slc1a-2

Overview
Nameslc1a-2 (AKN21392.1)
Smed IDSMED30011216
Length (bp)2079
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc1a-2 (SMED30011216) t-SNE clustered cells

Violin plots show distribution of expression levels for slc1a-2 (SMED30011216) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc1a-2 (SMED30011216) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc1a-2 (SMED30011216) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011216

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30011216SMESG000022787.1 SmedASXL_001183SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30011216SMESG000022787.1 dd_Smed_v4_7570_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30011216SMESG000022787.1 dd_Smed_v4_7570_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30011216SMESG000022787.1 dd_Smed_v6_7570_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30011216SMESG000022787.1 OX_Smed_1.0.14848ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
enteric muscle cellSMED30011216SMESG000022787.1 dd_Smed_v4_7570_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc1a-2 vs. Ensembl Human
Match: SLC1A2 (solute carrier family 1 member 2 [Source:HGNC Symbol;Acc:HGNC:10940])

HSP 1 Score: 437.573 bits (1124), Expect = 1.590e-145
Identity = 256/442 (57.92%), Postives = 334/442 (75.57%), Query Frame = 1
Query:  358 VMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISS------------KYVNKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAE 1647
            VMLI+FPG++LM MLKMLI+PLI+SSLI+GL+GLD K+SG++G  A++YY STT++A VLG+ILV+ IHPGN  +KKQLG G  K    S+LD+FLDL+RN+FP N++QA  QQI +            +  N T AV   +       N+T   +   + +  +    E  D  NVLG++ F + FG+ + +MG++A +MV FF +LNE+VMK+V +IMWYSP+GI  L+ GK++ I+ LE  A  LGMYM+TVI GL IH    L LIY V+ RK+P  FF GIFQAWITALGTASSA TLP+TFRCLEE +GIDKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+N   L+  QI TVS+TATLA++GAAS+PSAGLVTM+++LT+VGLPT+DISL++ VDWLLDR+RTS+NV+GD++GA +V+HL K  LD  D++
Sbjct:   75 VMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRAMVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPG-KKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLL-------NETVTEVPEETKMVIK-KGLEFKDGMNVLGLIGFFIAFGIAMGKMGDQAKLMVDFFNILNEIVMKLVIMIMWYSPLGIACLICGKIIAIKDLEVVARQLGMYMVTVIIGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVVLDGGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQ 507          
BLAST of slc1a-2 vs. Ensembl Human
Match: SLC1A2 (solute carrier family 1 member 2 [Source:HGNC Symbol;Acc:HGNC:10940])

HSP 1 Score: 437.187 bits (1123), Expect = 1.830e-145
Identity = 256/442 (57.92%), Postives = 334/442 (75.57%), Query Frame = 1
Query:  358 VMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISS------------KYVNKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAE 1647
            VMLI+FPG++LM MLKMLI+PLI+SSLI+GL+GLD K+SG++G  A++YY STT++A VLG+ILV+ IHPGN  +KKQLG G  K    S+LD+FLDL+RN+FP N++QA  QQI +            +  N T AV   +       N+T   +   + +  +    E  D  NVLG++ F + FG+ + +MG++A +MV FF +LNE+VMK+V +IMWYSP+GI  L+ GK++ I+ LE  A  LGMYM+TVI GL IH    L LIY V+ RK+P  FF GIFQAWITALGTASSA TLP+TFRCLEE +GIDKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+N   L+  QI TVS+TATLA++GAAS+PSAGLVTM+++LT+VGLPT+DISL++ VDWLLDR+RTS+NV+GD++GA +V+HL K  LD  D++
Sbjct:   66 VMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRAMVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPG-KKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLL-------NETVTEVPEETKMVIK-KGLEFKDGMNVLGLIGFFIAFGIAMGKMGDQAKLMVDFFNILNEIVMKLVIMIMWYSPLGIACLICGKIIAIKDLEVVARQLGMYMVTVIIGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVVLDGGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQ 498          
BLAST of slc1a-2 vs. Ensembl Human
Match: SLC1A2 (solute carrier family 1 member 2 [Source:HGNC Symbol;Acc:HGNC:10940])

HSP 1 Score: 437.187 bits (1123), Expect = 1.830e-145
Identity = 256/442 (57.92%), Postives = 334/442 (75.57%), Query Frame = 1
Query:  358 VMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISS------------KYVNKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAE 1647
            VMLI+FPG++LM MLKMLI+PLI+SSLI+GL+GLD K+SG++G  A++YY STT++A VLG+ILV+ IHPGN  +KKQLG G  K    S+LD+FLDL+RN+FP N++QA  QQI +            +  N T AV   +       N+T   +   + +  +    E  D  NVLG++ F + FG+ + +MG++A +MV FF +LNE+VMK+V +IMWYSP+GI  L+ GK++ I+ LE  A  LGMYM+TVI GL IH    L LIY V+ RK+P  FF GIFQAWITALGTASSA TLP+TFRCLEE +GIDKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+N   L+  QI TVS+TATLA++GAAS+PSAGLVTM+++LT+VGLPT+DISL++ VDWLLDR+RTS+NV+GD++GA +V+HL K  LD  D++
Sbjct:   66 VMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRAMVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPG-KKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLL-------NETVTEVPEETKMVIK-KGLEFKDGMNVLGLIGFFIAFGIAMGKMGDQAKLMVDFFNILNEIVMKLVIMIMWYSPLGIACLICGKIIAIKDLEVVARQLGMYMVTVIIGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVVLDGGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQ 498          
BLAST of slc1a-2 vs. Ensembl Human
Match: SLC1A2 (solute carrier family 1 member 2 [Source:HGNC Symbol;Acc:HGNC:10940])

HSP 1 Score: 437.187 bits (1123), Expect = 1.830e-145
Identity = 256/442 (57.92%), Postives = 334/442 (75.57%), Query Frame = 1
Query:  358 VMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISS------------KYVNKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAE 1647
            VMLI+FPG++LM MLKMLI+PLI+SSLI+GL+GLD K+SG++G  A++YY STT++A VLG+ILV+ IHPGN  +KKQLG G  K    S+LD+FLDL+RN+FP N++QA  QQI +            +  N T AV   +       N+T   +   + +  +    E  D  NVLG++ F + FG+ + +MG++A +MV FF +LNE+VMK+V +IMWYSP+GI  L+ GK++ I+ LE  A  LGMYM+TVI GL IH    L LIY V+ RK+P  FF GIFQAWITALGTASSA TLP+TFRCLEE +GIDKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+N   L+  QI TVS+TATLA++GAAS+PSAGLVTM+++LT+VGLPT+DISL++ VDWLLDR+RTS+NV+GD++GA +V+HL K  LD  D++
Sbjct:   66 VMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRAMVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPG-KKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLL-------NETVTEVPEETKMVIK-KGLEFKDGMNVLGLIGFFIAFGIAMGKMGDQAKLMVDFFNILNEIVMKLVIMIMWYSPLGIACLICGKIIAIKDLEVVARQLGMYMVTVIIGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVVLDGGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQ 498          
BLAST of slc1a-2 vs. Ensembl Human
Match: SLC1A2 (solute carrier family 1 member 2 [Source:HGNC Symbol;Acc:HGNC:10940])

HSP 1 Score: 437.187 bits (1123), Expect = 1.830e-145
Identity = 256/442 (57.92%), Postives = 334/442 (75.57%), Query Frame = 1
Query:  358 VMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISS------------KYVNKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAE 1647
            VMLI+FPG++LM MLKMLI+PLI+SSLI+GL+GLD K+SG++G  A++YY STT++A VLG+ILV+ IHPGN  +KKQLG G  K    S+LD+FLDL+RN+FP N++QA  QQI +            +  N T AV   +       N+T   +   + +  +    E  D  NVLG++ F + FG+ + +MG++A +MV FF +LNE+VMK+V +IMWYSP+GI  L+ GK++ I+ LE  A  LGMYM+TVI GL IH    L LIY V+ RK+P  FF GIFQAWITALGTASSA TLP+TFRCLEE +GIDKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+N   L+  QI TVS+TATLA++GAAS+PSAGLVTM+++LT+VGLPT+DISL++ VDWLLDR+RTS+NV+GD++GA +V+HL K  LD  D++
Sbjct:   66 VMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRAMVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPG-KKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLL-------NETVTEVPEETKMVIK-KGLEFKDGMNVLGLIGFFIAFGIAMGKMGDQAKLMVDFFNILNEIVMKLVIMIMWYSPLGIACLICGKIIAIKDLEVVARQLGMYMVTVIIGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVVLDGGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQ 498          
BLAST of slc1a-2 vs. Ensembl Celegans
Match: glt-1 (Excitatory amino acid transporter [Source:UniProtKB/Swiss-Prot;Acc:Q10901])

