-like protein vs. TrEMBL
Match: A0A4E0RKY2 (Kinesin-like protein OS=Fasciola hepatica OX=6192 GN=D915_000657 PE=3 SV=1)

HSP 1 Score: 769.615 bits (1986), Expect = 0.000e+0
Identity = 437/805 (54.29%), Postives = 567/805 (70.43%), Query Frame = 3
Query:   21 LMSGEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDEN-EENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQMLAGQIPINMDAVSTAKPTDSSEKHRLTEIERXXXXXXXXXXXXXXXXQYSAEAADKAKLKSDMEKLKQYYDEKLMQLD--IRDIPNSDEVLRLFEPKIFTSSSNSG----PQPIGQFEKDLGNPNLYDLNLADTSVVIVNPEGNY----------APDIEPQRAVHVR----------TVPKQEVL-------IHDKNELLSKLQYLQSTMVGGEQINNEVAKDXXXXXXXXXXXXXXXLMDSNERMEDDGIMLGVFEDIQDELRVKSKLLQKEKNKNLSLIQEMSDINEEFHKERCDYLESIRKLDRENKLLQMMMEKIQPCIKKSCNYSNFDKIKSQAKFDEESGKWILPQLKLEDTQLP----------------------------------------NADEKIRDNVDENYYRKLARKPDPSQEYFQNRKSGQLL 2213
            +M+ EAVKVIVR RPLNEREINL+CKN+I+I    GQCSI +PN  K P K FFFDG+Y++DS+TEQ+Y+DI YPLVE VTEGYNGTIFAYGQTGCGKSFTMQG+ +  +QRG+IPRAFDH+FETIS+++N+++LVHASYLEIYNEEIRDLLA++ K KL+LKEHPE+GVYVSGLSMHKV+ V +C V+M  GWKNR+TG+TLMN DSSRSHSIFTIYLEM + D   E   IKAGKLNLVDLAGSERQ+KTGA+GDR KEATKINLSLSALGNVISALVD +SKHIPYRDSKLTR+LQDSLGGNTKTLMIACLSPADNNY+ETLSTLRYANRAKNIQNKPKINEDPKDALLR++Q+EI+RL+Q+L     ++   +ST   +D  +  ++ E E+E +K EYE+KL  KEAQY+AEAADK KL ++++ L+ +Y+ ++ +L+   +  P   +     EP+ F  + +      P  + Q  K    P++ +  L+ +SV+IV+ EGN           A   E  R   ++          +    E+L          + ELL +L+ L+S +VGGE   N  A+ R S+++R+AEE+KRRL  +N  +ED+GIM+G++E+IQDEL +K+KLLQ+EK KNL++  E+SDI  EF ++R DYL++IR+  R+  LLQ ++++IQPCI++  NY N DKIK  AK+DEE G+W+LPQ+ +E TQLP                                        N D +     +  +Y KLA +      YF NR++ QLL
Sbjct:    1 MMASEAVKVIVRCRPLNEREINLDCKNVIEIISDTGQCSITHPNGKKNPPKNFFFDGAYDLDSSTEQIYNDIAYPLVEGVTEGYNGTIFAYGQTGCGKSFTMQGLADVESQRGIIPRAFDHIFETISVSQNTRFLVHASYLEIYNEEIRDLLAREAKTKLELKEHPERGVYVSGLSMHKVTRVEECNVIMGIGWKNRSTGATLMNADSSRSHSIFTIYLEMVDRDPQLEGEKIKAGKLNLVDLAGSERQAKTGASGDRFKEATKINLSLSALGNVISALVDSRSKHIPYRDSKLTRLLQDSLGGNTKTLMIACLSPADNNYDETLSTLRYANRAKNIQNKPKINEDPKDALLRQYQDEIDRLRQLLEQSQGVSR-TMSTNLNSDQKD-WQIIEREKEALKQEYESKLRAKEAQYNAEAADKVKLMNEIQALRSFYETRMQKLNDYTQKEPAKSDAHTSIEPEQFPHNDDLSVVHEPHTVYQ-PKPSKTPSVKESVLS-SSVMIVDAEGNVLNSEGQNKIPAVQSEGTRVGAIKQNARGLESKQSASGSEILNGGSILEALSREELLKRLKSLESGIVGGELAWNAEARARRSRKQRYAEERKRRLEQANAALEDEGIMVGIYENIQDELHMKNKLLQREKQKNLAMKSELSDIQSEFEQDRSDYLDTIRRQQRQVDLLQAIIDRIQPCIRRDSNYHNVDKIKKLAKYDEERGEWVLPQMTVERTQLPAAPLDPAHGAHRIAQGLGDQSDSFGSPGSSNTRLSAATLLNRDVERESEEEARFYAKLASRTQSQPNYFANRRASQLL 801          
BLAST of Kinesin-like protein vs. TrEMBL
Match: A0A183AA13 (Kinesin-like protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS3798 PE=3 SV=1)

HSP 1 Score: 768.459 bits (1983), Expect = 0.000e+0
Identity = 444/807 (55.02%), Postives = 553/807 (68.53%), Query Frame = 3
Query:   24 MSGEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTD-ENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQMLAGQIPINMDAVSTAKPTDSSEKHRLTEIERXXXXXXXXXXXXXXXXQYSAEAADKAKLKSDMEKLKQYYDEKLMQLDIRDIPNSDEVLRLFEPKIFTSSSNSGPQPIGQFEKDLGNPNLYDLNLADTSVVIVNPEGNYA-PDIEPQRAVHVRTVPKQEVLIHDKNELLSK---------------LQYLQSTMVGGEQINNEVAKDXXXXXXXXXXXXXXXLMDSNERMEDDGIMLGVFEDIQDELRVKSKLLQKEKNKNLSLIQEMSDINEEFHKERCDYLESIRKLDRENKLLQMMMEKIQPCIKKSCNYSNFDKIKSQAKFDEESGKWILPQLKLEDTQLPNA---------------------------------------DEKIRDNVDENYYRKLARKPDPSQEYFQNRKSGQLL---------NQRNSPN-NISN 2246
            M+ EAVKVIVR RPLNERE +L+CKN+I+I    GQCSI +PN  K P K FFFDG+Y+I STTEQ+Y+DI YPLVE VTEGYNGTIFAYGQTGCGKSFTMQG+ +  TQRG+IPRAFDHVFETIS+++N+++LVHASYLEIYNEEIRDLLA++ K KL+LKEHPEKGVYVSGLSMHKV+ V +C V+M  GWKNR+TG+TLMN DSSRSHSIFTIYLEM + D + + + IKAGKLNLVDLAGSERQ+KTGA+GDR KEATKINLSLSALGNVISALVD KSKHIPYRDSKLTR+LQDSLGGNTKTLMIACLSPADNNY+ETLSTLRYANRAKNIQNKPKINEDPKDALLR++Q+EI+RL+Q+L     I      T  P    +  +  E E+E +K EYE KL  KEAQY AEAADKAKL S+M+ L+ YY+ ++ +LD  D  + +E LR  E  +                                +V+IV+ +GN    D + Q +       +  +L      + SK               L+ L+S +VGGE   N  A+ R S+++R+AEE+KR+L  +N  +ED+GIM+G++E+IQDELR+K+KLLQ+EK KNL++  E+SDI  EF ++R DYL++IR+L R+  LLQ ++++IQPCI++  NY N DKIK  AK+DEE  +WILPQ+ +E TQLP A                                       D +     +  YY KLA +      YF NR++ QLL         + R S N NISN
Sbjct:    1 MASEAVKVIVRCRPLNEREKSLDCKNVIEIISETGQCSINHPNGKKVPPKIFFFDGAYDISSTTEQIYNDIAYPLVEGVTEGYNGTIFAYGQTGCGKSFTMQGMADVDTQRGIIPRAFDHVFETISVSQNTRFLVHASYLEIYNEEIRDLLAREGKTKLELKEHPEKGVYVSGLSMHKVTCVDECNVIMSIGWKNRSTGATLMNADSSRSHSIFTIYLEMVDHDPQTDSDKIKAGKLNLVDLAGSERQAKTGASGDRFKEATKINLSLSALGNVISALVDSKSKHIPYRDSKLTRLLQDSLGGNTKTLMIACLSPADNNYDETLSTLRYANRAKNIQNKPKINEDPKDALLRQYQDEIDRLRQLLEQSQGIG--KCPTVDPVVECKDWQTIEREKEALKQEYETKLRVKEAQYHAEAADKAKLMSEMQALRDYYEFRMQKLD--DCAHREEPLRADESGL------------------------------SNNVMIVDADGNILNSDEQNQLSTAQSESDRTRLLKSSTRSIESKQIGSGSETRNGTGVVLRSLESGIVGGELAWNAEARARRSRKQRYAEERKRQLELANAALEDEGIMVGIYENIQDELRIKNKLLQREKQKNLAMKSELSDIQSEFEQDRSDYLDTIRRLQRQMDLLQAIIDRIQPCIRRDSNYHNVDKIKKLAKYDEERNEWILPQMTIERTQLPVAPLDSGQGPHRFTQGLGDQSDTPGTGGLSARAGASTLLSRDTERESEEEARYYAKLASRTQSQPNYFANRRASQLLIDAAALGAGSHRGSLNTNISN 773          
BLAST of Kinesin-like protein vs. TrEMBL
Match: A0A267GIS3 (Kinesin-like protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016377g1 PE=3 SV=1)

HSP 1 Score: 767.303 bits (1980), Expect = 0.000e+0
Identity = 452/848 (53.30%), Postives = 580/848 (68.40%), Query Frame = 3
Query:   24 MSGEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQMLAGQI----------------------PINM---DAVSTAKPTDSSEKHR-LTEIERXXXXXXXXXXXXXXXXQYSAEAADKAKLKSDMEKLKQYYDEKLMQLDIRDIPNSDEVLRLFEPKIFTSSSNSGPQPIGQFEKDLGNPNLYDLNLAD---TSVVIVNPEGN---YAPDIEPQRAVHVRTVPKQEVLIHDKNELLSKLQYLQSTMVGGEQINNEVAKDXXXXXXXXXXXXXXXLMDSNERMEDDGIMLGVFEDIQDELRVKSKLLQKEKNKNLSLIQEMSDINEEFHKERCDYLESIRKLDRENKLLQMMMEKIQPCIKKSCNYSNFDKIKSQAKFDEESGKWILPQLKLEDTQLPNA--------------------------DEKIRDNVDENYYRKLARKPDPSQEYFQNRKSGQLLNQRNSPNN----ISNSQYNSQLGYVSV----NNSNLQKLSDHQYEANSYSNDFRAAEVHG 2369
            M+ EAVKVIVR RPLN+RE +L C+ ++ ++ SRGQCSI NP+D+K P K FFFDG+Y  DSTT+ +Y+DI YPLVE VTEGYNGTIFAYGQTGCGKSF+MQGI +P +QRG+IPRAFDH+FETIS+A++SK+LVHASYLEIYNEEIRDLL KDVKA+LDLKEHPEKGVYVSGLSMHKV+NV +CQVVMERGWKNRATG+TLMN DSSRSHSIFTIYLE    D+  E HI+AGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTR+LQDSLGGNTKTLM+ACLSPADNNY+ETLSTLRYANRAKNIQNKPKINEDPKDALLR++Q EI +LK +LAG +                      P+     +AV      D   KHR + E EREK++ EYE KL  KEA Y+ EAAD+ KL+ D+ KLK YYD KL QL+   + + DE +  F         N G      +  D G P    ++L     TS V      N     P+++   AV              + E+L +LQ L+S MVGGE  N++  ++RH K+KRHAEE+KR+L+ +N +MED G+M+G++E +Q +L+ K K L +++ +  +L +E+ D+  EF  +R DYL++IRK +R+  L Q ++++IQPCI++  NY   D+I+  A++D+E G W+LP L++E T LP+A                          DE+     D  Y +  AR+ +   +YFQ+ ++ +++ +  +       +S  + NS  GY S+    ++S++  L   Q + +  S + RAA VHG
Sbjct:    1 MTSEAVKVIVRCRPLNQREKDLKCETVVSMESSRGQCSIVNPSDSKAPPKSFFFDGAYFTDSTTDNIYADIAYPLVEGVTEGYNGTIFAYGQTGCGKSFSMQGITDPPSQRGIIPRAFDHIFETISVAQSSKFLVHASYLEIYNEEIRDLLGKDVKARLDLKEHPEKGVYVSGLSMHKVTNVSECQVVMERGWKNRATGATLMNADSSRSHSIFTIYLECAEWDDQGEEHIRAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRLLQDSLGGNTKTLMVACLSPADNNYDETLSTLRYANRAKNIQNKPKINEDPKDALLRQYQEEIEKLKAILAGHLGDPSQLAALLGGAAAAGQQQKSPVRQRRGEAVD-----DDDAKHREVLEAEREKLRLEYEEKLKAKEAAYAVEAADRVKLQEDINKLKSYYDSKLAQLE-DSVASPDEAVSDF---------NRGNSADEMYIGDNGAPVQQAVHLKSRPTTSAVAKQQTTNSPQQGPELQDDGAV--------------QEEVLKRLQALESGMVGGELKNDDEVRERHKKKKRHAEERKRKLLAANSQMEDGGLMVGIYESMQGDLKSKEKQLSRQQQRTEALEREILDLQSEFESDRMDYLDTIRKQERQLLLYQTILDRIQPCIRRDSNYYYLDRIRRDARWDDEKGMWLLPPLQIEKTSLPSAVGNGGPVGGGSGSAHSNANGQRGGYQDEEDYFEDDRLYQKMHARQGEA--KYFQSGRADRIIAETRAAEASTKLLSRRERNSFSGYTSLPMTFSDSSVVSLPGQQQQMS--SPEARAAFVHG 815          
BLAST of Kinesin-like protein vs. TrEMBL
Match: A0A075ABQ9 (Kinesin-like protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=T265_12632 PE=3 SV=1)

