SMED30011233

Overview
NameSMED30011233
Smed IDSMED30011233
Length (bp)335
Neoblast Clusters

Zeng et. al., 2018



▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)



Explore this single cell expression dataset with our NB Cluster Shiny App



 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30011233 (SMED30011233) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30011233 (SMED30011233) in cells (dots) of each of the 12 neoblast clusters.

 

back to top

 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30011233 (SMED30011233) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30011233 (SMED30011233) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top

 

Embryonic Expression

Davies et. al., 2017

Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020



SMED30011233

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
prepharyngeal regionSMED30011233 SmedASXL_018650SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016		whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30011233 SmedASXL_018650SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016		whole organism asexual adult RNA-sequencing evidence
head regionSMED30011233 OX_Smed_1.0.09525ox_Smed_v2PMID:24238224
Kao et al., 2013		whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30011233 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.005958:287..643 +1495
v31.018020:4081..4437 -1486
Homology
[Close]
BLAST of SMED30011233 vs. TrEMBL
Match: B1NTA3 (TCEN protein OS=Schmidtea mediterranea OX=79327 GN=tcen PE=2 SV=1)

HSP 1 Score: 50.8322 bits (120), Expect = 4.656e-6
Identity = 24/54 (44.44%), Postives = 34/54 (62.96%), Query Frame = 2 
Query:   20 MLKFALLFVVLIAFVQEGSSFVFGSISCVVESVKCAKKCGKVNMECAQQCLQVF 181
            M K AL  VV +A ++EG S  F SI C+ +S  CAK C K+N +C  +C +V+
Sbjct:    1 MFKLALFLVVFVAVIEEGYSLNFKSIQCLAKSASCAKDCPKLNSDCFVKCGEVY 54
[Close]
BLAST of SMED30011233 vs. Planmine SMEST
Match: SMESG000030595.1 (SMESG000030595.1)

HSP 1 Score: 117.087 bits (292), Expect = 3.155e-35
Identity = 71/78 (91.03%), Postives = 74/78 (94.87%), Query Frame = 2 
Query:   11 LSIMLKFALLFVVLIAFVQEGSSFVFGSISCVVESVKCAKKCGKVNMECAQQCLQVFXXXXXXXXXXXEVTEAPTETI 244
            ++   +FALLFVVLIAFVQEGSSFVFGSISCVVESVKCAKKC KVNMECAQQCLQVFKDCKDKKKANKEVTEAPTETI
Sbjct:   32 INYNFQFALLFVVLIAFVQEGSSFVFGSISCVVESVKCAKKCSKVNMECAQQCLQVFKDCKDKKKANKEVTEAPTETI 109
[Close]
BLAST of SMED30011233 vs. Planmine SMEST
Match: SMESG000030594.1 (SMESG000030594.1)

HSP 1 Score: 46.9802 bits (110), Expect = 4.004e-7
Identity = 22/47 (46.81%), Postives = 29/47 (61.70%), Query Frame = 2 
Query:   32 ALLFVVLIAFVQEGSSFVFGSISCVVESVKCAKKCGKVNMECAQQCL 172
             L  VV +A + E SS +FGSISC V++  CAKKC  ++  C   CL
Sbjct:  228 GLFIVVFVAVINESSSLLFGSISCFVDAGTCAKKCPSLDFACDGACL 274
The following BLAST results are available for this feature:
BLAST of SMED30011233 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011233 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011233 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011233 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011233 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011233 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011233 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011233 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 1
Match NameE-valueIdentityDescription
B1NTA34.656e-644.44TCEN protein OS=Schmidtea mediterranea OX=79327 GN... [more]
back to top
BLAST of SMED30011233 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011233 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011233 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011233 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011233 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011233 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000030595.13.155e-3591.03SMESG000030595.1[more]
SMESG000030594.14.004e-746.81SMESG000030594.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011233 ID=SMED30011233|Name=SMED30011233|organism=Schmidtea mediterranea sexual|type=transcript|length=335bp
GTTGACAATTCTATCAATCATGTTAAAATTTGCCTTACTGTTCGTTGTCT
TGATCGCTTTCGTGCAAGAGGGATCCTCATTTGTCTTTGGCAGCATCTCA
TGTGTCGTTGAATCTGTGAAATGTGCAAAGAAATGCGGCAAAGTCAACAT
GGAATGTGCTCAACAATGCTTGCAAGTATTCAAAGACTGTAAAGATAAGA
AAAAGGCCAATAAAGAAGTCACTGAAGCACCAACAGAAACGATATAAAGA
GATATTATTATAAATTTTCACAATTTAAATAATCAAATTATAGTTAATAT
TCAAAAAAAAAAAAAAGGCCAATAAAGAAGTCACT
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..26
score: 0.892
NoneNo IPR availableTMHMMTMhelixcoord: 10..32