HSP 1 Score: 448.358 bits (1152), Expect = 2.929e-151
Identity = 251/444 (56.53%), Postives = 333/444 (75.00%), Query Frame = 1
Query:  358 VMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAEILKEAANYLEKTDE 1689
            +M ISFPGELLM+MLKM+I+PLI+SSLISGLA LD + SG++G  A+ YY  TT +AVV GI LV++IHPG+  IKK++G GT  +   ST+D+ LDLLRN+FP N++QA  QQ+ +KY+     V  +++K+    +  T     N ++ Y   + E T   NVLG++ F +  G+ LSQ+G++A +MVQFF ++++V+MK+V  +MWYSP GIF L++GK+L+I  L +TA  L MYM+TV++GL IH+  +L LI+ V  +K+P  F +G+FQAWITALGTASS+ATLPITF CLEE +G+D+RVTRFVLP+GATINMDGTALYEAVA+IFIAQIN   L   Q+ TVS+TATLA+IGAASVPSAGLVTM++VLT+VGLP  D+SLI+ VDWLLDR+RTSINVLGDA GA +V+H  K  LD  D       ++ +   DE
Sbjct:   38 IMYISFPGELLMHMLKMMILPLIMSSLISGLAQLDARQSGKLGSLAVTYYMFTTAVAVVTGIFLVLVIHPGDPTIKKEIGTGTEGKTV-STVDTLLDLLRNMFPENVVQATFQQVQTKYIK----VRPKVVKN---NDSATLAALNNGSLDYVKASVEYTSGMNVLGVIVFCIAIGISLSQLGQEAHVMVQFFVIMDKVIMKLVMTVMWYSPFGIFCLIMGKILEIHDLADTARMLAMYMVTVLSGLAIHSLISLPLIFFVTTKKNPYVFMRGLFQAWITALGTASSSATLPITFNCLEENLGVDRRVTRFVLPVGATINMDGTALYEAVAAIFIAQINGVHLSFGQVVTVSLTATLASIGAASVPSAGLVTMLLVLTAVGLPVKDVSLIVAVDWLLDRIRTSINVLGDAMGAGIVYHYSKADLDAHDRLAATTRSHSIAMNDE 473          
BLAST of slc1a-2 vs. Ensembl Celegans
Match: glt-1 (Excitatory amino acid transporter [Source:UniProtKB/Swiss-Prot;Acc:Q10901])

HSP 1 Score: 447.588 bits (1150), Expect = 7.980e-151
Identity = 251/444 (56.53%), Postives = 333/444 (75.00%), Query Frame = 1
Query:  358 VMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAEILKEAANYLEKTDE 1689
            +M ISFPGELLM+MLKM+I+PLI+SSLISGLA LD + SG++G  A+ YY  TT +AVV GI LV++IHPG+  IKK++G GT  +   ST+D+ LDLLRN+FP N++QA  QQ+ +KY+     V  +++K+    +  T     N ++ Y   + E T   NVLG++ F +  G+ LSQ+G++A +MVQFF ++++V+MK+V  +MWYSP GIF L++GK+L+I  L +TA  L MYM+TV++GL IH+  +L LI+ V  +K+P  F +G+FQAWITALGTASS+ATLPITF CLEE +G+D+RVTRFVLP+GATINMDGTALYEAVA+IFIAQIN   L   Q+ TVS+TATLA+IGAASVPSAGLVTM++VLT+VGLP  D+SLI+ VDWLLDR+RTSINVLGDA GA +V+H  K  LD  D       ++ +   DE
Sbjct:   49 IMYISFPGELLMHMLKMMILPLIMSSLISGLAQLDARQSGKLGSLAVTYYMFTTAVAVVTGIFLVLVIHPGDPTIKKEIGTGTEGKTV-STVDTLLDLLRNMFPENVVQATFQQVQTKYIK----VRPKVVKN---NDSATLAALNNGSLDYVKASVEYTSGMNVLGVIVFCIAIGISLSQLGQEAHVMVQFFVIMDKVIMKLVMTVMWYSPFGIFCLIMGKILEIHDLADTARMLAMYMVTVLSGLAIHSLISLPLIFFVTTKKNPYVFMRGLFQAWITALGTASSSATLPITFNCLEENLGVDRRVTRFVLPVGATINMDGTALYEAVAAIFIAQINGVHLSFGQVVTVSLTATLASIGAASVPSAGLVTMLLVLTAVGLPVKDVSLIVAVDWLLDRIRTSINVLGDAMGAGIVYHYSKADLDAHDRLAATTRSHSIAMNDE 484          
BLAST of slc1a-2 vs. Ensembl Celegans
Match: glt-3 (Putative sodium-dependent excitatory amino acid transporter glt-3 [Source:UniProtKB/Swiss-Prot;Acc:Q21353])

HSP 1 Score: 371.703 bits (953), Expect = 5.562e-121
Identity = 219/430 (50.93%), Postives = 309/430 (71.86%), Query Frame = 1
Query:  358 VMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAE 1647
            + LI FPGE+ M +++M+I+PLI+SS+IS LA +  + + +IG   +IYY  TT +A   GIILV  IHPG+ ++  +LG+GT +  A STLD+FLD +RN+FP NIIQA  QQ+ ++Y+     +    +++  S N T+E L    T+TY       T+  NVLG++ F   FG++LS +G++A +M+ FF +L+ ++M+ +  +MW  PIGI SLV   ++ I++L ETA AL MY++TVI GL IH+  TL L+Y ++ +KSP  F  G+ QA  TA GTASS ATLP+TFR LEE + ID+RVTRFVLP+GATI MDGTALYEAVA IFIAQ++  KL  + + T+SIT T+A+IG+ SVP AGL T+++VLT+VGLP  D+SL+LTVDWLLDR+RTS+NVLGD++GA ++HHL + +L E D +
Sbjct:   36 ISLIGFPGEIFMQIVEMMILPLIMSSVISALAQVRARDARRIGIVTIIYYMITTFLATFTGIILVSSIHPGDPELIHELGEGTLENTALSTLDTFLDQIRNMFPENIIQATFQQVQTEYM----PIKPSRVRNATSMNMTSEVLH-KQTLTY-------TNEMNVLGLIVFCSGFGIILSILGDQARLMINFFIVLDAIIMRWISALMWCYPIGILSLVCKNIIDIDNLTETAQALAMYVVTVICGLMIHSLLTLPLLYFLVTKKSPFAFMTGMLQALATAFGTASSGATLPVTFRALEENLKIDRRVTRFVLPLGATITMDGTALYEAVAVIFIAQLHNIKLSLMDLVTISITTTVASIGSGSVP-AGLDTIVIVLTTVGLPAKDLSLLLTVDWLLDRIRTSVNVLGDSFGAGIIHHLTRSSLLEADTD 452          
BLAST of slc1a-2 vs. Ensembl Celegans
Match: glt-5 (Amino acid transporter [Source:UniProtKB/TrEMBL;Acc:O18210])

HSP 1 Score: 366.696 bits (940), Expect = 1.435e-119
Identity = 225/434 (51.84%), Postives = 296/434 (68.20%), Query Frame = 1
Query:  367 ISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAP-STLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAEILKEAA 1665
            + FPGEL MNMLK +++PLI +S++SGL+ LD K+SG++G  A++YY  TT  AV+LGII+V +I PG+  IK+++G       A  S    FLDL RN FP NI++A   Q+ + Y+N+T +                      +  T+EV  T   D  NVLGI+ F +  GLV+S++GE+A  +   F  L+ V+ +MV +IMW  PIGI SL+  K+L++  L  TA  LG+++ TVI GL I A  TL LIY +  R +P  F KG+ QA +TALGT+SSAA+LP+TFRCL  K+GID RVT+FVLP+GA +NMDGTALYEA ASIFIAQ+N  +L   QI TVSITATLA+IGAAS+PSAGLVTM++VLT++GLP +DISLIL VDW LDRLRTS+NV+GDA G   VHH+C   L+   AE  K  A
Sbjct:   52 VGFPGELFMNMLKAMVLPLIAASIVSGLSQLDGKTSGRLGSRAVMYYAITTTHAVILGIIVVSIIQPGDPTIKQKMGYDKEGEAANVSAAQKFLDLFRNAFPENIMRATFSQVQTNYINQTHS----------------------NGATHEVLHTGYVDGMNVLGIIVFCIVMGLVVSRIGEEAKALANLFHALDVVITRMVMLIMWLGPIGIPSLIAQKMLEVSDLWLTARMLGLFVFTVILGLAIQAFITLPLIYFIGTRHNPYTFLKGLGQAIMTALGTSSSAASLPVTFRCLN-KLGIDPRVTKFVLPVGAMVNMDGTALYEATASIFIAQMNGLELSIGQIVTVSITATLASIGAASIPSAGLVTMLIVLTALGLPANDISLILAVDWFLDRLRTSVNVIGDALGCGFVHHICADHLNADVAEAEKNHA 462          
BLAST of slc1a-2 vs. Ensembl Celegans
Match: glt-6 (Putative sodium-dependent excitatory amino acid transporter glt-6 [Source:UniProtKB/Swiss-Prot;Acc:Q21751])