HSP 1 Score: 747.273 bits (1928), Expect = 0.000e+0
Identity = 438/801 (54.68%), Postives = 551/801 (68.79%), Query Frame = 3
Query:   24 MSGEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDEN-EENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQMLAGQIPINMDAVSTAKPTDSSEKHRLTEIERXXXXXXXXXXXXXXXXQYSAEAADKAKLKSDMEKLKQYYDEKLMQLDIRDIPNSDEVLRLFEPKIFTSSSNSGPQPIGQFEKDLGNP---NLYDL-----NLADTSVVIVNPEGNY-------------------APDIEPQRAVHVRTVPKQ---------------EVLIHDKNELLSKLQYLQSTMVGGEQINNEVAKDXXXXXXXXXXXXXXXLMDSNERMEDDGIMLGVFEDIQDELRVKSKLLQKEKNKNLSLIQEMSDINEEFHKERCDYLESIRKLDRENKLLQMMMEKIQPCIKKSCNYSNFDKIKSQAKFDEESGKWILPQLKLEDTQLPNADEK-----------------------IRDNVDEN-----YYRKLARKPDPSQEYFQNRKSGQLL 2213
            M+ E+V+VIVR RPLN RE+ L CKNIIDI    GQCSI++P+D K P K FFFDG+++I STTEQ+YSDI YPLVE VTEGYNGTIFAYGQTGCGKSFTMQGI   ++QRG+IPRAFDHVFETIS+++N+K+LV+AS+LEIYNEEIRDLLA+DVK KLDLKEHPEKGVYV+GLS+HKVS+V +CQV+M  GWKNR+TG+TLMN +SSRSHSIFTI+LEM + D       IKAGKLNLVDLAGSERQ+KTGA GDRL+EATKINLSLSALGNVISALVD K KHIPYRDSKLTR+LQDSLGGNTKTLMIACLSPADNNY+ETLSTLRYANRAKNIQNKPKINEDPKDALLR++Q+EI RL+Q+L  + P  +         +SS+     E ERE+++ EYEAKL EKEAQ++AEAADKAKL  ++++L+ ++D K         P   E   L E            + +G       +      Y       +LA +SV++++ EG                     AP     R   +R++  +               E L  D  ELL +L  L++ MVGGE+ +N   + RHS+R+++AEE++RRL  +N  +ED+GIM+G++E IQ+EL  K+KLLQ+EK KN+SL  E+SDI  EF ++R DYL++IR+  R+  LLQ ++++IQPCI++  NY N DKIK  AKFDEE  +W+LPQ+ +E T  P A                          +RD   EN     YY KLA +      YF NR++ QLL
Sbjct:   40 MAAESVRVIVRCRPLNTRELELECKNIIDIVAETGQCSIKHPSDKKFPPKNFFFDGAFDISSTTEQIYSDICYPLVEGVTEGYNGTIFAYGQTGCGKSFTMQGISEDASQRGIIPRAFDHVFETISVSQNTKFLVYASFLEIYNEEIRDLLARDVKTKLDLKEHPEKGVYVAGLSVHKVSSVDECQVIMGTGWKNRSTGATLMNAESSRSHSIFTIHLEMIDRDPQLTSEKIKAGKLNLVDLAGSERQAKTGAAGDRLREATKINLSLSALGNVISALVDAKVKHIPYRDSKLTRLLQDSLGGNTKTLMIACLSPADNNYDETLSTLRYANRAKNIQNKPKINEDPKDALLRQYQDEIARLRQLLE-ERPSTVQTSDLISSDNSSDIFANAE-ERERLRQEYEAKLREKEAQFNAEAADKAKLLEEIQRLRAFHDSKFGH------PGEHENDLLLEESRILRHHTRKTESVGVSTTGTASAVANEQYAFVSTSDSLACSSVLVIDQEGTLQSQDVDDKFTTKHKGLLISAPKSTTSRNAVIRSMDGKLTNRTLTQSTTKLALESLTRD--ELLERLSILEAGMVGGEEASNPEIRARHSRRQKYAEERRRRLEQANAALEDEGIMVGIYETIQEELCHKNKLLQREKQKNMSLRMELSDIQSEFEQDRSDYLDTIRRQQRQMDLLQAIIDRIQPCIRRDSNYYNVDKIKRIAKFDEEKNEWVLPQMTVERTHFPLAVTDPIRATTDLPEGLGPLNSLRVAGVVRDMEKENEEEARYYAKLASRTQSQPNYFANRRANQLL 830          
BLAST of Kinesin-like protein vs. TrEMBL
Match: A0A3R7CS94 (Kinesin-like protein OS=Clonorchis sinensis OX=79923 GN=KIF17 PE=3 SV=1)

HSP 1 Score: 744.577 bits (1921), Expect = 0.000e+0
Identity = 434/803 (54.05%), Postives = 555/803 (69.12%), Query Frame = 3
Query:   24 MSGEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDEN-EENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQMLAGQIPINMDAVSTAKPTDSSEKHRLTEIERXXXXXXXXXXXXXXXXQYSAEAADKAKLKSDMEKLKQYYDEKLMQLDIRDIPNSDE---------VLRLFEPK---IFTSSSNSGPQPIGQFEKDLGNPNLYDLNLADTSVVIVNPEGNY-------------------APDIEPQRAVHVRTV-------------PKQEVLIHDKNELLSKLQYLQSTMVGGEQINNEVAKDXXXXXXXXXXXXXXXLMDSNERMEDDGIMLGVFEDIQDELRVKSKLLQKEKNKNLSLIQEMSDINEEFHKERCDYLESIRKLDRENKLLQMMMEKIQPCIKKSCNYSNFDKIKSQAKFDEESGKWILPQLKLEDTQLPNADEK-----------------------IRDNVDEN-----YYRKLARKPDPSQEYFQNRKSGQLL 2213
            M+ E+V+VIVR RPLN RE+ L CK II+I    GQCSI++P+D K P K FFFDG++++ STTEQ+YSDI YPLVE VTEGYNGTIFAYGQTGCGKSFTMQG+   ++QRG+IPRAFDHVFETIS+++N+K+LV+AS+LEIYNEEIRDLLA+DVK KLDLKEHPEKGVYV+GLS+HKVS+V +CQV+M  GWKNR+TG+TLMN +SSRSHSIFTI+LEM + D       IKAGKLNLVDLAGSERQ+KTGA GDRL+EATKINLSLSALGNVISALVD K KHIPYRDSKLTR+LQDSLGGNTKTLMIACLSPADNNY+ETLSTLRYANRAKNIQNKPKINEDPKDALLR++Q+EI RL+Q+L  + P  +         +SS+     E ERE+++ EYE KL EKEAQY+AEAADKAKL  ++++L+  +D K +      +P   E         +LR    K   +  S++ +      +    +G  +    +LA +SV++++ EG                     AP     R   +R+V              K  +    ++ELL +L  L++ MVGGE+ +N   + RHS+R+++AEE++RRL  +N  +ED+GIM+G++E IQ+EL  K+KLLQ+EK KN+SL  E+SDI  EF ++R DYL++IR+  R+  LLQ ++++IQPCI++  NY N DKIK  AKFDEE  +W+LPQ+ +E T  P A                           RD   EN     YY KLA +      YF NR++ QLL
Sbjct:    1 MAAESVRVIVRCRPLNTRELELECKKIIEIVGETGQCSIKHPSDKKCPPKNFFFDGAFDMSSTTEQIYSDICYPLVEGVTEGYNGTIFAYGQTGCGKSFTMQGLPEDASQRGIIPRAFDHVFETISVSQNTKFLVYASFLEIYNEEIRDLLARDVKTKLDLKEHPEKGVYVAGLSVHKVSSVDECQVIMGTGWKNRSTGATLMNAESSRSHSIFTIHLEMIDRDPQLATEKIKAGKLNLVDLAGSERQAKTGAAGDRLREATKINLSLSALGNVISALVDAKVKHIPYRDSKLTRLLQDSLGGNTKTLMIACLSPADNNYDETLSTLRYANRAKNIQNKPKINEDPKDALLRQYQDEIARLRQLLE-ERPSTVQTSDLISSGNSSDIFANAE-ERERLRQEYETKLREKEAQYNAEAADKAKLLEEIQRLRSVHDSKFV------LPGEHENDLLLEESRILRHHTRKTESVGVSTTGTASAVANEQYAFVGTSD----SLACSSVLVIDQEGTLQSQDVDDKFTMKHKGLLITAPKSTASRNAIIRSVDGKLTNRTLAQSTAKLALESLTRDELLERLSMLEAGMVGGEEASNPEIRARHSRRQKYAEERRRRLEQANAALEDEGIMVGIYETIQEELCHKNKLLQREKQKNMSLRMELSDIQSEFEQDRSDYLDTIRRQQRQMDLLQAIIDRIQPCIRRDSNYYNVDKIKRIAKFDEEKNEWVLPQMTVERTHFPLAVTDSPRATADLPEGLGPLNSLRVAGVARDMEKENEEEARYYAKLASRTQSQPNYFANRRANQLL 791          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: kif17 (kinesin family member 17 [Source:NCBI gene;Acc:103022265])

HSP 1 Score: 667.922 bits (1722), Expect = 0.000e+0
Identity = 375/716 (52.37%), Postives = 496/716 (69.27%), Query Frame = 3
Query:   24 MSGEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQMLAGQIPINMDAVSTAKPTDSSEKHRL-----------TEIERXXXXXXXXXXXXXXXXQYSAEAADKAKLKSDMEKLKQYYDEKLMQLD---------IRDIPNSDEVLRLFEPKIFTSSSNSGPQPIGQFEKDLGNPNLYDLNLADTSVVIVNPEGNYAPDIEPQRAVHVRTVPKQEVLIHDKNELLSKLQYLQSTMVGGEQINNEVAKDXXXXXXXXXXXXXXXLMDSNERMEDDG--IMLGVFEDIQDELRVKSKLLQKEKNKNLSLIQEMSDINEEFHKERCDYLESIRKLDRENKLLQMMMEKIQPCIKKSCNYSNFDKIKSQAKFDEESGKWILPQLKLEDTQLPNA 2105
            M+ E+VKV++R RPLN+RE  LNCK ++ +D    QC I  P  ++ P K F FDG+Y I+ TTEQ+Y++I YPLVE VTEGYNGTIFAYGQTG GKSFTMQG+ +P+ QRGVIPRAF+H+FETI  AEN+K+LV ASYLEIY EEIRDLL KD K KL+LKEHPE+GVYV  LSMH V +V +C+ +ME+GWKNR+ G TLMN DSSRSHSIFTI+LE+  TD   E+H++AGKLNLVDLAGSERQSKTGATGDRL+EATKINLSLSALGNVISALVDG+SKHIPYRDSKLTR+LQDSLGGNT+TLM+ACLSPADNNYEE+LSTLRYANRAK+IQN+P+INEDPKDALLRE+Q EI +L+ +++GQ+    D +S+   + +SE               +E E+EKIK EYE K+   +A Y+AE   KAKL+ D+  L++ Y+ KL  L+           D  N +E + + E    ++   S P   G  E +             +  +   PEG       P                 D+  +L +LQ L+   VGGEQ  NE  + R  +RK  A ++K++L+D+ ++  +DG  ++L V++ IQ+E+  K+KLL+  +NK  +   E+ D+  EF  ER DYL SIR+L+RE +L Q ++E++   +++ CNYSN D+++ +A +DEESG W +P++ ++ T LP A
Sbjct:    1 MASESVKVVIRCRPLNDREKALNCKMVVSVDTGCCQCFIEKPEASEEPPKQFTFDGTYFINQTTEQMYNEIAYPLVEGVTEGYNGTIFAYGQTGSGKSFTMQGVADPAAQRGVIPRAFEHIFETIQCAENTKFLVRASYLEIYKEEIRDLLGKDSKLKLELKEHPERGVYVRDLSMHTVHSVGECERIMEQGWKNRSVGYTLMNKDSSRSHSIFTIHLEICKTDAAGEDHLRAGKLNLVDLAGSERQSKTGATGDRLQEATKINLSLSALGNVISALVDGRSKHIPYRDSKLTRLLQDSLGGNTRTLMVACLSPADNNYEESLSTLRYANRAKSIQNRPRINEDPKDALLREYQEEIKQLRALISGQL--GTDNLSSFLASQTSEGTLAVQSRPQSSTVESEAEKEKIKQEYEGKIARLQADYNAEQESKAKLQEDITFLRESYEFKLSSLERFRSDRPHKTGDTSNKEEAISVNE----STPKASDPIQDGLKEDE------------HSGGIRGGPEGKLVLVATPSPL--------------DQQHVLERLQQLEQEFVGGEQSRNEELRQRRRQRKSLANQRKKQLIDALKQGSEDGDSVLLNVYDSIQEEVHAKNKLLEGTQNKLKAAKLEIRDLQAEFETERDDYLASIRRLERETQLQQAILERMVGLVRRDCNYSNLDRLRKEAVWDEESGVWRVPEVLVQKTALPAA 684          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: kif3b (kinesin family member 3B [Source:NCBI gene;Acc:103035116])