HSP 1 Score: 365.925 bits (938), Expect = 1.356e-118
Identity = 214/451 (47.45%), Postives = 309/451 (68.51%), Query Frame = 1
Query:  364 LISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPS-----TLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDA------------EILKEAA 1665
            LI+FPGE+ M +LKM+I+PLI SSLIS LA +D K SGQ+G   ++YY ST ++A +LGI LV +IHPG+  IK     GT+   APS      LD+FLDL+RN+FP NIIQA  +++ + YV     +         S+N T+  +    +I        +T   N+LGI+ F   FG+V+SQ+GE+A I+V FF +L+ V+M+ V  +MW++P+GI  L+ G +L+++ + + A+ L +Y+ TV  GL +H   T+ L+Y  I R++P+  FKG+ QA +TA GTAS  ATLP++ +CLE+  G+D+R++RFVLP+G+TINMDG ALYEAVA IFIAQ+N  +L   ++ TVSITAT+A+IG  SVP AGLV+++++L +VGLP  D+S++ TVDWLLDR+RT++NVLGDA+ A++V HL +K LD+ DA            E+LK AA
Sbjct:   48 LINFPGEIFMQVLKMMILPLIFSSLISALAQMDAKESGQMGASTVLYYLSTAVLATILGIFLVTVIHPGDPSIK-----GTDISEAPSDGNVSPLDTFLDLVRNMFPENIIQATFERMQTTYVAIRPKIA--------SKNGTSGNIIVKRSI-------GMTKGMNILGIIVFCTGFGIVISQLGERARIVVDFFVILDAVIMRWVVTLMWFAPLGITCLICGNLLELDDISDIASVLALYVFTVCAGLILHTIITVPLMYFFITRENPLPIFKGMIQAAVTAFGTASGGATLPMSMQCLEDHCGVDRRISRFVLPLGSTINMDGNALYEAVAVIFIAQLNNVQLSLAEVLTVSITATIASIGLGSVP-AGLVSILLILNTVGLPVRDVSMLFTVDWLLDRVRTAVNVLGDAFAASMVQHLLQKKLDQADARHDYKTELKGEIELLKSAA 477          
BLAST of slc1a-2 vs. Ensembl Fly
Match: Eaat2 (gene:FBgn0026438 transcript:FBtr0078043)

HSP 1 Score: 297.36 bits (760), Expect = 7.722e-92
Identity = 199/436 (45.64%), Postives = 290/436 (66.51%), Query Frame = 1
Query:  355 AVMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKTK--AVTDRMLKDMLSQ----NKTTEGLTTNSTITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDA 1644
            ++MLIS+PGEL M +LK++I+PL++SSLI+G A L+ K +G+I    L+Y+ ST+     LGI LV+LIHPGN D+     + T+ RRA + LDS LDL RN+FP N+ QA++QQ  + Y+ K     V +  + D L+      + +E LT +  +  ++   +    TN LGIV F + FG  L  +G+K  ++V FFA + EV+MKMV  +MW +P+GI S++ GK+L +  L    + L  +++TV  G+FI+    +  IY V+ R++P  F+ G+ QA +TA  TAS+AA LPITFRC+ EK+ +D R+TRFVLPIG  INMDGTALY AVASIFIAQ++   L   ++ TV +T+T A++ +ASVPSA LV +++VLT++  P  D++L+  VDW +DR+RT+ N+LGD Y AAVV  L +K L   DA
Sbjct:   62 SIMLISYPGELFMRVLKLMILPLVISSLIAGSASLNAKMNGKIALRTLVYFASTSFFNAALGIALVLLIHPGNPDLHNADDRSTD-RRAVNLLDSLLDLGRNVFPDNLFQASIQQAHTVYLPKPSILHVFNETMNDTLASGSEAQRLSEDLTEDVVLVRDI---QYRSGTNTLGIVFFCLVFGTFLGTIGQKGQVVVDFFAAIFEVIMKMVTCVMWLTPVGISSVIAGKILSVGDLGLVMSQLMWFIVTVAIGVFIYQFVVMQAIYFVVVRRNPFKFYAGLIQAMLTAFATASTAAALPITFRCMNEKLKVDPRITRFVLPIGCNINMDGTALYIAVASIFIAQMSGMVLGFGELLTVLLTSTAASMSSASVPSAALVLLLVVLTAIDAPVQDVTLLFAVDWFVDRIRTTNNMLGDCYTAAVVEELSRKELMALDA 493          
BLAST of slc1a-2 vs. Ensembl Fly
Match: Eaat2 (gene:FBgn0026438 transcript:FBtr0301317)

HSP 1 Score: 297.36 bits (760), Expect = 7.722e-92
Identity = 199/436 (45.64%), Postives = 290/436 (66.51%), Query Frame = 1
Query:  355 AVMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKTK--AVTDRMLKDMLSQ----NKTTEGLTTNSTITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDA 1644
            ++MLIS+PGEL M +LK++I+PL++SSLI+G A L+ K +G+I    L+Y+ ST+     LGI LV+LIHPGN D+     + T+ RRA + LDS LDL RN+FP N+ QA++QQ  + Y+ K     V +  + D L+      + +E LT +  +  ++   +    TN LGIV F + FG  L  +G+K  ++V FFA + EV+MKMV  +MW +P+GI S++ GK+L +  L    + L  +++TV  G+FI+    +  IY V+ R++P  F+ G+ QA +TA  TAS+AA LPITFRC+ EK+ +D R+TRFVLPIG  INMDGTALY AVASIFIAQ++   L   ++ TV +T+T A++ +ASVPSA LV +++VLT++  P  D++L+  VDW +DR+RT+ N+LGD Y AAVV  L +K L   DA
Sbjct:   62 SIMLISYPGELFMRVLKLMILPLVISSLIAGSASLNAKMNGKIALRTLVYFASTSFFNAALGIALVLLIHPGNPDLHNADDRSTD-RRAVNLLDSLLDLGRNVFPDNLFQASIQQAHTVYLPKPSILHVFNETMNDTLASGSEAQRLSEDLTEDVVLVRDI---QYRSGTNTLGIVFFCLVFGTFLGTIGQKGQVVVDFFAAIFEVIMKMVTCVMWLTPVGISSVIAGKILSVGDLGLVMSQLMWFIVTVAIGVFIYQFVVMQAIYFVVVRRNPFKFYAGLIQAMLTAFATASTAAALPITFRCMNEKLKVDPRITRFVLPIGCNINMDGTALYIAVASIFIAQMSGMVLGFGELLTVLLTSTAASMSSASVPSAALVLLLVVLTAIDAPVQDVTLLFAVDWFVDRIRTTNNMLGDCYTAAVVEELSRKELMALDA 493          
BLAST of slc1a-2 vs. Ensembl Fly
Match: Eaat2 (gene:FBgn0026438 transcript:FBtr0301316)

HSP 1 Score: 297.36 bits (760), Expect = 1.092e-91
Identity = 199/436 (45.64%), Postives = 290/436 (66.51%), Query Frame = 1
Query:  355 AVMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKTK--AVTDRMLKDMLSQ----NKTTEGLTTNSTITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDA 1644
            ++MLIS+PGEL M +LK++I+PL++SSLI+G A L+ K +G+I    L+Y+ ST+     LGI LV+LIHPGN D+     + T+ RRA + LDS LDL RN+FP N+ QA++QQ  + Y+ K     V +  + D L+      + +E LT +  +  ++   +    TN LGIV F + FG  L  +G+K  ++V FFA + EV+MKMV  +MW +P+GI S++ GK+L +  L    + L  +++TV  G+FI+    +  IY V+ R++P  F+ G+ QA +TA  TAS+AA LPITFRC+ EK+ +D R+TRFVLPIG  INMDGTALY AVASIFIAQ++   L   ++ TV +T+T A++ +ASVPSA LV +++VLT++  P  D++L+  VDW +DR+RT+ N+LGD Y AAVV  L +K L   DA
Sbjct:   78 SIMLISYPGELFMRVLKLMILPLVISSLIAGSASLNAKMNGKIALRTLVYFASTSFFNAALGIALVLLIHPGNPDLHNADDRSTD-RRAVNLLDSLLDLGRNVFPDNLFQASIQQAHTVYLPKPSILHVFNETMNDTLASGSEAQRLSEDLTEDVVLVRDI---QYRSGTNTLGIVFFCLVFGTFLGTIGQKGQVVVDFFAAIFEVIMKMVTCVMWLTPVGISSVIAGKILSVGDLGLVMSQLMWFIVTVAIGVFIYQFVVMQAIYFVVVRRNPFKFYAGLIQAMLTAFATASTAAALPITFRCMNEKLKVDPRITRFVLPIGCNINMDGTALYIAVASIFIAQMSGMVLGFGELLTVLLTSTAASMSSASVPSAALVLLLVVLTAIDAPVQDVTLLFAVDWFVDRIRTTNNMLGDCYTAAVVEELSRKELMALDA 509          
BLAST of slc1a-2 vs. Ensembl Fly
Match: Eaat1 (gene:FBgn0026439 transcript:FBtr0079800)

HSP 1 Score: 288.886 bits (738), Expect = 1.159e-89
Identity = 188/435 (43.22%), Postives = 268/435 (61.61%), Query Frame = 1
Query:  340 RYDDYAVMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGN-ADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQD 1641
             +    +M ISFPGE+ + MLK LI+PL+VSS+ S + GLD   S +I   A+ YYF TT+ AV+LGI LV  + PG  A I +   +  +K     T D+ +DL+RN+F  NIIQ+ M Q  ++    T     + +++   ++   EG                   +NVLG+V FS+  G  + +M EK  ++  FF  L+E +M +   ++W SP+G+  L+  K++++ES+  T  +LG Y +TV+ GLF+H   T+ +I+ +  R+ P  +   + Q   TA GT SS+AT+P+T +CL+  +GID RVTRFV+P+GATINMDGTALYEAVA++FIAQ          I  VSITAT A+IGAA +P AGLVTM+MVL +VGL   D+SLI+ VDWLLDR RT+INV+ DA G  +V+HL K  L   D
Sbjct:   44 EWSKREIMYISFPGEIFLRMLKCLIVPLLVSSITSAIGGLDLSMSSKIATRAITYYFVTTISAVILGICLVTTLRPGQGAKIVETQTESIDKASKVLTPDTLMDLVRNMFTDNIIQSTMFQHRTEIYENTSISPAQPMENWEFKSAQREG-------------------SNVLGLVMFSVILGTTIGRMREKGQLLQDFFTTLSEAMMTITSWVIWISPLGVAFLIAAKIIEMESIAATIQSLGWYFITVMIGLFLHGFGTIAVIFFLGTRRLPYRYIAKLSQVLATAFGTGSSSATMPLTIKCLD-NMGIDPRVTRFVIPVGATINMDGTALYEAVAALFIAQYREMSYSFGTIVAVSITATAASIGAAGIPQAGLVTMVMVLDTVGLEPKDVSLIIAVDWLLDRFRTTINVMCDALGTILVNHLSKNDLASVD 458          
BLAST of slc1a-2 vs. Ensembl Fly
Match: Eaat1 (gene:FBgn0026439 transcript:FBtr0079801)

HSP 1 Score: 288.886 bits (738), Expect = 1.159e-89
Identity = 188/435 (43.22%), Postives = 268/435 (61.61%), Query Frame = 1
Query:  340 RYDDYAVMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGN-ADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQD 1641
             +    +M ISFPGE+ + MLK LI+PL+VSS+ S + GLD   S +I   A+ YYF TT+ AV+LGI LV  + PG  A I +   +  +K     T D+ +DL+RN+F  NIIQ+ M Q  ++    T     + +++   ++   EG                   +NVLG+V FS+  G  + +M EK  ++  FF  L+E +M +   ++W SP+G+  L+  K++++ES+  T  +LG Y +TV+ GLF+H   T+ +I+ +  R+ P  +   + Q   TA GT SS+AT+P+T +CL+  +GID RVTRFV+P+GATINMDGTALYEAVA++FIAQ          I  VSITAT A+IGAA +P AGLVTM+MVL +VGL   D+SLI+ VDWLLDR RT+INV+ DA G  +V+HL K  L   D
Sbjct:   44 EWSKREIMYISFPGEIFLRMLKCLIVPLLVSSITSAIGGLDLSMSSKIATRAITYYFVTTISAVILGICLVTTLRPGQGAKIVETQTESIDKASKVLTPDTLMDLVRNMFTDNIIQSTMFQHRTEIYENTSISPAQPMENWEFKSAQREG-------------------SNVLGLVMFSVILGTTIGRMREKGQLLQDFFTTLSEAMMTITSWVIWISPLGVAFLIAAKIIEMESIAATIQSLGWYFITVMIGLFLHGFGTIAVIFFLGTRRLPYRYIAKLSQVLATAFGTGSSSATMPLTIKCLD-NMGIDPRVTRFVIPVGATINMDGTALYEAVAALFIAQYREMSYSFGTIVAVSITATAASIGAAGIPQAGLVTMVMVLDTVGLEPKDVSLIIAVDWLLDRFRTTINVMCDALGTILVNHLSKNDLASVD 458          
BLAST of slc1a-2 vs. Ensembl Zebrafish
Match: slc1a2b (solute carrier family 1 member 2b [Source:ZFIN;Acc:ZDB-GENE-030131-7779])

HSP 1 Score: 456.447 bits (1173), Expect = 9.928e-154
Identity = 261/438 (59.59%), Postives = 332/438 (75.80%), Query Frame = 1
Query:  346 DDYAVMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKTKAVTDRMLKDMLSQNKTTEGLTTNST----ITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAE 1647
            DD  VM+I+FPG++LM MLKMLI+PLI+SSLI+GLAGLD KSSG++G  A+IYY +TT++A VLG+ILV+LIHPGN  +K+ LG+G       S+LD+F DL+RN+FP N++QA  QQI +  V K +   D  L D    N T     +N+T    I  +  + +     NVLG++ F + FG+ + +MGEKA +M+ FF +LNE+VMK+V +IMWYSP GI  L+ GK++ I+ LE  A  LGMYM+TVI GL IH    L  IY  I RK+P  FF GIFQAWITALGTASSA TLP+TFRCLEE +GIDKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+N   L+P QI TVS+TATLA++GAAS+PSAGLVTM+++LT+VGLPT DISL++ VDWLLDR RTS+NV+GD+YGA +V+HL K  LD  DA+
Sbjct:   63 DDNIVMVIAFPGDILMRMLKMLILPLIISSLITGLAGLDAKSSGRLGSRAMIYYMTTTVIAAVLGVILVLLIHPGNPKLKENLGEGLENDEV-SSLDAFFDLIRNLFPENLVQACFQQIQT-VVKKVEVQPD--LDD---TNSTMSEYLSNATKPPPIFKDKKSLQFKSGMNVLGLIGFFIAFGICMGKMGEKARLMIDFFNILNEIVMKLVIMIMWYSPFGIACLICGKIISIKDLEVVARQLGMYMITVIVGLIIHGAIFLPCIYFAIVRKNPFSFFMGIFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGIDLDPGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTQDISLLVAVDWLLDRFRTSVNVVGDSYGAGIVYHLSKAELDALDAQ 493          
BLAST of slc1a-2 vs. Ensembl Zebrafish
Match: slc1a2b (solute carrier family 1 member 2b [Source:ZFIN;Acc:ZDB-GENE-030131-7779])