HSP 1 Score: 436.802 bits (1122), Expect = 7.434e-141
Identity = 223/365 (61.10%), Postives = 278/365 (76.16%), Query Frame = 3
Query:   27 SGEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQKP--FFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQML 1115
            S EAVKV+VR RP+NE+E   N + ++ +DV  GQ ++RNP    + + P  F FD  Y+ +S    LY +   PLV++V  G+NGTIFAYGQTG GK++TM+G+ N   +RGVIP +F+H+F  IS ++N +YLV ASYLEIY EEIRDLL+KD   +L+LKE P+ GVYV  LS     +VR+ + VM  G +NR+ G+T MN  SSRSH+IF I +E      + ENHI+ GKLNLVDLAGSERQ+KTGA G+RLKEATKINLSLSALGNVISALVDG+S HIPYRDSKLTR+LQDSLGGN +T+M+A + PA  N EETL+TLRY+NRAKNI+NKP+INEDPKDALLREFQ EI RLK+ L
Sbjct:    6 SSEAVKVVVRCRPMNEKERAANFERVVSVDVKLGQVAVRNPKGASSHEHPKVFTFDSVYDWNSKQIDLYDETFRPLVDSVLLGFNGTIFAYGQTGTGKTYTMEGVRNDPERRGVIPNSFEHIFTHISRSQNQQYLVRASYLEIYQEEIRDLLSKDQSRRLELKERPDTGVYVKDLSSFVTKSVREIEHVMNVGNQNRSVGATNMNEHSSRSHAIFVITIECSELGPDGENHIRVGKLNLVDLAGSERQTKTGAQGERLKEATKINLSLSALGNVISALVDGRSTHIPYRDSKLTRLLQDSLGGNARTVMVANIGPASYNVEETLTTLRYSNRAKNIKNKPRINEDPKDALLREFQEEIARLKEQL 370          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: kif3ca (kinesin family member 3C [Source:NCBI gene;Acc:103045204])

HSP 1 Score: 417.157 bits (1071), Expect = 1.129e-133
Identity = 216/366 (59.02%), Postives = 265/366 (72.40%), Query Frame = 3
Query:   30 GEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDN--KTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIR--XXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQML 1115
            GEAVKV+VR RPLN RE      +I+ +DV  GQ ++RNP       P K F FD +Y+  S    LY + V PL+++V +G+NGT+FAYGQTG GK++TMQG      +RG+IP +F+H+F  IS + N +YLV ASYLEIY EEIR     +KD   KL+LKE PE GVYV  LS     NV++ + VM  G + R+ G T MN  SSRSH+IFTI +E      +  +HI+ GKLNLVDLAGSERQ+KTG  G+RLKEA KINLSLSALGNVISALVDG+S H+PYRDSKLTR+L+DSLGGN KT+M+A L PA   YEETL+TLRYA+RAKNI+N P++NEDPKDALLREFQ EI RLK  L
Sbjct:    8 GEAVKVVVRCRPLNRREETGGHDSIVSVDVKLGQVALRNPGRALPDEPLKTFTFDAAYDGSSRQNDLYDETVRPLIDSVLQGFNGTVFAYGQTGTGKTYTMQGQWMDPERRGIIPNSFEHIFTHISRSHNQQYLVRASYLEIYQEEIRDLLTESKDQGRKLELKESPESGVYVRDLSTFVTKNVKEIEHVMNAGNRARSVGFTNMNEHSSRSHAIFTITVECGQPGPDGRSHIRVGKLNLVDLAGSERQAKTGVKGERLKEAAKINLSLSALGNVISALVDGRSSHVPYRDSKLTRLLRDSLGGNAKTIMVATLGPASCCYEETLTTLRYASRAKNIKNVPRVNEDPKDALLREFQQEIARLKAQL 373          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: kif3cb (kinesin-like protein KIF3B [Source:NCBI gene;Acc:103037192])

HSP 1 Score: 410.994 bits (1055), Expect = 3.717e-131
Identity = 209/361 (57.89%), Postives = 266/361 (73.68%), Query Frame = 3
Query:   33 EAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQML 1115
            E +KV+VR RP+N++E  ++ + I+++D+  GQ  + NP    T  K F FD  Y++ S    LY     PL+++V +G+NGT+FAYGQTG GK++TMQG+     +RGVIP +F H+F  IS ++N +YLV  SYLEIY +EIRDL+ KD   KL+LKE+PE GVYV GLS     N+++ + VM  G ++R+ G T MN  SSRSH+IF + +E      + E HI+ GKLN+VDLAGSERQSKTG  G R KEA KINLSL ALGNVISALVDGKS HIPYRDSKLTR+LQDSLGGN+KT+M+A + P   +YEETL+TLR+ANRAKNI+N+PKINEDPKDALLREFQ EI RLK  L
Sbjct:   22 ETIKVVVRCRPVNKKEEAMSHEKIVEVDIKLGQVRVHNPKGPGTLVKAFTFDAVYDMASKQTDLYDYSCKPLIDSVLQGFNGTVFAYGQTGTGKTYTMQGLPMDPERRGVIPNSFQHIFTHISRSQNQQYLVRVSYLEIYQDEIRDLVCKDNNKKLELKENPELGVYVKGLSSVVTKNIKEIEHVMNLGNQSRSVGFTKMNERSSRSHAIFVVTIECSEMGIDGEEHIRVGKLNMVDLAGSERQSKTGVQGMRFKEAAKINLSLCALGNVISALVDGKSSHIPYRDSKLTRLLQDSLGGNSKTVMVATIGPTSCHYEETLTTLRFANRAKNIKNRPKINEDPKDALLREFQEEIARLKAQL 382          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: kif3cb (kinesin-like protein KIF3B [Source:NCBI gene;Acc:103037192])

HSP 1 Score: 406.757 bits (1044), Expect = 4.396e-131
Identity = 207/358 (57.82%), Postives = 264/358 (73.74%), Query Frame = 3
Query:   42 KVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQML 1115
            +V+VR RP+N++E  ++ + I+++D+  GQ  + NP    T  K F FD  Y++ S    LY     PL+++V +G+NGT+FAYGQTG GK++TMQG+     +RGVIP +F H+F  IS ++N +YLV  SYLEIY +EIRDL+ KD   KL+LKE+PE GVYV GLS     N+++ + VM  G ++R+ G T MN  SSRSH+IF + +E      + E HI+ GKLN+VDLAGSERQSKTG  G R KEA KINLSL ALGNVISALVDGKS HIPYRDSKLTR+LQDSLGGN+KT+M+A + P   +YEETL+TLR+ANRAKNI+N+PKINEDPKDALLREFQ EI RLK  L
Sbjct:   14 QVVVRCRPVNKKEEAMSHEKIVEVDIKLGQVRVHNPKGPGTLVKAFTFDAVYDMASKQTDLYDYSCKPLIDSVLQGFNGTVFAYGQTGTGKTYTMQGLPMDPERRGVIPNSFQHIFTHISRSQNQQYLVRVSYLEIYQDEIRDLVCKDNNKKLELKENPELGVYVKGLSSVVTKNIKEIEHVMNLGNQSRSVGFTKMNERSSRSHAIFVVTIECSEMGIDGEEHIRVGKLNMVDLAGSERQSKTGVQGMRFKEAAKINLSLCALGNVISALVDGKSSHIPYRDSKLTRLLQDSLGGNSKTVMVATIGPTSCHYEETLTTLRFANRAKNIKNRPKINEDPKDALLREFQEEIARLKAQL 371          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010617.1 (pep scaffold:Pmarinus_7.0:GL476849:1993:16233:1 gene:ENSPMAG00000009612.1 transcript:ENSPMAT00000010617.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 476.478 bits (1225), Expect = 1.021e-154
Identity = 248/379 (65.44%), Postives = 300/379 (79.16%), Query Frame = 3
Query:  252 ENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQMLAGQIP------INMDAVSTAKPTDSSE-----KHRL-TEIERXXXXXXXXXXXXXXXXQYSAEAADKAKLKSDMEKLKQYYDEKLMQLDIR 1352
            + V EGYNGT+FAYGQTGCGKSFTMQG+  PS QRGVIPRAF+H+FE+I  AEN+K+L  ASYLEIYNEEIRDLL KD K +L+LKEHPE+GVYV  LSMH V +V +C+ +M+ GW NRATG+TLMN DSSRSHSIF+I+LEM  TD+  E+HI+AGKLNLVDLAGSERQSKTGA GDRLKEATKINLSLSALGNVISALVDG+SKH+PYRDSKLTR+LQDSLGGNTKTLM+AC+SPADNNYEE+LSTLRYANRAK+I+N+P++NEDPKDA+LRE++ EI RLK +L GQI           AV    P    E      H+   E ER+KI+ EYE +L      + A+   KA+L+  ++ L+  Y++KL  ++ R
Sbjct:    1 QGVVEGYNGTVFAYGQTGCGKSFTMQGVSEPSAQRGVIPRAFEHIFESIQCAENTKFLFRASYLEIYNEEIRDLLGKDTKQRLELKEHPERGVYVRDLSMHTVHSVAECERIMQAGWSNRATGATLMNKDSSRSHSIFSIHLEMCTTDDQGEDHIRAGKLNLVDLAGSERQSKTGAQGDRLKEATKINLSLSALGNVISALVDGRSKHVPYRDSKLTRLLQDSLGGNTKTLMVACISPADNNYEESLSTLRYANRAKSIRNRPRVNEDPKDAMLREYREEITRLKALLQGQIAAPGRPXFTRKAVPAEVPRAKEEVIAAVDHQAEIEKERQKIRQEYEERLSRVRGDFEAQQRSKARLEEALDTLRVSYEKKLTAVEER 379          

HSP 2 Score: 95.1301 bits (235), Expect = 3.140e-20
Identity = 78/232 (33.62%), Postives = 129/232 (55.60%), Query Frame = 3
Query: 1611 LLSKLQYLQSTMVGGEQINNEVAKDXXXXXXXXXXXXXXXLMDS--------NERMED-DGIMLGVFEDIQDELRVKSKLLQKEKNKNLSLIQEMSDINEEFHKERCDYLESIRKLDRENKLLQMMMEKIQPCIKKSCNYSNFDKIKSQAKFDEESGKWILPQLKLEDTQLP-------NADEKIRDNVDEN--------YYRKLAR--KPDPSQEYFQNRKSGQLLNQRNS 2228
            L + L  LQ  +VGGEQ NN    +R  +R+R A+E+ RRLM+S         E   D D +++ VF+ ++DE   K + L K + K  +   +++DI +EF  ER DYL++IR+  RE +L Q ++E++ PC+++ CNY+N ++++S+A +DE++  W LP++ +  T LP        A    R    EN        +  +L R    D +  YF+ R++  LLN+  S
Sbjct:  655 LFAGLSSLQRDVVGGEQANNPELHERRKERRRLADERHRRLMESLRLDHEADGEGTGDSDEVVMRVFDSMRDEAEEKERQLNKGRKKLRAAQADINDIQQEFESERRDYLDTIRRQQRELRLQQQLLERVAPCLRRDCNYANLERVRSEATWDEDAQAWRLPEMVVTRTSLPPAGGSGAQAKPSRRTPPHENGNHQHEDRFLERLTRAEAEDVAGNYFKPRRASLLLNKEAS 886          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: kif3ca (kinesin family member 3Ca [Source:ZFIN;Acc:ZDB-GENE-111214-2])