HSP 1 Score: 456.062 bits (1172), Expect = 4.114e-153
Identity = 261/438 (59.59%), Postives = 332/438 (75.80%), Query Frame = 1
Query:  346 DDYAVMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKTKAVTDRMLKDMLSQNKTTEGLTTNST----ITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAE 1647
            DD  VM+I+FPG++LM MLKMLI+PLI+SSLI+GLAGLD KSSG++G  A+IYY +TT++A VLG+ILV+LIHPGN  +K+ LG+G       S+LD+F DL+RN+FP N++QA  QQI +  V K +   D  L D    N T     +N+T    I  +  + +     NVLG++ F + FG+ + +MGEKA +M+ FF +LNE+VMK+V +IMWYSP GI  L+ GK++ I+ LE  A  LGMYM+TVI GL IH    L  IY  I RK+P  FF GIFQAWITALGTASSA TLP+TFRCLEE +GIDKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+N   L+P QI TVS+TATLA++GAAS+PSAGLVTM+++LT+VGLPT DISL++ VDWLLDR RTS+NV+GD+YGA +V+HL K  LD  DA+
Sbjct:   62 DDNIVMVIAFPGDILMRMLKMLILPLIISSLITGLAGLDAKSSGRLGSRAMIYYMTTTVIAAVLGVILVLLIHPGNPKLKENLGEGLENDEV-SSLDAFFDLIRNLFPENLVQACFQQIQT-VVKKVEVQPD--LDD---TNSTMSEYLSNATKPPPIFKDKKSLQFKSGMNVLGLIGFFIAFGICMGKMGEKARLMIDFFNILNEIVMKLVIMIMWYSPFGIACLICGKIISIKDLEVVARQLGMYMITVIVGLIIHGAIFLPCIYFAIVRKNPFSFFMGIFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGIDLDPGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTQDISLLVAVDWLLDRFRTSVNVVGDSYGAGIVYHLSKAELDALDAQ 492          
BLAST of slc1a-2 vs. Ensembl Zebrafish
Match: slc1a2b (solute carrier family 1 member 2b [Source:ZFIN;Acc:ZDB-GENE-030131-7779])

HSP 1 Score: 456.062 bits (1172), Expect = 4.733e-153
Identity = 261/438 (59.59%), Postives = 332/438 (75.80%), Query Frame = 1
Query:  346 DDYAVMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKTKAVTDRMLKDMLSQNKTTEGLTTNST----ITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAE 1647
            DD  VM+I+FPG++LM MLKMLI+PLI+SSLI+GLAGLD KSSG++G  A+IYY +TT++A VLG+ILV+LIHPGN  +K+ LG+G       S+LD+F DL+RN+FP N++QA  QQI +  V K +   D  L D    N T     +N+T    I  +  + +     NVLG++ F + FG+ + +MGEKA +M+ FF +LNE+VMK+V +IMWYSP GI  L+ GK++ I+ LE  A  LGMYM+TVI GL IH    L  IY  I RK+P  FF GIFQAWITALGTASSA TLP+TFRCLEE +GIDKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+N   L+P QI TVS+TATLA++GAAS+PSAGLVTM+++LT+VGLPT DISL++ VDWLLDR RTS+NV+GD+YGA +V+HL K  LD  DA+
Sbjct:   63 DDNIVMVIAFPGDILMRMLKMLILPLIISSLITGLAGLDAKSSGRLGSRAMIYYMTTTVIAAVLGVILVLLIHPGNPKLKENLGEGLENDEV-SSLDAFFDLIRNLFPENLVQACFQQIQT-VVKKVEVQPD--LDD---TNSTMSEYLSNATKPPPIFKDKKSLQFKSGMNVLGLIGFFIAFGICMGKMGEKARLMIDFFNILNEIVMKLVIMIMWYSPFGIACLICGKIISIKDLEVVARQLGMYMITVIVGLIIHGAIFLPCIYFAIVRKNPFSFFMGIFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGIDLDPGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTQDISLLVAVDWLLDRFRTSVNVVGDSYGAGIVYHLSKAELDALDAQ 493          
BLAST of slc1a-2 vs. Ensembl Zebrafish
Match: slc1a2b (solute carrier family 1 member 2b [Source:ZFIN;Acc:ZDB-GENE-030131-7779])

HSP 1 Score: 455.677 bits (1171), Expect = 7.055e-153
Identity = 261/438 (59.59%), Postives = 332/438 (75.80%), Query Frame = 1
Query:  346 DDYAVMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKTKAVTDRMLKDMLSQNKTTEGLTTNST----ITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAE 1647
            DD  VM+I+FPG++LM MLKMLI+PLI+SSLI+GLAGLD KSSG++G  A+IYY +TT++A VLG+ILV+LIHPGN  +K+ LG+G       S+LD+F DL+RN+FP N++QA  QQI +  V K +   D  L D    N T     +N+T    I  +  + +     NVLG++ F + FG+ + +MGEKA +M+ FF +LNE+VMK+V +IMWYSP GI  L+ GK++ I+ LE  A  LGMYM+TVI GL IH    L  IY  I RK+P  FF GIFQAWITALGTASSA TLP+TFRCLEE +GIDKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+N   L+P QI TVS+TATLA++GAAS+PSAGLVTM+++LT+VGLPT DISL++ VDWLLDR RTS+NV+GD+YGA +V+HL K  LD  DA+
Sbjct:   65 DDNIVMVIAFPGDILMRMLKMLILPLIISSLITGLAGLDAKSSGRLGSRAMIYYMTTTVIAAVLGVILVLLIHPGNPKLKENLGEGLENDEV-SSLDAFFDLIRNLFPENLVQACFQQIQT-VVKKVEVQPD--LDD---TNSTMSEYLSNATKPPPIFKDKKSLQFKSGMNVLGLIGFFIAFGICMGKMGEKARLMIDFFNILNEIVMKLVIMIMWYSPFGIACLICGKIISIKDLEVVARQLGMYMITVIVGLIIHGAIFLPCIYFAIVRKNPFSFFMGIFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGIDLDPGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTQDISLLVAVDWLLDRFRTSVNVVGDSYGAGIVYHLSKAELDALDAQ 495          
BLAST of slc1a-2 vs. Ensembl Zebrafish
Match: slc1a2a (solute carrier family 1 member 2a [Source:ZFIN;Acc:ZDB-GENE-100422-11])

HSP 1 Score: 447.973 bits (1151), Expect = 4.865e-150
Identity = 257/443 (58.01%), Postives = 330/443 (74.49%), Query Frame = 1
Query:  358 VMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEVTAT-ELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAEILKEAANYLEKT 1683
            +M+I+FPG++LM MLKM+I+PLI+SSLI+GLAGLD KSSG++G  A+IYY STT++A VLG+ILV+LIHPGN  +K  LG+G  K    S+LD+F DL+RN+FP N++QA  QQI +  V     +          +N       T     Y +  + +     NVLGI+ F + FG+ + +MGEKA +MV FF  LNE+VM++V +IMWYSPIGI  L+ GK++ I  LE  A  LGMYM+TVI GL IH    L LIY VI RK+P  FF G+FQAW+TALGTASSA TLP+TFRCLEE +GIDKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+N  +L+P QI TVS+TATLA++GAAS+PSAGLVTM+++LT+VGLPT DISL++ VDWLLDR RTS+NV+GD+YGA +V+HL K  LD  DA+ ++     + KT
Sbjct:   66 IMVIAFPGDILMRMLKMVILPLIISSLITGLAGLDAKSSGRLGTRAMIYYMSTTVIAAVLGVILVLLIHPGNPKLKANLGEG-KKNDEVSSLDAFFDLIRNLFPENLVQACFQQIQT--VTTKVEIAPPPPPTRFGRN------ATKGAAKYVIKKSLQFKSGMNVLGIIGFFVAFGICMGKMGEKAKLMVDFFNTLNEIVMRLVGMIMWYSPIGIACLICGKIISINDLEMVAKQLGMYMVTVIVGLIIHGGIFLPLIYFVIVRKNPFKFFMGLFQAWVTALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGIELDPGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTQDISLLVAVDWLLDRFRTSVNVIGDSYGAGIVYHLSKDELDMFDAQQIRPDDFEMAKT 499          
BLAST of slc1a-2 vs. Ensembl Xenopus
Match: SLC1A2 (solute carrier family 1 member 2 [Source:NCBI gene;Acc:100494868])