HSP 1 Score: 418.698 bits (1075), Expect = 6.853e-137
Identity = 212/364 (58.24%), Postives = 273/364 (75.00%), Query Frame = 3
Query:   27 SGEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKY-LVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQML 1115
            S E V+V+VR RP+N RE   + +++I IDV  GQ +IRNP  N  P + F FD  Y  D+    +Y +   PLV++V  G+NGTIFAYGQTG GK++TM+G+ +   +RGVIP +F+H+F  IS ++N     V ASYLEIY EEIRDLL++D   +L+L+E P+ G++V  LS     + R+ + VM  G +NR+ G+T MN  SSRSH+IF I +E      + E+HI+ GKLNLVDLAGSERQ+KTGA G+RLKEATKINLSLSALGNVISALVDGKS H+PYRDSKLTR+LQDSLGGN +T+M+A + PA  NY+E+L+TLRYANRAKNI+N+P++NEDPKDALLREFQ EI RLK+ L
Sbjct:   16 SAETVRVVVRCRPMNPRESAASYESVITIDVRAGQVAIRNPRANADPARTFTFDAVYGGDAKQLDIYEESFRPLVDSVLCGFNGTIFAYGQTGTGKTYTMEGVRSDPERRGVIPNSFEHIFTHISRSQNQPVPEVRASYLEIYQEEIRDLLSRDQSRRLELRERPDTGIHVKDLSSFVTKSAREIEHVMGIGNQNRSVGATNMNEHSSRSHAIFVITVECSELGADGESHIRVGKLNLVDLAGSERQAKTGAQGERLKEATKINLSLSALGNVISALVDGKSTHVPYRDSKLTRLLQDSLGGNARTVMVANVGPASYNYDESLTTLRYANRAKNIRNRPRVNEDPKDALLREFQEEIARLKEQL 379          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: kif3a (kinesin family member 3A [Source:ZFIN;Acc:ZDB-GENE-050417-71])

HSP 1 Score: 408.683 bits (1049), Expect = 1.554e-131
Identity = 213/364 (58.52%), Postives = 269/364 (73.90%), Query Frame = 3
Query:   30 GEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAE-NSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQMLA 1118
            G+ VKV+VR RP+N +E     +  + +D  RGQ +++ P+ N  P K F FD  +  +S    +Y+    P+V++V EGYNGTIFAYGQTG GK+FTM+GI      RG+IP +F H+F  I+ AE ++++LV  SYLEIYNEE++DLL KD   +L++KE P+ GVYV  LS   V+N  D   +M  G KNR+ GST MN  SSRSH+IFTI +E      +   H++ GKL+LVDLAGSERQ+KTGATG RLKEATKINLSLS LGNVISALVDGKS H+PYR+SKLTR+LQDSLGGN+KT+M A + PAD NY+ET+STLRYANRAKNI+NK +INEDPKDALLR+FQ EI  LK+ LA
Sbjct:   13 GDNVKVVVRCRPINGKETGAGHRMAVLVDEMRGQIAVQRPDCNDEPPKTFTFDTVFGTESKQVDVYNLTARPIVDSVLEGYNGTIFAYGQTGTGKTFTMEGIRAVPELRGIIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVKDLLGKDQTQRLEVKERPDVGVYVKDLSAFVVNNADDMDRIMTLGHKNRSVGSTNMNEHSSRSHAIFTITIECSEKGVDGNMHVRMGKLHLVDLAGSERQTKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQFQKEIEDLKKKLA 376          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: kif16bb (kinesin family member 16Bb [Source:ZFIN;Acc:ZDB-GENE-070424-241])

HSP 1 Score: 287.345 bits (734), Expect = 2.821e-82
Identity = 188/393 (47.84%), Postives = 239/393 (60.81%), Query Frame = 3
Query:   36 AVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQ-----------KPFFFDGSY-NID------STTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETIS--LAENSKYLVHASYLEIYNEEIRXXXXXXXXXX--XXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALV---------DGKSKHI--PYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQML 1115
            +VKV VRVRP+N+RE  L  K II ++   G+ ++    + KTP+           K F +D SY ++D      ++ E +Y DI   +++   EGYN  IFAYGQTG GKS+TM G  NP    G+IPR  + ++  +S  ++  + Y    SYLEIYNE +RDLL +       L ++EHP++G YV  LS H V N  D + +ME G  NR T +T MN  SSRSH+IFTI       D  E       K++LVDLAGSER   TGATG RLKE   IN SL  LGNVIS+L           G+ K +  PYRDS LT +L+DSLGGN+KT+MIA +SPAD NY ETLSTLRYANRAKNI NKP INED    L+RE + EI RLK +L
Sbjct:    3 SVKVAVRVRPMNQREKGLEAKFIIQME---GKKTV--ITNLKTPEGSTGDVSRERLKEFTYDYSYFSVDKRSPQFASQEMVYKDIGMDVLDAAFEGYNACIFAYGQTGSGKSYTMMG--NPGDL-GLIPRICEGLYRGVSQHISSGASYRTEVSYLEIYNERVRDLLRRKSSKSFNLRVREHPKEGPYVEDLSKHLVQNYSDVEELMEAGNINRTTAATGMNDVSSRSHAIFTIKFTQAKFD-AEMPRETVSKIHLVDLAGSERADATGATGVRLKEGGNINKSLVTLGNVISSLADLSLSSSSPQGRKKQVFVPYRDSVLTWLLKDSLGGNSKTIMIATISPADVNYGETLSTLRYANRAKNIINKPTINEDSNVKLIRELRAEIVRLKALL 386          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: kif11 (kinesin family member 11 [Source:ZFIN;Acc:ZDB-GENE-020426-1])

HSP 1 Score: 283.108 bits (723), Expect = 3.670e-82
Identity = 166/376 (44.15%), Postives = 235/376 (62.50%), Query Frame = 3
Query:   39 VKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIR--NPNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQ--------RGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRXXXXXX----XXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINED-PKDALLREFQNEINRLKQMLAG 1121
            ++V VR RPLN  E   N  +I++ D +R + S++   P   K+ +K + +D  +   +   ++Y  +VYP+++ V  GYN T+FAYGQTG GK+FTM+G  +P+ +         GVIPR    +FE ++ +   ++ V  S LEIYNEE+ DLL+       + ++      +  V + GL    V N  +   ++E G   R T STLMN  SSRSHS+F+I + M  T  + E  +K GKLN+VDLAGSE   ++GA   R +EA  IN SL  LG VI+ALV+ ++ HIPYR+SKLTR+LQDSLGG TKT +IA +SPA  N EETLSTL YA RAKNI NKP++N+   K AL++E+ +EI RLK+ L+ 
Sbjct:   22 IQVFVRCRPLNGIERKANSYSIVECDQARKELSVKLNVPLGEKSSKKTYTYDMVFGPAAKQIEIYKSVVYPILDEVILGYNCTVFAYGQTGTGKTFTMEGERSPNDEFTWEEDPLAGVIPRTLHQIFEKLT-SLGVEFSVKVSLLEIYNEELFDLLSSSPDIGERLQMFDDPRSKGAVLIKGLEEVTVHNKDEVYHILEHGAAKRRTASTLMNAYSSRSHSVFSITIHMKETMMDGEELVKIGKLNMVDLAGSENIGRSGAVDKRAREAGNINQSLLTLGRVITALVE-RTPHIPYRESKLTRLLQDSLGGRTKTSIIATISPAAVNIEETLSTLEYAARAKNIMNKPEVNQKLTKKALIKEYTDEIERLKKELSS 395          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: KIP3 (Kinesin-related antiparallel sliding motor protein; involved in mitotic spindle positioning; sliding activity promotes bipolar spindle assembly and maintenance of genome stability; inhibits spindle elongation, destabilizing late anaphase spindle microtubules that polymerize beyond the midzone [Source:SGD;Acc:S000003184])

HSP 1 Score: 218.394 bits (555), Expect = 1.537e-60
Identity = 130/292 (44.52%), Postives = 186/292 (63.70%), Query Frame = 3
Query:  177 FFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETIS-LAENSKYLVHASYLEIYNEEIRXXXXXXX-XXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALV--DG-KSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNK 1037
            F FD  ++  S+  ++Y +   PL+++V +G+N T+FAYG TGCGK++T+ G   PS Q G+I  A + +F  I+ L +   + +  SYLEIYNE IRDLL  +    +L ++E  +  + V+ LS H  + V D   ++ +G  NR T  T  N  SSRSH++  I++   N   +  +      L+++DLAGSER + T   G RL E   IN SL ALGN I+AL   DG +S HIPYRDSKLTR+L+ SLGGN KT+MI C+SP+ ++Y+ETL+TL+YANRAK I+ K
Sbjct:  153 FVFDKLFDETSSQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSG--TPS-QPGIIFLAMEELFNKITDLKDEKDFEISLSYLEIYNERIRDLLKPETPSKRLVIREDTQNHIKVANLSYHHPNTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNKLVDLTSQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGSRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: KIP1 (Kinesin-related motor protein; required for mitotic spindle assembly, chromosome segregation, and 2 micron plasmid partitioning; functionally redundant with Cin8p for chromosomal but not plasmid functions [Source:SGD;Acc:S000000159])

HSP 1 Score: 219.935 bits (559), Expect = 4.978e-60
Identity = 149/392 (38.01%), Postives = 222/392 (56.63%), Query Frame = 3
Query:   27 SGEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKT---PQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVN-----PST-------QRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEK------------GVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENE----ENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINED-PKDALLREFQNEINRLK 1106
            S   + V VR R  N+REI      +I     +G+  I +   +++    +K + FD  +  +S  E +++      ++ +  GYN TIFAYGQTG GK++TM G +N      ST         G+IPR    +F+ +S + N +Y V  S+LE+YNE ++DLL+        + + P++             + V G+    +++  +   ++ +G   R   +T  N  SSRSH++FTI   +   D  +    +N +K GKLNLVDLAGSE  +++GA   R +EA  IN SL  LG VI+ALVD  S HIPYR+SKLTR+LQDSLGG TKT +IA +SPA  + EET STL YA RAK+I+N P++N+   KD  L+++  EI +L+
Sbjct:   49 SDSNIHVYVRCRSRNKREIEEKSSVVISTLGPQGKEIILSNGSHQSYSSSKKTYQFDQVFGAESDQETVFNATAKNYIKEMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDNLLLGEHAGIIPRVLVDLFKELS-SLNKEYSVKISFLELYNENLKDLLSDSEDDDPAVND-PKRQIRIFDNNNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVD-HSNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTPQVNQSLSKDTCLKDYIQEIEKLR 437          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: KAR3 (Minus-end-directed microtubule motor; functions in mitosis and meiosis, localizes to the spindle pole body and localization is dependent on functional Cik1p, required for nuclear fusion during mating; potential Cdc28p substrate [Source:SGD;Acc:S000006345])

HSP 1 Score: 176.407 bits (446), Expect = 1.399e-46
Identity = 123/343 (35.86%), Postives = 186/343 (54.23%), Query Frame = 3
Query:   39 VKVIVRVRPL--NEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQ-KPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENS--KYLVHASYLEIYNEEI-------RXXXXXXXXXXXXXXEHPEKGVYVSGLSMH--KVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISAL--VDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRA 1019
            ++V  R+RP   N    + +  N+ + D + G  S+       T Q   F FD  ++   T   ++ + V  LV++  +GYN  IFAYGQTG GK+FTM   +NP    G+IP    H+F  I+  +     Y V+  ++EIYNE I        +              H ++    +  ++   K+ +    ++++++  K R+T ST  N  SSRSHSIF I+L   N      ++   G LNLVDLAGSER + +   GDRL+E   IN SLS LG+VI AL   D   +HIP+R+SKLT +LQ SL G++KTLM   +SP+ ++  ETL++LR+A++ 
Sbjct:  387 IRVYCRIRPALKNLENSDTSLINVNEFDDNSGVQSMEVTKIQNTAQVHEFKFDKIFDQQDTNVDVFKE-VGQLVQSSLDGYNVCIFAYGQTGSGKTFTM---LNPGD--GIIPSTISHIFNWINKLKTKGWDYKVNCEFIEIYNENIVDLLRSDNNNKEDTSIGLKHEIRHDQETKTTTITNVTSCKLESEEMVEIILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNAKTGAHSY---GTLNLVDLAGSERINVSQVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLMFVNISPSSSHINETLNSLRFASKV 720          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: CIN8 (Kinesin motor protein; involved in mitotic spindle assembly and chromosome segregation [Source:SGD;Acc:S000000787])

HSP 1 Score: 173.326 bits (438), Expect = 6.094e-45
Identity = 98/195 (50.26%), Postives = 131/195 (67.18%), Query Frame = 3
Query:  525 GVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINE-DPKDALLREFQNEINRLK 1106
            G+Y+  L    ++N  +   ++++G K+R   ST MN  SSRSH+IFTI L   + DE      +  K+NLVDLAGSE  +++GA   R KEA  IN SL  LG VI+ALVD KS HIP+R+SKLTR+LQDSLGGNTKT +IA +SPA    EET STL YA++AKNI+NKP++     KD L++    E+ ++K
Sbjct:  315 GIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDE----LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVD-KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSFIMKDILVKNITMELAKIK 504          

HSP 2 Score: 81.6481 bits (200), Expect = 2.846e-16
Identity = 49/154 (31.82%), Postives = 86/154 (55.84%), Query Frame = 3
Query:   39 VKVIVRVRPLNEREINLNCKNIIDI-DVS-RGQCSIRNPNDNK-TPQ---KPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQG---IVNP--STQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIR 467
            + V VR R  NEREI++    ++++ D++   + SI    D   T Q   K +  D  +   ++ + ++ ++  PL ++  +GYN T+  YG T  GK++TM G   + N   S   G+IPR    +F+T+ L +N  Y+V  S++E+YNEE++
Sbjct:   37 ITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQND-YVVKCSFIELYNEELK 189          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: KIP2 (Kinesin-related motor protein involved in mitotic spindle positioning; stabilizes microtubules by targeting Bik1p to the plus end; functions as a microtubule polymerase and catastrophe inhibitor in vitro; Kip2p levels are controlled during the cell cycle [Source:SGD;Acc:S000006076])

HSP 1 Score: 149.443 bits (376), Expect = 7.356e-38
Identity = 117/342 (34.21%), Postives = 161/342 (47.08%), Query Frame = 3
Query:  177 FFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETI---SLAENSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEK-----------------------GVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATG--DRLKEATKINLSLSALGNVISALVDGK------------------------------SKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNI 1028
            F FD  +    T  ++Y     P+++ +  G+N TIFAYG TG GK+FTM G      + G+IP +  ++F  I   S+  + K+ V  SYLEIYNE I DLL   ++        P +                       GV V GL+  +  +  +    +  G K+R  G T  N  SSRSH+I  I L   N         ++  L+L DLAGSER     ATG  +R KE + IN SL ALG VIS L   K                              S HIPYRDSKLTR+LQ +L G++    I  +   ++   ET++TLR+A+RAKN+
Sbjct:  163 FKFDHVFASHCTNLEVYERTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSG---NEQELGLIPLSVSYLFTNIMEQSMNGDKKFDVIISYLEIYNERIYDLLESGLEESGSRISTPSRLYMSKSNSNGLGVELKIRDDSQYGVKVIGLTERRCESSEELLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTSTNVKNGTS---RSSTLSLCDLAGSER-----ATGQQERRKEGSFINKSLLALGTVISKLSADKMNSVGSNIPSPSASGSSSSSGNATNNGTSPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRNDAAAETMNTLRFASRAKNV 493          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO37529 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFN7])

HSP 1 Score: 541.576 bits (1394), Expect = 0.000e+0
Identity = 269/376 (71.54%), Postives = 317/376 (84.31%), Query Frame = 3
Query:   30 GEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQMLAGQIPINMDAVSTA 1157
             EAV+VIVR RPLN+RE +L C+ ++++D   GQC +  P D   P K F FDG+Y IDSTTE +Y+DI +PLVE V EGYNGT+FAYGQTGCGKSF+M GI +P TQRG+IPRAF+H+FE+I++A++SK+LVHASYLEIYNEEIRDLL KD KAKLDLKEHP+KGVYV  L+M  V+ V + + VM+ G KNR+ G+TLMN DSSRSHSIF+I LE+ + D     HI+AGKLNLVDLAGSERQSKTGATG RLKEATKINLSLSALGNVISALVDGK+KHIPYRDSKLTR+LQDSLGGNTKTLM+ACLSPADNNY+ETLSTLRYANRAKNI+NKPKINEDPKDALLR++  EI RLK+ML GQ+ I  D +  +
Sbjct:    2 AEAVRVIVRCRPLNKREKDLKCETVLEMDSDTGQCRLHKPGDKTQPPKAFTFDGAYFIDSTTENIYNDICFPLVEGVLEGYNGTVFAYGQTGCGKSFSMMGITDPPTQRGIIPRAFEHIFESINVADDSKFLVHASYLEIYNEEIRDLLGKDHKAKLDLKEHPDKGVYVKDLTMIPVNCVSEIEHVMDLGSKNRSVGATLMNADSSRSHSIFSINLEILDDDSEGNEHIRAGKLNLVDLAGSERQSKTGATGGRLKEATKINLSLSALGNVISALVDGKAKHIPYRDSKLTRLLQDSLGGNTKTLMVACLSPADNNYDETLSTLRYANRAKNIKNKPKINEDPKDALLRQYSEEIERLKKMLMGQMEIPTDLLGKS 377          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO39610 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9N5])

HSP 1 Score: 444.506 bits (1142), Expect = 1.115e-149
Identity = 225/368 (61.14%), Postives = 278/368 (75.54%), Query Frame = 3
Query:   24 MSGEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETI---SLAENSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQMLA 1118
            MS E V+VI R RPL+  EI +  + I+ ID S  QCS+R P D    +K F FDG Y     TE+LYS+IV+P+V+ V EGYNGT+FAYGQT CGK+FTMQG   P +Q G+ PR   H+  ++       N +YL+H SYLEIYNEEIRDLL K+ ++ L++KEHP+KG+YV GLS   V    D   ++E G  NR+ GST MN DSSRSHSIF I L++      E   ++ GKLNLVDLAGSERQSK+GATG+R +EATKINLSLSALGNVISALVDGKSKHIPYRDSKLTR+LQDSLGGN+KTLM+AC+SP  NNYEETLSTLRYA RAKNI+N+P+INEDPKD+L+R++  EI +LK+++A
Sbjct:    1 MSDECVRVIARCRPLDYNEIKMKTEIIVSIDSSLRQCSLRKPGDPAKMRKVFTFDGVYGSQCNTEKLYSEIVHPIVDGVLEGYNGTVFAYGQTSCGKTFTMQGSAQPESQVGITPRCCRHILNSMQGKGRRRNREYLLHVSYLEIYNEEIRDLLVKNTRSNLEIKEHPDKGMYVKGLSSITVDCYEDMAEILEIGSANRSVGSTCMNTDSSRSHSIFIIDLQVNVNKGGEGECVRNGKLNLVDLAGSERQSKSGATGERFREATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRLLQDSLGGNSKTLMVACISPGSNNYEETLSTLRYAKRAKNIKNRPRINEDPKDSLIRKYLEEIQQLKKIIA 368          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO40836 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5X0])

HSP 1 Score: 408.683 bits (1049), Expect = 5.286e-131
Identity = 212/350 (60.57%), Postives = 259/350 (74.00%), Query Frame = 3
Query:   66 LNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQML 1115
            +NE+EI      +++++V +GQ  IRNP       K F +D  Y+ +S    LY +    LVE+V EGYNGTIFAYGQTG GK+FTM+G+ +    RGVIP +FDH+F  I+   N +YLV ASYLEIY EE+RDLL KD K +L+LKE P+ GVYV  L      +V++ + VM  G +NR+ G+T MN  SSRSH+IF I +E    +   E HI+ GKLN+VDLAGSERQ+KT ATGDRLKEATKINLSLSALGNVISALVDGKS HIPYRDSKLTR+LQDSLGGN +T+M+A + PA  NYEE+++TLRYANRAKNI+NKP INEDPKDALLREFQ EI RLK  L
Sbjct:    1 MNEKEIANGHTRVVEMNVKKGQIEIRNPLKKDEVPKMFTYDAVYDWNSKQIDLYDETFRQLVESVLEGYNGTIFAYGQTGTGKTFTMEGVRSDPDLRGVIPNSFDHIFTHIARTTNQQYLVRASYLEIYQEEVRDLLGKDQKKRLELKERPDTGVYVKDLQSFVCKSVKEIEHVMNVGNQNRSVGATKMNEHSSRSHAIFIITIECSQLNAVGECHIRVGKLNMVDLAGSERQTKTEATGDRLKEATKINLSLSALGNVISALVDGKSTHIPYRDSKLTRLLQDSLGGNARTVMVANIGPASYNYEESITTLRYANRAKNIKNKPHINEDPKDALLREFQEEIARLKNEL 350          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO47075 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN53])

HSP 1 Score: 321.627 bits (823), Expect = 6.699e-99
Identity = 170/311 (54.66%), Postives = 222/311 (71.38%), Query Frame = 3
Query:   27 SGEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKT-PQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENS-KYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIA 953
            SG+ V+V+VR RPLNE+E    CK  +++D   G  ++  P    + P K F FD  +N+D     +Y+D    +VE+V EGYNGTIFAYGQTG GK+FTM+G+ +    RG++P +F H+F  I+  +   ++LV  SYLEIYNE +RDLL KD  AKL++KE P+ GVYV  LS + ++N  D    M  G KNR+ G+T MN  SSRSH+IF+I +E      + + H++ GKL+LVDLAGSERQ+KTGATG RLKEAT+INLSLS LGNVISALVDGKS HIPYR+SKLTR+LQDSLGGN+KT+M+ 
Sbjct:    7 SGDNVRVVVRCRPLNEKEKGSGCKMCVNVDEGTGSIAVTPPGGRSSEPPKKFTFDRVFNVDCKQTDVYTDAARGIVESVLEGYNGTIFAYGQTGTGKTFTMEGVRSVPELRGIVPNSFAHIFGHIAKVDGHVRFLVRVSYLEIYNENVRDLLGKDQNAKLEVKERPDIGVYVKDLSSYVMNNADDLDRTMTLGNKNRSVGATNMNERSSRSHAIFSITVECSEKGLDGQQHVRMGKLHLVDLAGSERQAKTGATGVRLKEATQINLSLSTLGNVISALVDGKSTHIPYRNSKLTRLLQDSLGGNSKTIMVG 317          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO33740 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRC2])

HSP 1 Score: 292.352 bits (747), Expect = 9.193e-89
Identity = 178/391 (45.52%), Postives = 238/391 (60.87%), Query Frame = 3
Query:   36 AVKVIVRVRPLNEREINLNCKNIIDIDVSRGQ------CSIRNPNDNKTPQKPFFFDGSY-NIDSTT------EQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENS----KYLVHASYLEIYNEEIRXX----XXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKH---------IPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQMLA 1118
            +VKV VRVRPLN RE N+  K II+++  + +       ++    + K   K F FD SY ++D  +      E+++ D+   +V+   EGYN  IFAYGQTG GK++TM G    +   G+IPR  +++F  ++   N+     +    SYLEIY E +RDL            L ++EHP++G YV  L+ H VS+    + +ME+G  +R T ST MN  SSRSH+IFT+       D  E     A K+NLVDLAGSER   TGATG+RLKE   IN SL  LG VISAL D  + H         IPYRDS LT +L+DSLGGN+KT+MIA +SPAD NY ET+STLRYANRAKNI NKP INEDP   L+R+ +++I +LK M++
Sbjct:    3 SVKVAVRVRPLNNRENNMGAKTIIEMEGKKTRIYNVKGTNVTGEGERKNYVKDFSFDYSYWSVDERSRHFVNQERVFKDLGTDVVKAAFEGYNACIFAYGQTGSGKTYTMMG---HNGDTGLIPRICENMFHRMTENSNADDGVSFRTEVSYLEIYQERVRDLLRPPTKGRAAHSLRVREHPKEGPYVQDLTKHLVSDYAAIEHLMEQGNSHRVTASTGMNDVSSRSHAIFTMNFTQAKFDM-ELPCETASKINLVDLAGSERADATGATGERLKEGANINKSLVTLGTVISALADASTGHGSHGSHHKFIPYRDSVLTWLLKDSLGGNSKTIMIATISPADVNYAETMSTLRYANRAKNIMNKPTINEDPNVKLIRDLRSQIEKLKAMIS 389          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: kif3b (kinesin family member 3B [Source:NCBI gene;Acc:101155428])