HSP 1 Score: 451.055 bits (1159), Expect = 2.065e-151
Identity = 259/436 (59.40%), Postives = 338/436 (77.52%), Query Frame = 1
Query:  358 VMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKTKAVTDRMLKDMLSQNKTTEGLT--TNSTITYEVTAT-ELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCK---KTLDEQDAE 1647
            VM+I+FPG++LM MLKMLI+PLI+SSLI+GLAGLD KSSG++G  A+IYY STT++A +LG+ILV+ IHPG+  +KKQLG+G       S+LD+FLDL+RN+FP N++QA  QQI +  V K K V +   ++  +   +   L   T +T T E+    E  D  NVLG++ F + FG+ + +MGE+A +MV+FF +LNE+VMK+V +IMWYSP+GI  L+ GK++ I+ LE  A  LGMYM+TVI GL IH    L L+Y VI RKSP  F  G+FQAWITALGTASSA TLP+TFRCLEE +GIDKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+N   L+  QI TVS+TATLA++GAAS+PSAGLVTM+++LT+VGLPT DISL++ VDWLLDR+RTS+NV+GD++GA +V+HL K   ++LD+Q A 
Sbjct:   41 VMVIAFPGDILMRMLKMLILPLIISSLITGLAGLDAKSSGRLGTRAMIYYMSTTIIAAILGVILVLAIHPGDPKLKKQLGKGQENDEV-SSLDAFLDLIRNLFPENLVQACFQQIQT--VTK-KVVVEAPTEEPSNVTDSVFALMNDTVATTTEEIRKKLEFKDGMNVLGVIGFFIAFGIAMGKMGEQARLMVEFFNILNEIVMKLVTMIMWYSPLGIACLICGKIIAIKDLELVARQLGMYMVTVIVGLIIHGAIFLPLLYFVITRKSPFTFLAGVFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVILDGGQIITVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTQDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKAELESLDKQHAH 472          
BLAST of slc1a-2 vs. Ensembl Xenopus
Match: SLC1A2 (solute carrier family 1 member 2 [Source:NCBI gene;Acc:100494868])

HSP 1 Score: 451.825 bits (1161), Expect = 2.358e-151
Identity = 259/436 (59.40%), Postives = 338/436 (77.52%), Query Frame = 1
Query:  358 VMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKTKAVTDRMLKDMLSQNKTTEGLT--TNSTITYEVTAT-ELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCK---KTLDEQDAE 1647
            VM+I+FPG++LM MLKMLI+PLI+SSLI+GLAGLD KSSG++G  A+IYY STT++A +LG+ILV+ IHPG+  +KKQLG+G       S+LD+FLDL+RN+FP N++QA  QQI +  V K K V +   ++  +   +   L   T +T T E+    E  D  NVLG++ F + FG+ + +MGE+A +MV+FF +LNE+VMK+V +IMWYSP+GI  L+ GK++ I+ LE  A  LGMYM+TVI GL IH    L L+Y VI RKSP  F  G+FQAWITALGTASSA TLP+TFRCLEE +GIDKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+N   L+  QI TVS+TATLA++GAAS+PSAGLVTM+++LT+VGLPT DISL++ VDWLLDR+RTS+NV+GD++GA +V+HL K   ++LD+Q A 
Sbjct:   75 VMVIAFPGDILMRMLKMLILPLIISSLITGLAGLDAKSSGRLGTRAMIYYMSTTIIAAILGVILVLAIHPGDPKLKKQLGKGQENDEV-SSLDAFLDLIRNLFPENLVQACFQQIQT--VTK-KVVVEAPTEEPSNVTDSVFALMNDTVATTTEEIRKKLEFKDGMNVLGVIGFFIAFGIAMGKMGEQARLMVEFFNILNEIVMKLVTMIMWYSPLGIACLICGKIIAIKDLELVARQLGMYMVTVIVGLIIHGAIFLPLLYFVITRKSPFTFLAGVFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVILDGGQIITVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTQDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKAELESLDKQHAH 506          
BLAST of slc1a-2 vs. Ensembl Xenopus
Match: SLC1A2 (solute carrier family 1 member 2 [Source:NCBI gene;Acc:100494868])

HSP 1 Score: 452.21 bits (1162), Expect = 2.705e-151
Identity = 259/436 (59.40%), Postives = 338/436 (77.52%), Query Frame = 1
Query:  358 VMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKTKAVTDRMLKDMLSQNKTTEGLT--TNSTITYEVTAT-ELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCK---KTLDEQDAE 1647
            VM+I+FPG++LM MLKMLI+PLI+SSLI+GLAGLD KSSG++G  A+IYY STT++A +LG+ILV+ IHPG+  +KKQLG+G       S+LD+FLDL+RN+FP N++QA  QQI +  V K K V +   ++  +   +   L   T +T T E+    E  D  NVLG++ F + FG+ + +MGE+A +MV+FF +LNE+VMK+V +IMWYSP+GI  L+ GK++ I+ LE  A  LGMYM+TVI GL IH    L L+Y VI RKSP  F  G+FQAWITALGTASSA TLP+TFRCLEE +GIDKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+N   L+  QI TVS+TATLA++GAAS+PSAGLVTM+++LT+VGLPT DISL++ VDWLLDR+RTS+NV+GD++GA +V+HL K   ++LD+Q A 
Sbjct:   75 VMVIAFPGDILMRMLKMLILPLIISSLITGLAGLDAKSSGRLGTRAMIYYMSTTIIAAILGVILVLAIHPGDPKLKKQLGKGQENDEV-SSLDAFLDLIRNLFPENLVQACFQQIQT--VTK-KVVVEAPTEEPSNVTDSVFALMNDTVATTTEEIRKKLEFKDGMNVLGVIGFFIAFGIAMGKMGEQARLMVEFFNILNEIVMKLVTMIMWYSPLGIACLICGKIIAIKDLELVARQLGMYMVTVIVGLIIHGAIFLPLLYFVITRKSPFTFLAGVFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVILDGGQIITVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTQDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKAELESLDKQHAH 506          
BLAST of slc1a-2 vs. Ensembl Xenopus
Match: SLC1A2 (solute carrier family 1 member 2 [Source:NCBI gene;Acc:100494868])

HSP 1 Score: 451.825 bits (1161), Expect = 2.772e-151
Identity = 259/436 (59.40%), Postives = 338/436 (77.52%), Query Frame = 1
Query:  358 VMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKTKAVTDRMLKDMLSQNKTTEGLT--TNSTITYEVTAT-ELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCK---KTLDEQDAE 1647
            VM+I+FPG++LM MLKMLI+PLI+SSLI+GLAGLD KSSG++G  A+IYY STT++A +LG+ILV+ IHPG+  +KKQLG+G       S+LD+FLDL+RN+FP N++QA  QQI +  V K K V +   ++  +   +   L   T +T T E+    E  D  NVLG++ F + FG+ + +MGE+A +MV+FF +LNE+VMK+V +IMWYSP+GI  L+ GK++ I+ LE  A  LGMYM+TVI GL IH    L L+Y VI RKSP  F  G+FQAWITALGTASSA TLP+TFRCLEE +GIDKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+N   L+  QI TVS+TATLA++GAAS+PSAGLVTM+++LT+VGLPT DISL++ VDWLLDR+RTS+NV+GD++GA +V+HL K   ++LD+Q A 
Sbjct:   75 VMVIAFPGDILMRMLKMLILPLIISSLITGLAGLDAKSSGRLGTRAMIYYMSTTIIAAILGVILVLAIHPGDPKLKKQLGKGQENDEV-SSLDAFLDLIRNLFPENLVQACFQQIQT--VTK-KVVVEAPTEEPSNVTDSVFALMNDTVATTTEEIRKKLEFKDGMNVLGVIGFFIAFGIAMGKMGEQARLMVEFFNILNEIVMKLVTMIMWYSPLGIACLICGKIIAIKDLELVARQLGMYMVTVIVGLIIHGAIFLPLLYFVITRKSPFTFLAGVFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVILDGGQIITVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTQDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKAELESLDKQHAH 506          
BLAST of slc1a-2 vs. Ensembl Xenopus
Match: SLC1A2 (solute carrier family 1 member 2 [Source:NCBI gene;Acc:100494868])

HSP 1 Score: 452.21 bits (1162), Expect = 2.790e-151
Identity = 259/436 (59.40%), Postives = 338/436 (77.52%), Query Frame = 1
Query:  358 VMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKTKAVTDRMLKDMLSQNKTTEGLT--TNSTITYEVTAT-ELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCK---KTLDEQDAE 1647
            VM+I+FPG++LM MLKMLI+PLI+SSLI+GLAGLD KSSG++G  A+IYY STT++A +LG+ILV+ IHPG+  +KKQLG+G       S+LD+FLDL+RN+FP N++QA  QQI +  V K K V +   ++  +   +   L   T +T T E+    E  D  NVLG++ F + FG+ + +MGE+A +MV+FF +LNE+VMK+V +IMWYSP+GI  L+ GK++ I+ LE  A  LGMYM+TVI GL IH    L L+Y VI RKSP  F  G+FQAWITALGTASSA TLP+TFRCLEE +GIDKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+N   L+  QI TVS+TATLA++GAAS+PSAGLVTM+++LT+VGLPT DISL++ VDWLLDR+RTS+NV+GD++GA +V+HL K   ++LD+Q A 
Sbjct:   79 VMVIAFPGDILMRMLKMLILPLIISSLITGLAGLDAKSSGRLGTRAMIYYMSTTIIAAILGVILVLAIHPGDPKLKKQLGKGQENDEV-SSLDAFLDLIRNLFPENLVQACFQQIQT--VTK-KVVVEAPTEEPSNVTDSVFALMNDTVATTTEEIRKKLEFKDGMNVLGVIGFFIAFGIAMGKMGEQARLMVEFFNILNEIVMKLVTMIMWYSPLGIACLICGKIIAIKDLELVARQLGMYMVTVIVGLIIHGAIFLPLLYFVITRKSPFTFLAGVFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVILDGGQIITVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTQDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKAELESLDKQHAH 510          
BLAST of slc1a-2 vs. Ensembl Mouse
Match: Slc1a2 (solute carrier family 1 (glial high affinity glutamate transporter), member 2 [Source:MGI Symbol;Acc:MGI:101931])

HSP 1 Score: 457.218 bits (1175), Expect = 1.912e-153
Identity = 260/441 (58.96%), Postives = 335/441 (75.96%), Query Frame = 1
Query:  358 VMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQIS-----------SKYVNKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAE 1647
            VMLI+FPG++LM MLKMLI+PLI+SSLI+GL+GLD K+SG++G  A++YY STT++A VLG+ILV+ IHPGN  +KKQLG G  K    S+LD+FLDL+RN+FP N++QA  QQI            S+  N TKAV   +       N+T       + I  +    E  D  NVLG++ F + FG+ + +MGE+A +MV+FF +LNE+VMK+V +IMWYSP+GI  L+ GK++ I+ LE  A  LGMYM+TVI GL IH    L LIY V+ RK+P  FF GIFQAWITALGTASSA TLP+TFRCLE+ +GIDKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+N   L+  QI TVS+TATLA+IGAAS+PSAGLVTM+++LT+VGLPT+DISL++ VDWLLDR+RTS+NV+GD++GA +V+HL K  LD  D++
Sbjct:   75 VMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRAMVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPG-KKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPSEEANTTKAVISML-------NETMNEAPEETKIVIK-KGLEFKDGMNVLGLIGFFIAFGIAMGKMGEQAKLMVEFFNILNEIVMKLVIMIMWYSPLGIACLICGKIIAIKDLEVVARQLGMYMITVIVGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALGTASSAGTLPVTFRCLEDNLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVILDGGQIVTVSLTATLASIGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQ 506          
BLAST of slc1a-2 vs. Ensembl Mouse
Match: Slc1a2 (solute carrier family 1 (glial high affinity glutamate transporter), member 2 [Source:MGI Symbol;Acc:MGI:101931])

HSP 1 Score: 456.833 bits (1174), Expect = 3.101e-153
Identity = 260/441 (58.96%), Postives = 335/441 (75.96%), Query Frame = 1
Query:  358 VMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQIS-----------SKYVNKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAE 1647
            VMLI+FPG++LM MLKMLI+PLI+SSLI+GL+GLD K+SG++G  A++YY STT++A VLG+ILV+ IHPGN  +KKQLG G  K    S+LD+FLDL+RN+FP N++QA  QQI            S+  N TKAV   +       N+T       + I  +    E  D  NVLG++ F + FG+ + +MGE+A +MV+FF +LNE+VMK+V +IMWYSP+GI  L+ GK++ I+ LE  A  LGMYM+TVI GL IH    L LIY V+ RK+P  FF GIFQAWITALGTASSA TLP+TFRCLE+ +GIDKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+N   L+  QI TVS+TATLA+IGAAS+PSAGLVTM+++LT+VGLPT+DISL++ VDWLLDR+RTS+NV+GD++GA +V+HL K  LD  D++
Sbjct:   75 VMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRAMVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPG-KKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPSEEANTTKAVISML-------NETMNEAPEETKIVIK-KGLEFKDGMNVLGLIGFFIAFGIAMGKMGEQAKLMVEFFNILNEIVMKLVIMIMWYSPLGIACLICGKIIAIKDLEVVARQLGMYMITVIVGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALGTASSAGTLPVTFRCLEDNLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVILDGGQIVTVSLTATLASIGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQ 506          
BLAST of slc1a-2 vs. Ensembl Mouse
Match: Slc1a2 (solute carrier family 1 (glial high affinity glutamate transporter), member 2 [Source:MGI Symbol;Acc:MGI:101931])

HSP 1 Score: 456.447 bits (1173), Expect = 3.777e-153
Identity = 260/441 (58.96%), Postives = 335/441 (75.96%), Query Frame = 1
Query:  358 VMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQIS-----------SKYVNKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAE 1647
            VMLI+FPG++LM MLKMLI+PLI+SSLI+GL+GLD K+SG++G  A++YY STT++A VLG+ILV+ IHPGN  +KKQLG G  K    S+LD+FLDL+RN+FP N++QA  QQI            S+  N TKAV   +       N+T       + I  +    E  D  NVLG++ F + FG+ + +MGE+A +MV+FF +LNE+VMK+V +IMWYSP+GI  L+ GK++ I+ LE  A  LGMYM+TVI GL IH    L LIY V+ RK+P  FF GIFQAWITALGTASSA TLP+TFRCLE+ +GIDKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+N   L+  QI TVS+TATLA+IGAAS+PSAGLVTM+++LT+VGLPT+DISL++ VDWLLDR+RTS+NV+GD++GA +V+HL K  LD  D++
Sbjct:   72 VMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRAMVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPG-KKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPSEEANTTKAVISML-------NETMNEAPEETKIVIK-KGLEFKDGMNVLGLIGFFIAFGIAMGKMGEQAKLMVEFFNILNEIVMKLVIMIMWYSPLGIACLICGKIIAIKDLEVVARQLGMYMITVIVGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALGTASSAGTLPVTFRCLEDNLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVILDGGQIVTVSLTATLASIGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQ 503          
BLAST of slc1a-2 vs. Ensembl Mouse
Match: Slc1a2 (solute carrier family 1 (glial high affinity glutamate transporter), member 2 [Source:MGI Symbol;Acc:MGI:101931])

HSP 1 Score: 456.447 bits (1173), Expect = 4.021e-153
Identity = 260/441 (58.96%), Postives = 335/441 (75.96%), Query Frame = 1
Query:  358 VMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQIS-----------SKYVNKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAE 1647
            VMLI+FPG++LM MLKMLI+PLI+SSLI+GL+GLD K+SG++G  A++YY STT++A VLG+ILV+ IHPGN  +KKQLG G  K    S+LD+FLDL+RN+FP N++QA  QQI            S+  N TKAV   +       N+T       + I  +    E  D  NVLG++ F + FG+ + +MGE+A +MV+FF +LNE+VMK+V +IMWYSP+GI  L+ GK++ I+ LE  A  LGMYM+TVI GL IH    L LIY V+ RK+P  FF GIFQAWITALGTASSA TLP+TFRCLE+ +GIDKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+N   L+  QI TVS+TATLA+IGAAS+PSAGLVTM+++LT+VGLPT+DISL++ VDWLLDR+RTS+NV+GD++GA +V+HL K  LD  D++
Sbjct:   72 VMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRAMVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPG-KKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPSEEANTTKAVISML-------NETMNEAPEETKIVIK-KGLEFKDGMNVLGLIGFFIAFGIAMGKMGEQAKLMVEFFNILNEIVMKLVIMIMWYSPLGIACLICGKIIAIKDLEVVARQLGMYMITVIVGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALGTASSAGTLPVTFRCLEDNLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVILDGGQIVTVSLTATLASIGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQ 503          
BLAST of slc1a-2 vs. Ensembl Mouse
Match: Slc1a3 (solute carrier family 1 (glial high affinity glutamate transporter), member 3 [Source:MGI Symbol;Acc:MGI:99917])