HSP 1 Score: 426.787 bits (1096), Expect = 1.528e-137
Identity = 219/365 (60.00%), Postives = 275/365 (75.34%), Query Frame = 3
Query:   27 SGEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKT--PQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQML 1115
            S E+VKV+VR RP+NE+E     + ++ +DV  GQ  ++NP +     P K F FD  Y+ +S    LY +   PLV++V  G+NGTIFAYGQTG GK++TM+G+     +RGVIP +F+H+F  IS ++N +YLV ASYLEIY EEIRDLL+KD   +L+L+E P+ GV+V  LS     +VR+ + VM  G +NR+ G+T MN  SSRSH+IF I +E      +EENHI+ GKLNLVDLAGSERQSKTGA G+RLKEATKINLSLSALGNVISALVDG+S HIPYRDSKLTR+LQDSLGGN +T+M+A + PA  N EETL+TLRYANRAKNI+NKP+INEDPKDA+LR FQ EI RLK+ L
Sbjct:    6 SPESVKVVVRCRPMNEKERAAGFERVVSLDVKLGQIMVKNPREASANEPPKVFTFDSVYDWNSKQIDLYDETFRPLVDSVLLGFNGTIFAYGQTGTGKTYTMEGVRKDPERRGVIPNSFEHIFTHISRSQNQQYLVSASYLEIYQEEIRDLLSKDQSRRLELRERPDVGVHVRDLSSFVTKSVREIENVMNIGNQNRSVGATNMNEHSSRSHAIFVITVECSEMGVDEENHIRVGKLNLVDLAGSERQSKTGAQGERLKEATKINLSLSALGNVISALVDGRSSHIPYRDSKLTRLLQDSLGGNARTVMVANIGPASYNVEETLTTLRYANRAKNIKNKPRINEDPKDAMLRTFQEEILRLKEQL 370          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: kif3b (kinesin family member 3B [Source:NCBI gene;Acc:101155428])

HSP 1 Score: 426.787 bits (1096), Expect = 1.528e-137
Identity = 219/365 (60.00%), Postives = 275/365 (75.34%), Query Frame = 3
Query:   27 SGEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKT--PQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQML 1115
            S E+VKV+VR RP+NE+E     + ++ +DV  GQ  ++NP +     P K F FD  Y+ +S    LY +   PLV++V  G+NGTIFAYGQTG GK++TM+G+     +RGVIP +F+H+F  IS ++N +YLV ASYLEIY EEIRDLL+KD   +L+L+E P+ GV+V  LS     +VR+ + VM  G +NR+ G+T MN  SSRSH+IF I +E      +EENHI+ GKLNLVDLAGSERQSKTGA G+RLKEATKINLSLSALGNVISALVDG+S HIPYRDSKLTR+LQDSLGGN +T+M+A + PA  N EETL+TLRYANRAKNI+NKP+INEDPKDA+LR FQ EI RLK+ L
Sbjct:    6 SPESVKVVVRCRPMNEKERAAGFERVVSLDVKLGQIMVKNPREASANEPPKVFTFDSVYDWNSKQIDLYDETFRPLVDSVLLGFNGTIFAYGQTGTGKTYTMEGVRKDPERRGVIPNSFEHIFTHISRSQNQQYLVSASYLEIYQEEIRDLLSKDQSRRLELRERPDVGVHVRDLSSFVTKSVREIENVMNIGNQNRSVGATNMNEHSSRSHAIFVITVECSEMGVDEENHIRVGKLNLVDLAGSERQSKTGAQGERLKEATKINLSLSALGNVISALVDGRSSHIPYRDSKLTRLLQDSLGGNARTVMVANIGPASYNVEETLTTLRYANRAKNIKNKPRINEDPKDAMLRTFQEEILRLKEQL 370          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: ENSORLT00000022071.2 (kinesin-like protein KIF3C [Source:NCBI gene;Acc:101173427])

HSP 1 Score: 402.519 bits (1033), Expect = 3.187e-128
Identity = 214/368 (58.15%), Postives = 265/368 (72.01%), Query Frame = 3
Query:   27 SGEAVKVIVRVRPLNEREINLN-CKNIIDIDVSRGQCSIRNPNDNKT-PQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSK-YLVHASYLEIYNEEIRXXXX--XXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQML 1115
            S E+VKV+VR RPLN +E +      I+ +D+  GQ  +RNP  + + PQK F FD  Y+ +S    LY + V PL+++V  G+NGTIFAYGQTG GK++TMQG      +RGVIP AFDH+F  IS +++ K YLV ASYLEIY EEIRDLL         LDL+E PE GVYV  L+     ++++ + VM  G + R  G+T MN  SSRSH++F I +E      +   HI+ G+LNLVDLAGSERQ+KTG  G+RLKEA KINLSLSALGNVISAL DG+S H+PYRDSKLTR+LQDSLGGN KT+M+A L PA  +Y+ETL+TLRYANRAKNIQN+PK+NEDPKDALLREFQ EI RLK  L
Sbjct:    6 SSESVKVVVRCRPLNRKEESSGPVGGIVQMDLRLGQVILRNPRASPSEPQKTFTFDAVYDGNSKQRDLYDESVRPLIDSVLAGFNGTIFAYGQTGTGKTYTMQGAWLDPEKRGVIPNAFDHIFTHISRSQSDKQYLVRASYLEIYREEIRDLLDPNHSTTRGLDLRESPETGVYVQDLTSCVCKSIKEIEEVMNVGNQTRVVGATDMNEHSSRSHALFLITVECSQPGPDGRKHIRVGRLNLVDLAGSERQAKTGVHGERLKEAAKINLSLSALGNVISALADGRSGHVPYRDSKLTRLLQDSLGGNAKTVMVATLGPAPAHYDETLTTLRYANRAKNIQNQPKVNEDPKDALLREFQKEIARLKAQL 373          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: ENSORLT00000040869.1 (kinesin-like protein KIF3C [Source:NCBI gene;Acc:101173427])

HSP 1 Score: 402.519 bits (1033), Expect = 3.187e-128
Identity = 214/368 (58.15%), Postives = 265/368 (72.01%), Query Frame = 3
Query:   27 SGEAVKVIVRVRPLNEREINLN-CKNIIDIDVSRGQCSIRNPNDNKT-PQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSK-YLVHASYLEIYNEEIRXXXX--XXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQML 1115
            S E+VKV+VR RPLN +E +      I+ +D+  GQ  +RNP  + + PQK F FD  Y+ +S    LY + V PL+++V  G+NGTIFAYGQTG GK++TMQG      +RGVIP AFDH+F  IS +++ K YLV ASYLEIY EEIRDLL         LDL+E PE GVYV  L+     ++++ + VM  G + R  G+T MN  SSRSH++F I +E      +   HI+ G+LNLVDLAGSERQ+KTG  G+RLKEA KINLSLSALGNVISAL DG+S H+PYRDSKLTR+LQDSLGGN KT+M+A L PA  +Y+ETL+TLRYANRAKNIQN+PK+NEDPKDALLREFQ EI RLK  L
Sbjct:    6 SSESVKVVVRCRPLNRKEESSGPVGGIVQMDLRLGQVILRNPRASPSEPQKTFTFDAVYDGNSKQRDLYDESVRPLIDSVLAGFNGTIFAYGQTGTGKTYTMQGAWLDPEKRGVIPNAFDHIFTHISRSQSDKQYLVRASYLEIYREEIRDLLDPNHSTTRGLDLRESPETGVYVQDLTSCVCKSIKEIEEVMNVGNQTRVVGATDMNEHSSRSHALFLITVECSQPGPDGRKHIRVGRLNLVDLAGSERQAKTGVHGERLKEAAKINLSLSALGNVISALADGRSGHVPYRDSKLTRLLQDSLGGNAKTVMVATLGPAPAHYDETLTTLRYANRAKNIQNQPKVNEDPKDALLREFQKEIARLKAQL 373          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: kif3a (kinesin-like protein KIF3A [Source:NCBI gene;Acc:101164388])

HSP 1 Score: 399.823 bits (1026), Expect = 1.387e-127
Identity = 206/360 (57.22%), Postives = 262/360 (72.78%), Query Frame = 3
Query:   39 VKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAE-NSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQML 1115
            VKV+VR RPLN+RE     K  + +D  RG  ++      + P K F FD  +  DS    +Y+    P+V++V EGYNGTIFAYGQTG GK+FTM+G+      RG+IP +F H+F  I+ AE ++++LV  SYLEIYNEE+RDLL KD   +L++KE P+ GVY+  L+ +  +N  D   +M  G KNR+ G+T MN  SSRSH+IFT+ +E      +   H++ GKL+LVDLAGSERQ KTGATG RLKEATKINLSLS LGNVISALVDGKS H+PYR+SKLTR+LQDSLGGN+KT+M A + PAD NY+ET+STLRYANRAKNI+NK +INEDPKDALLR+FQ EI  L++ L
Sbjct:   17 VKVVVRCRPLNQREKMTGFKQAVTVDEIRGTITVNKFETAQEPPKTFTFDTVFGPDSKQLDVYNLTARPIVDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAVPELRGIIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQMQRLEVKERPDIGVYIKDLTSYAANNADDMDRIMTVGHKNRSVGATNMNEHSSRSHAIFTVTIEYSEKGLDGNQHVRMGKLHLVDLAGSERQGKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQFQKEIEDLRKKL 376          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000035453.1 (SMESG000035453.1)

HSP 1 Score: 1585.47 bits (4104), Expect = 0.000e+0
Identity = 819/824 (99.39%), Postives = 820/824 (99.51%), Query Frame = 3
Query:   24 MSGEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQMLAGQIPINMDAVSTAKPTDSSEKHRLTEIERXXXXXXXXXXXXXXXXQYSAEAADKAKLKSDMEKLKQYYDEKLMQLDIRDIPNSDEVLRLFEPKIFTSSSNSGPQPIGQFEKDLGNPNLYDLNLADTSVVIVNPEGNYAPDIEPQRAVHVRTVPKQEVLIHDKNELLSKLQYLQSTMVGGEQINNEVAKDXXXXXXXXXXXXXXXLMDSNERMEDDGIMLGVFEDIQDELRVKSKLLQKEKNKNLSLIQEMSDINEEFHKERCDYLESIRKLDRENKLLQMMMEKIQPCIKKSCNYSNFDKIKSQAKFDEESGKWILPQLKLEDTQLPNADEKIRDNVDENYYRKLARKPDPSQEYFQNRKSGQLLNQRNSPNNISNSQYNSQLGYVSVNNSNLQKLSDHQYEANSYSNDFRAAEVHGQFQLNPDVPTRRGAYRLDAIQTVTKPRKKSSKYTPDNSMNDF 2495
            MSGEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRDLLAKDVKAKLDLKEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQMLAG IPINMDAVSTAKPTDSSEKHRLTEIEREKIKAEYEAKLLEKEAQYSAEAADKAKLKSDMEKLKQYYDEKLMQLDIRDIPNSDEVLRLFEPKIFTSSSNSGPQPIGQFEKDLGNPNLYDLNLADTSVVIVNPEGNYA  +EPQRAVHVRTVPKQEVLIHDKNELLSKLQYLQSTMVGGEQINNEVAKDRHSKRKRHAEEKKRRLMDSNERMEDDGIMLGVFEDIQDELRVKSKLLQKEKNKNLSLIQEMSDINEEFHKERCDYLESIRKLDRENKLLQMMMEKIQPCIKKSCNYSNFDKIKSQAKFDEESGKWILPQLKLEDTQLPNADEKIRDNVDENYYRKLARKPDPSQEYFQNRKSGQLLNQRNSPNNISNSQYNSQLGYVSVNNSNLQKLSDHQYEANSYSNDFRAAEVHGQFQLNPDV TRRGAYRLDAIQTVTKPRKKSSKYTPDNSMNDF
Sbjct:    1 MSGEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRDLLAKDVKAKLDLKEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQMLAGHIPINMDAVSTAKPTDSSEKHRLTEIEREKIKAEYEAKLLEKEAQYSAEAADKAKLKSDMEKLKQYYDEKLMQLDIRDIPNSDEVLRLFEPKIFTSSSNSGPQPIGQFEKDLGNPNLYDLNLADTSVVIVNPEGNYAA-VEPQRAVHVRTVPKQEVLIHDKNELLSKLQYLQSTMVGGEQINNEVAKDRHSKRKRHAEEKKRRLMDSNERMEDDGIMLGVFEDIQDELRVKSKLLQKEKNKNLSLIQEMSDINEEFHKERCDYLESIRKLDRENKLLQMMMEKIQPCIKKSCNYSNFDKIKSQAKFDEESGKWILPQLKLEDTQLPNADEKIRDNVDENYYRKLARKPDPSQEYFQNRKSGQLLNQRNSPNNISNSQYNSQLGYVSVNNSNLQKLSDHQYEANSYSNDFRAAEVHGQFQLNPDVTTRRGAYRLDAIQTVTKPRKKSSKYTPDNSMNDF 823          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000035453.1 (SMESG000035453.1)

HSP 1 Score: 1577.76 bits (4084), Expect = 0.000e+0
Identity = 819/835 (98.08%), Postives = 820/835 (98.20%), Query Frame = 3
Query:   24 MSGEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQ-----------VVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQMLAGQIPINMDAVSTAKPTDSSEKHRLTEIERXXXXXXXXXXXXXXXXQYSAEAADKAKLKSDMEKLKQYYDEKLMQLDIRDIPNSDEVLRLFEPKIFTSSSNSGPQPIGQFEKDLGNPNLYDLNLADTSVVIVNPEGNYAPDIEPQRAVHVRTVPKQEVLIHDKNELLSKLQYLQSTMVGGEQINNEVAKDXXXXXXXXXXXXXXXLMDSNERMEDDGIMLGVFEDIQDELRVKSKLLQKEKNKNLSLIQEMSDINEEFHKERCDYLESIRKLDRENKLLQMMMEKIQPCIKKSCNYSNFDKIKSQAKFDEESGKWILPQLKLEDTQLPNADEKIRDNVDENYYRKLARKPDPSQEYFQNRKSGQLLNQRNSPNNISNSQYNSQLGYVSVNNSNLQKLSDHQYEANSYSNDFRAAEVHGQFQLNPDVPTRRGAYRLDAIQTVTKPRKKSSKYTPDNSMNDF 2495
            MSGEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRDLLAKDVKAKLDLKEHPEKGVYVSGLSMHKVSNVRDCQ           VVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQMLAG IPINMDAVSTAKPTDSSEKHRLTEIEREKIKAEYEAKLLEKEAQYSAEAADKAKLKSDMEKLKQYYDEKLMQLDIRDIPNSDEVLRLFEPKIFTSSSNSGPQPIGQFEKDLGNPNLYDLNLADTSVVIVNPEGNYA  +EPQRAVHVRTVPKQEVLIHDKNELLSKLQYLQSTMVGGEQINNEVAKDRHSKRKRHAEEKKRRLMDSNERMEDDGIMLGVFEDIQDELRVKSKLLQKEKNKNLSLIQEMSDINEEFHKERCDYLESIRKLDRENKLLQMMMEKIQPCIKKSCNYSNFDKIKSQAKFDEESGKWILPQLKLEDTQLPNADEKIRDNVDENYYRKLARKPDPSQEYFQNRKSGQLLNQRNSPNNISNSQYNSQLGYVSVNNSNLQKLSDHQYEANSYSNDFRAAEVHGQFQLNPDV TRRGAYRLDAIQTVTKPRKKSSKYTPDNSMNDF
Sbjct:    1 MSGEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRDLLAKDVKAKLDLKEHPEKGVYVSGLSMHKVSNVRDCQNLEYSNSKAYKVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQMLAGHIPINMDAVSTAKPTDSSEKHRLTEIEREKIKAEYEAKLLEKEAQYSAEAADKAKLKSDMEKLKQYYDEKLMQLDIRDIPNSDEVLRLFEPKIFTSSSNSGPQPIGQFEKDLGNPNLYDLNLADTSVVIVNPEGNYAA-VEPQRAVHVRTVPKQEVLIHDKNELLSKLQYLQSTMVGGEQINNEVAKDRHSKRKRHAEEKKRRLMDSNERMEDDGIMLGVFEDIQDELRVKSKLLQKEKNKNLSLIQEMSDINEEFHKERCDYLESIRKLDRENKLLQMMMEKIQPCIKKSCNYSNFDKIKSQAKFDEESGKWILPQLKLEDTQLPNADEKIRDNVDENYYRKLARKPDPSQEYFQNRKSGQLLNQRNSPNNISNSQYNSQLGYVSVNNSNLQKLSDHQYEANSYSNDFRAAEVHGQFQLNPDVTTRRGAYRLDAIQTVTKPRKKSSKYTPDNSMNDF 834          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000035453.1 (SMESG000035453.1)

HSP 1 Score: 1545.02 bits (3999), Expect = 0.000e+0
Identity = 803/824 (97.45%), Postives = 804/824 (97.57%), Query Frame = 3
Query:   24 MSGEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQMLAGQIPINMDAVSTAKPTDSSEKHRLTEIERXXXXXXXXXXXXXXXXQYSAEAADKAKLKSDMEKLKQYYDEKLMQLDIRDIPNSDEVLRLFEPKIFTSSSNSGPQPIGQFEKDLGNPNLYDLNLADTSVVIVNPEGNYAPDIEPQRAVHVRTVPKQEVLIHDKNELLSKLQYLQSTMVGGEQINNEVAKDXXXXXXXXXXXXXXXLMDSNERMEDDGIMLGVFEDIQDELRVKSKLLQKEKNKNLSLIQEMSDINEEFHKERCDYLESIRKLDRENKLLQMMMEKIQPCIKKSCNYSNFDKIKSQAKFDEESGKWILPQLKLEDTQLPNADEKIRDNVDENYYRKLARKPDPSQEYFQNRKSGQLLNQRNSPNNISNSQYNSQLGYVSVNNSNLQKLSDHQYEANSYSNDFRAAEVHGQFQLNPDVPTRRGAYRLDAIQTVTKPRKKSSKYTPDNSMNDF 2495
            MSGEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRDLLAKDVKAKLDLKEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQMLAG IPINMDAVSTAKPTDSSEKHRLTEIEREKIKAEYEAKLLEKEAQYSAEAADKAKLKSDMEKLKQYYDEKLMQLDIRDIPNSDE                GPQPIGQFEKDLGNPNLYDLNLADTSVVIVNPEGNYA  +EPQRAVHVRTVPKQEVLIHDKNELLSKLQYLQSTMVGGEQINNEVAKDRHSKRKRHAEEKKRRLMDSNERMEDDGIMLGVFEDIQDELRVKSKLLQKEKNKNLSLIQEMSDINEEFHKERCDYLESIRKLDRENKLLQMMMEKIQPCIKKSCNYSNFDKIKSQAKFDEESGKWILPQLKLEDTQLPNADEKIRDNVDENYYRKLARKPDPSQEYFQNRKSGQLLNQRNSPNNISNSQYNSQLGYVSVNNSNLQKLSDHQYEANSYSNDFRAAEVHGQFQLNPDV TRRGAYRLDAIQTVTKPRKKSSKYTPDNSMNDF
Sbjct:    1 MSGEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRDLLAKDVKAKLDLKEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQMLAGHIPINMDAVSTAKPTDSSEKHRLTEIEREKIKAEYEAKLLEKEAQYSAEAADKAKLKSDMEKLKQYYDEKLMQLDIRDIPNSDE---------------GGPQPIGQFEKDLGNPNLYDLNLADTSVVIVNPEGNYAA-VEPQRAVHVRTVPKQEVLIHDKNELLSKLQYLQSTMVGGEQINNEVAKDRHSKRKRHAEEKKRRLMDSNERMEDDGIMLGVFEDIQDELRVKSKLLQKEKNKNLSLIQEMSDINEEFHKERCDYLESIRKLDRENKLLQMMMEKIQPCIKKSCNYSNFDKIKSQAKFDEESGKWILPQLKLEDTQLPNADEKIRDNVDENYYRKLARKPDPSQEYFQNRKSGQLLNQRNSPNNISNSQYNSQLGYVSVNNSNLQKLSDHQYEANSYSNDFRAAEVHGQFQLNPDVTTRRGAYRLDAIQTVTKPRKKSSKYTPDNSMNDF 808          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000020245.1 (SMESG000020245.1)

HSP 1 Score: 395.201 bits (1014), Expect = 1.614e-125
Identity = 202/350 (57.71%), Postives = 260/350 (74.29%), Query Frame = 3
Query:   66 LNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQML 1115
            +N+RE+       +++D  +G   +     ++   + F FD  Y+ +S  + LY +    LV++V EG+NGTIFAYGQTG GK+FTMQG+      +GVIPR+FDH+F  IS + +++YLV ASYLEIY E +RDLL KD   +L++KE P+ GVYV+ LS    ++ R+ + VM  G KNR+ G+T MN  SSRSH+IF + +E    +   ENHI+ GKLN+VDLAGSERQSKT + G+RLKEATKINLSLSALGNVISALVDGKS HIPYRDSKLTR+LQDSLGGN KT+M+A + PA  NY+ET +TLRYANRAKNI+NKPKINEDPKDALLRE+Q++I +LK ML
Sbjct:    1 MNKREVEEGHSRCVEMDTKKGIVEVNCGKSSQEGPRRFTFDAVYDWNSAQKDLYDETFQDLVQSVLEGFNGTIFAYGQTGTGKTFTMQGLKEDPVLKGVIPRSFDHIFNHISRSTDAQYLVRASYLEIYKESVRDLLHKDQTKQLEIKEKPDTGVYVNDLSSVLTNSCREIENVMNIGNKNRSVGATNMNEHSSRSHAIFIVTIECCRANAEGENHIRVGKLNMVDLAGSERQSKTHSEGERLKEATKINLSLSALGNVISALVDGKSTHIPYRDSKLTRLLQDSLGGNAKTVMVANIGPASYNYDETTNTLRYANRAKNIKNKPKINEDPKDALLREYQDKIEKLKGML 350          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000075065.1 (SMESG000075065.1)

HSP 1 Score: 376.711 bits (966), Expect = 2.740e-119
Identity = 204/361 (56.51%), Postives = 260/361 (72.02%), Query Frame = 3
Query:   39 VKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDN-KTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAE-NSKYLVHASYLEIYNEEIRXXXXXXXXXXXXXXEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQML 1115
            VKV++R RPLNE+E+   C     ++   G  +I NP  +   P K F FD  +  +S    +Y+ +  P+V++V  GYNGTIFAYGQTG GK+FTM+G  +    RG+IP +F HVF  I+ AE N  +LV  SYLEIYNEE+RDLL KD  A+L++KE P+ GVYV  L+   V    +   +M  G KNR TG+T MN  SSRSH+I+T+ +E   T  + E   + GKL+LVDLAGSERQ KTGATG RL+EA KINLSL+ LGNVISALVDGKS H+PYR+SKLTR+LQDSLGGN+KTLMIA + PAD N++E++S+LRYANRAKNI+NK  INEDPKDALLR++Q E+ RL+Q L
Sbjct:    9 VKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQL 369          
The following BLAST results are available for this feature:
BLAST of Kinesin-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIF171.742e-2163.13kinesin family member 17 [Source:HGNC Symbol;Acc:H... [more]
KIF171.357e-2163.13kinesin family member 17 [Source:HGNC Symbol;Acc:H... [more]
KIF3B1.610e-14060.76kinesin family member 3B [Source:HGNC Symbol;Acc:H... [more]
KIF177.795e-13463.74kinesin family member 17 [Source:HGNC Symbol;Acc:H... [more]
KIF3A4.710e-13057.69kinesin family member 3A [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
osm-31.944e-16360.59Osmotic avoidance abnormal protein 3 [Source:UniP... [more]
osm-36.454e-15562.41Osmotic avoidance abnormal protein 3 [Source:UniP... [more]
klp-114.290e-13459.83Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc... [more]
klp-207.406e-11955.16Kinesin-like protein klp-20 [Source:UniProtKB/Swi... [more]
klp-207.406e-11955.16Kinesin-like protein klp-20 [Source:UniProtKB/Swi... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kif3C2.763e-13358.15gene:FBgn0039925 transcript:FBtr0089196[more]
Klp64D1.322e-12557.02gene:FBgn0004380 transcript:FBtr0077157[more]
Klp68D3.114e-11353.15gene:FBgn0004381 transcript:FBtr0332129[more]
Klp68D3.114e-11353.15gene:FBgn0004381 transcript:FBtr0076030[more]
Klp98A1.465e-8748.27gene:FBgn0004387 transcript:FBtr0304671[more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif170.000e+051.48kinesin family member 17 [Source:ZFIN;Acc:ZDB-GENE... [more]
kif3cb1.200e-13560.39kinesin family member 3Cb [Source:ZFIN;Acc:ZDB-GEN... [more]
kif3ca2.690e-13560.22kinesin family member 3Ca [Source:ZFIN;Acc:ZDB-GEN... [more]
kif3b6.145e-13560.39kinesin family member 3B [Source:ZFIN;Acc:ZDB-GENE... [more]
kif3b1.923e-13460.39kinesin family member 3B [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIF3C5.394e-13660.71kinesin family member 3C [Source:NCBI gene;Acc:100... [more]
insm21.140e-13559.45insulinoma-associated 2 [Source:Xenbase;Acc:XB-GEN... [more]
insm22.239e-13559.45insulinoma-associated 2 [Source:Xenbase;Acc:XB-GEN... [more]
cbll11.059e-13058.52Cbl proto-oncogene-like 1, E3 ubiquitin protein li... [more]
cbll11.713e-13058.52Cbl proto-oncogene-like 1, E3 ubiquitin protein li... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kif171.823e-2961.21kinesin family member 17 [Source:MGI Symbol;Acc:MG... [more]
Kif172.100e-2870.33kinesin family member 17 [Source:MGI Symbol;Acc:MG... [more]
Kif3b3.882e-14060.49kinesin family member 3B [Source:MGI Symbol;Acc:MG... [more]
Kif3a3.090e-13057.69kinesin family member 3A [Source:MGI Symbol;Acc:MG... [more]
Kif3a3.423e-13057.69kinesin family member 3A [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q99PW8|KIF17_MOUSE1.275e-2861.21Kinesin-like protein KIF17 OS=Mus musculus OX=1009... [more]
sp|Q9P2E2|KIF17_HUMAN8.367e-2163.13Kinesin-like protein KIF17 OS=Homo sapiens OX=9606... [more]
sp|P46873|OSM3_CAEEL2.472e-16260.59Osmotic avoidance abnormal protein 3 OS=Caenorhabd... [more]
sp|O15066|KIF3B_HUMAN7.732e-14060.76Kinesin-like protein KIF3B OS=Homo sapiens OX=9606... [more]
sp|P46871|KRP95_STRPU1.476e-13962.06Kinesin-II 95 kDa subunit OS=Strongylocentrotus pu... [more]
back to top
BLAST of Kinesin-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RKY20.000e+054.29Kinesin-like protein OS=Fasciola hepatica OX=6192 ... [more]
A0A183AA130.000e+055.02Kinesin-like protein OS=Echinostoma caproni OX=278... [more]
A0A267GIS30.000e+053.30Kinesin-like protein OS=Macrostomum lignano OX=282... [more]
A0A075ABQ90.000e+054.68Kinesin-like protein (Fragment) OS=Opisthorchis vi... [more]
A0A3R7CS940.000e+054.05Kinesin-like protein OS=Clonorchis sinensis OX=799... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif170.000e+052.37kinesin family member 17 [Source:NCBI gene;Acc:103... [more]
kif3b7.434e-14161.10kinesin family member 3B [Source:NCBI gene;Acc:103... [more]
kif3ca1.129e-13359.02kinesin family member 3C [Source:NCBI gene;Acc:103... [more]
kif3cb3.717e-13157.89kinesin-like protein KIF3B [Source:NCBI gene;Acc:1... [more]
kif3cb4.396e-13157.82kinesin-like protein KIF3B [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010617.11.021e-15465.44pep scaffold:Pmarinus_7.0:GL476849:1993:16233:1 ge... [more]
kif3ca6.853e-13758.24kinesin family member 3Ca [Source:ZFIN;Acc:ZDB-GEN... [more]
kif3a1.554e-13158.52kinesin family member 3A [Source:ZFIN;Acc:ZDB-GENE... [more]
kif16bb2.821e-8247.84kinesin family member 16Bb [Source:ZFIN;Acc:ZDB-GE... [more]
kif113.670e-8244.15kinesin family member 11 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
KIP31.537e-6044.52Kinesin-related antiparallel sliding motor protein... [more]
KIP14.978e-6038.01Kinesin-related motor protein; required for mitoti... [more]
KAR31.399e-4635.86Minus-end-directed microtubule motor; functions in... [more]
CIN86.094e-4550.26Kinesin motor protein; involved in mitotic spindle... [more]
KIP27.356e-3834.21Kinesin-related motor protein involved in mitotic ... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO375290.000e+071.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO396101.115e-14961.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO408365.286e-13160.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470756.699e-9954.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337409.193e-8945.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif3b1.528e-13760.00kinesin family member 3B [Source:NCBI gene;Acc:101... [more]
kif3b1.528e-13760.00kinesin family member 3B [Source:NCBI gene;Acc:101... [more]
ENSORLT00000022071.23.187e-12858.15kinesin-like protein KIF3C [Source:NCBI gene;Acc:1... [more]
ENSORLT00000040869.13.187e-12858.15kinesin-like protein KIF3C [Source:NCBI gene;Acc:1... [more]
kif3a1.387e-12757.22kinesin-like protein KIF3A [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Kinesin-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000035453.10.000e+099.39SMESG000035453.1[more]
SMESG000035453.10.000e+098.08SMESG000035453.1[more]
SMESG000035453.10.000e+097.45SMESG000035453.1[more]
SMESG000020245.11.614e-12557.71SMESG000020245.1[more]
SMESG000075065.12.740e-11956.51SMESG000075065.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011238 ID=SMED30011238|Name=Kinesin-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2560bp
ATATAAATCTTATATGATAATTAATGAGTGGTGAAGCTGTTAAAGTAATT
GTAAGAGTAAGACCATTAAATGAACGAGAAATTAATCTAAATTGCAAAAA
TATTATTGATATTGACGTAAGTCGCGGACAATGTTCAATCAGAAATCCAA
ATGATAACAAAACTCCACAAAAACCATTTTTCTTTGATGGTTCATATAAT
ATTGATTCAACAACTGAGCAATTGTATTCGGATATAGTTTATCCTCTTGT
GGAAAACGTGACAGAGGGTTACAATGGAACTATATTTGCATACGGTCAAA
CCGGGTGTGGGAAATCATTCACAATGCAAGGAATCGTTAATCCATCAACT
CAAAGAGGTGTTATTCCGAGGGCATTTGATCATGTATTCGAAACGATATC
GTTAGCGGAAAATTCCAAATACTTAGTTCATGCCTCATATCTCGAAATCT
ACAATGAAGAAATTCGAGATTTACTCGCAAAAGACGTGAAGGCAAAACTT
GATCTCAAAGAACATCCAGAAAAGGGCGTCTATGTTTCAGGATTGTCAAT
GCATAAAGTGTCGAATGTCAGAGATTGTCAGGTAGTAATGGAAAGAGGTT
GGAAAAATCGAGCTACTGGATCAACTTTGATGAATGTTGATAGTTCTCGT
TCTCATTCTATTTTCACTATTTATCTGGAAATGTTTAATACCGATGAAAA
TGAGGAAAATCATATAAAAGCCGGCAAGTTAAACCTAGTCGATTTAGCCG
GGTCAGAAAGGCAGTCTAAAACTGGCGCAACTGGAGATCGGTTGAAGGAA
GCTACAAAGATTAATCTCAGTTTGTCTGCACTGGGTAATGTCATTTCAGC
TCTTGTTGATGGTAAAAGCAAGCATATTCCGTACAGAGATAGTAAACTGA
CAAGAATGCTTCAAGACTCCTTGGGTGGTAACACAAAGACCCTTATGATA
GCCTGTCTGAGCCCAGCAGACAACAATTACGAAGAAACGTTAAGCACCTT
ACGCTATGCTAATAGAGCAAAGAATATTCAGAACAAACCAAAAATTAACG
AAGATCCTAAAGACGCATTGTTGAGGGAATTCCAAAATGAAATAAATCGT
TTGAAACAGATGCTAGCTGGGCAGATTCCTATAAATATGGATGCTGTCAG
TACTGCCAAACCGACAGATAGTTCTGAAAAACACAGATTGACAGAAATAG
AACGGGAGAAAATAAAAGCTGAATACGAAGCTAAGTTGTTGGAAAAAGAA
GCGCAGTATTCGGCGGAAGCAGCCGATAAAGCTAAATTAAAAAGTGATAT
GGAAAAATTAAAGCAATATTACGATGAAAAATTAATGCAATTGGATATCA
GAGATATTCCTAATTCTGATGAAGTTCTTAGATTATTTGAACCAAAAATA
TTCACTTCATCTTCAAATAGCGGGCCACAGCCTATTGGTCAATTTGAGAA
AGACCTTGGAAATCCGAACTTATACGATTTGAACCTGGCAGATACATCAG
TTGTCATTGTAAATCCTGAAGGCAATTATGCCCCAGATATTGAACCCCAG
CGAGCAGTTCACGTGCGAACTGTGCCCAAGCAAGAAGTTTTAATTCACGA
TAAAAATGAATTGTTGAGCAAGCTTCAATATTTACAATCGACCATGGTTG
GTGGTGAGCAGATCAATAATGAGGTCGCCAAAGATCGGCATTCAAAGCGA
AAGCGTCATGCAGAAGAAAAAAAGAGAAGATTAATGGACTCGAATGAGAG
AATGGAAGATGATGGAATAATGCTTGGAGTTTTTGAGGACATTCAAGATG
AATTAAGAGTAAAGTCAAAGCTTTTGCAGAAAGAAAAAAATAAAAATTTG
AGTCTGATTCAAGAAATGTCCGATATTAATGAAGAATTCCACAAAGAAAG
ATGCGATTATTTAGAGTCGATTCGAAAATTGGATCGTGAGAATAAACTGT
TACAAATGATGATGGAAAAGATTCAGCCATGCATTAAAAAGAGTTGCAAT
TATTCGAATTTCGATAAAATCAAATCCCAAGCCAAATTTGATGAAGAGTC
TGGCAAATGGATTTTGCCTCAATTGAAACTCGAAGACACTCAACTGCCGA
ATGCCGATGAGAAGATACGAGATAACGTCGACGAGAATTATTATCGGAAA
TTGGCACGTAAACCCGATCCGAGTCAAGAGTATTTCCAAAACCGGAAATC
CGGTCAGTTATTGAATCAAAGAAATTCCCCCAACAATATCAGTAACAGTC
AATATAACAGCCAATTGGGATACGTGTCAGTGAATAACTCCAACCTTCAA
AAACTCAGCGACCATCAATACGAAGCTAATAGTTATTCCAATGATTTCCG
AGCAGCAGAAGTCCATGGGCAGTTTCAACTTAATCCCGATGTTCCAACTC
GTCGTGGGGCTTATAGATTGGATGCTATTCAAACGGTTACTAAACCGCGG
AAGAAGTCCAGCAAATACACGCCCGATAATTCAATGAATGATTTTTAATT
TTTAGTCGGTAAATTTAAATATCCAATTGTCTATTAGTAAATCTTGTCTT
TCAAAAAAAA
back to top

protein sequence of SMED30011238-orf-1

>SMED30011238-orf-1 ID=SMED30011238-orf-1|Name=SMED30011238-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=825bp
MSGEAVKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDNKTPQK
PFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFT
MQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRDL
LAKDVKAKLDLKEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGS
TLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKT
GATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSL
GGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALL
REFQNEINRLKQMLAGQIPINMDAVSTAKPTDSSEKHRLTEIEREKIKAE
YEAKLLEKEAQYSAEAADKAKLKSDMEKLKQYYDEKLMQLDIRDIPNSDE
VLRLFEPKIFTSSSNSGPQPIGQFEKDLGNPNLYDLNLADTSVVIVNPEG
NYAPDIEPQRAVHVRTVPKQEVLIHDKNELLSKLQYLQSTMVGGEQINNE
VAKDRHSKRKRHAEEKKRRLMDSNERMEDDGIMLGVFEDIQDELRVKSKL
LQKEKNKNLSLIQEMSDINEEFHKERCDYLESIRKLDRENKLLQMMMEKI
QPCIKKSCNYSNFDKIKSQAKFDEESGKWILPQLKLEDTQLPNADEKIRD
NVDENYYRKLARKPDPSQEYFQNRKSGQLLNQRNSPNNISNSQYNSQLGY
VSVNNSNLQKLSDHQYEANSYSNDFRAAEVHGQFQLNPDVPTRRGAYRLD
AIQTVTKPRKKSSKYTPDNSMNDF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR036961Kinesin_motor_dom_sf
IPR027640Kinesin-like_fam
IPR001275DM_DNA-bd
IPR001752Kinesin_motor_dom
IPR019821Kinesin_motor_CS
IPR027417P-loop_NTPase
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0007018microtubule-based movement
Vocabulary: molecular function
TermDefinition
GO:0043565sequence-specific DNA binding
GO:0008017microtubule binding
GO:0005524ATP binding
GO:0003777microtubule motor activity
GO:0000166nucleotide binding
GO:0003774motor activity
Vocabulary: cellular component
TermDefinition
GO:0005874microtubule
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 600..620
NoneNo IPR availableCOILSCoilCoilcoord: 552..579
NoneNo IPR availableCOILSCoilCoilcoord: 389..409
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 804..823
NoneNo IPR availablePANTHERPTHR24115:SF744KINESIN-LIKE PROTEIN KIF3Bcoord: 3..390
IPR001752Kinesin motor domainPRINTSPR00380KINESINHEAVYcoord: 235..253
score: 67.63
coord: 285..306
score: 69.73
coord: 201..218
score: 58.1
coord: 82..103
score: 71.06
IPR001752Kinesin motor domainSMARTSM00129kinesin_4coord: 3..343
e-value: 1.8E-180
score: 615.5
IPR001752Kinesin motor domainPFAMPF00225Kinesincoord: 11..335
e-value: 3.6E-118
score: 394.3
IPR001752Kinesin motor domainPROSITEPS50067KINESIN_MOTOR_2coord: 5..335
score: 123.056
IPR036961Kinesin motor domain superfamilyGENE3DG3DSA:3.40.850.10coord: 4..354
e-value: 8.5E-153
score: 510.2
IPR027640Kinesin-like proteinPANTHERPTHR24115FAMILY NOT NAMEDcoord: 3..390
IPR019821Kinesin motor domain, conserved sitePROSITEPS00411KINESIN_MOTOR_1coord: 234..245
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 6..365