HSP 1 Score: 387.497 bits (994), Expect = 1.144e-126
Identity = 226/434 (52.07%), Postives = 309/434 (71.20%), Query Frame = 1
Query:  358 VMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKTKAVTDRMLKDMLSQ--NKTTEGLTTNSTITYE-VTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAEI 1650
            V   SFPGELLM ML+ML++PLI+SSL++G+A LD K+SG++G  A++YY +TT++AVV+GII+V++IHPG    +    +G  K    +  D+FLDL+RN+FPPN+++A  +Q  + Y  ++  V  +  + +L    N  +E + T + I  E V      +  N LG+V FSM FG V+  M E+   + +FF  LNE +M++V VIMWY+P+GI  L+ GK++++E +      L MY +TVI GL IHA   L L+Y ++ RK+P  F  G+ QA ITALGT+SS+ATLPITF+CLEE  G+DKR+TRFVLP+GATINMDGTALYEA+A+IFIAQ+N   L   QI T+SITAT A+IGAA +P AGLVTM++VLTSVGLPTDDI+LI+ VDW LDRLRT+ NVLGD+ GA +V HL +  L  +D E+
Sbjct:   78 VKYFSFPGELLMRMLQMLVLPLIISSLVTGMAALDSKASGKMGMRAVVYYMTTTIIAVVIGIIIVIIIHPGKGTKENMYREG--KIVQVTAADAFLDLIRNMFPPNLVEACFKQFKTSYEKRSFKVPIQSNETLLGAVINNVSEAMETLTRIREEMVPVPGSVNGVNALGLVVFSMCFGFVIGNMKEQGQALREFFDSLNEAIMRLVAVIMWYAPLGILFLIAGKIVEMEDMGVIGGQLAMYTVTVIVGLLIHAVIVLPLLYFLVTRKNPWVFIGGLLQALITALGTSSSSATLPITFKCLEENNGVDKRITRFVLPVGATINMDGTALYEALAAIFIAQVNNFDLNFGQIITISITATAASIGAAGIPQAGLVTMVIVLTSVGLPTDDITLIIAVDWFLDRLRTTTNVLGDSLGAGIVEHLSRHELKNRDVEM 509          
BLAST of slc1a-2 vs. UniProt/SwissProt
Match: sp|P43006|EAA2_MOUSE (Excitatory amino acid transporter 2 OS=Mus musculus OX=10090 GN=Slc1a2 PE=1 SV=1)

HSP 1 Score: 456.833 bits (1174), Expect = 2.169e-152
Identity = 260/441 (58.96%), Postives = 335/441 (75.96%), Query Frame = 1
Query:  358 VMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQIS-----------SKYVNKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAE 1647
            VMLI+FPG++LM MLKMLI+PLI+SSLI+GL+GLD K+SG++G  A++YY STT++A VLG+ILV+ IHPGN  +KKQLG G  K    S+LD+FLDL+RN+FP N++QA  QQI            S+  N TKAV   +       N+T       + I  +    E  D  NVLG++ F + FG+ + +MGE+A +MV+FF +LNE+VMK+V +IMWYSP+GI  L+ GK++ I+ LE  A  LGMYM+TVI GL IH    L LIY V+ RK+P  FF GIFQAWITALGTASSA TLP+TFRCLE+ +GIDKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+N   L+  QI TVS+TATLA+IGAAS+PSAGLVTM+++LT+VGLPT+DISL++ VDWLLDR+RTS+NV+GD++GA +V+HL K  LD  D++
Sbjct:   75 VMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRAMVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPG-KKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPSEEANTTKAVISML-------NETMNEAPEETKIVIK-KGLEFKDGMNVLGLIGFFIAFGIAMGKMGEQAKLMVEFFNILNEIVMKLVIMIMWYSPLGIACLICGKIIAIKDLEVVARQLGMYMITVIVGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALGTASSAGTLPVTFRCLEDNLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVILDGGQIVTVSLTATLASIGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQ 506          
BLAST of slc1a-2 vs. UniProt/SwissProt
Match: sp|P31596|EAA2_RAT (Excitatory amino acid transporter 2 OS=Rattus norvegicus OX=10116 GN=Slc1a2 PE=1 SV=2)

HSP 1 Score: 456.833 bits (1174), Expect = 2.871e-152
Identity = 260/441 (58.96%), Postives = 335/441 (75.96%), Query Frame = 1
Query:  358 VMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQIS-----------SKYVNKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAE 1647
            VMLI+FPG++LM MLKMLI+PLI+SSLI+GL+GLD K+SG++G  A++YY STT++A VLG+ILV+ IHPGN  +KKQLG G  K    S+LD+FLDL+RN+FP N++QA  QQI            S+  N TKAV   +       N+T       + I  +    E  D  NVLG++ F + FG+ + +MGE+A +MV+FF +LNE+VMK+V +IMWYSP+GI  L+ GK++ I+ LE  A  LGMYM+TVI GL IH    L LIY V+ RK+P  FF GIFQAWITALGTASSA TLP+TFRCLE+ +GIDKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+N   L+  QI TVS+TATLA+IGAAS+PSAGLVTM+++LT+VGLPT+DISL++ VDWLLDR+RTS+NV+GD++GA +V+HL K  LD  D++
Sbjct:   75 VMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRAMVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPG-KKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPSEEANTTKAVISLL-------NETMNEAPEETKIVIK-KGLEFKDGMNVLGLIGFFIAFGIAMGKMGEQAKLMVEFFNILNEIVMKLVIMIMWYSPLGIACLICGKIIAIKDLEVVARQLGMYMITVIVGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALGTASSAGTLPVTFRCLEDNLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVILDGGQIVTVSLTATLASIGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQ 506          
BLAST of slc1a-2 vs. UniProt/SwissProt
Match: sp|Q10901|EAA1_CAEEL (Excitatory amino acid transporter OS=Caenorhabditis elegans OX=6239 GN=glt-1 PE=1 SV=2)

HSP 1 Score: 447.588 bits (1150), Expect = 1.015e-149
Identity = 251/444 (56.53%), Postives = 333/444 (75.00%), Query Frame = 1
Query:  358 VMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAEILKEAANYLEKTDE 1689
            +M ISFPGELLM+MLKM+I+PLI+SSLISGLA LD + SG++G  A+ YY  TT +AVV GI LV++IHPG+  IKK++G GT  +   ST+D+ LDLLRN+FP N++QA  QQ+ +KY+     V  +++K+    +  T     N ++ Y   + E T   NVLG++ F +  G+ LSQ+G++A +MVQFF ++++V+MK+V  +MWYSP GIF L++GK+L+I  L +TA  L MYM+TV++GL IH+  +L LI+ V  +K+P  F +G+FQAWITALGTASS+ATLPITF CLEE +G+D+RVTRFVLP+GATINMDGTALYEAVA+IFIAQIN   L   Q+ TVS+TATLA+IGAASVPSAGLVTM++VLT+VGLP  D+SLI+ VDWLLDR+RTSINVLGDA GA +V+H  K  LD  D       ++ +   DE
Sbjct:   49 IMYISFPGELLMHMLKMMILPLIMSSLISGLAQLDARQSGKLGSLAVTYYMFTTAVAVVTGIFLVLVIHPGDPTIKKEIGTGTEGKTV-STVDTLLDLLRNMFPENVVQATFQQVQTKYIK----VRPKVVKN---NDSATLAALNNGSLDYVKASVEYTSGMNVLGVIVFCIAIGISLSQLGQEAHVMVQFFVIMDKVIMKLVMTVMWYSPFGIFCLIMGKILEIHDLADTARMLAMYMVTVLSGLAIHSLISLPLIFFVTTKKNPYVFMRGLFQAWITALGTASSSATLPITFNCLEENLGVDRRVTRFVLPVGATINMDGTALYEAVAAIFIAQINGVHLSFGQVVTVSLTATLASIGAASVPSAGLVTMLLVLTAVGLPVKDVSLIVAVDWLLDRIRTSINVLGDAMGAGIVYHYSKADLDAHDRLAATTRSHSIAMNDE 484          
BLAST of slc1a-2 vs. UniProt/SwissProt
Match: sp|Q25605|EAAT_ONCVO (Excitatory amino acid transporter OS=Onchocerca volvulus OX=6282 GN=GLT-1 PE=2 SV=1)

HSP 1 Score: 442.58 bits (1137), Expect = 6.828e-148
Identity = 247/444 (55.63%), Postives = 330/444 (74.32%), Query Frame = 1
Query:  358 VMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAEILKEAANYLEKTDE 1689
            +M ISFPGELLM+MLKM+I+PLI+SSLISGLA LD + SG++G  A+ YY  TT +AVV GI LV++IHPG+  IKK++G GT  +   ST+D+ LDLLRN+FP N++QA  QQ+ +KY+     V  +++K+    +  T     N ++ Y   + E T   NVLG++ F +  G+ LSQ+G++A +MVQFF ++++V+MK+V  +MWYSP GI  L++GK+L+I  L +TA  L MYM+TV++GL IH+  +L LI+ V  +K+P  F +G+FQAWIT LGTASS+ TLPIT+ CLEE +G+D+RVTRFVLP+GATINMDGTALYEAVA+IFIAQIN   L   Q+ TVS+TATLA+IGAASVPSAGLVTM++VLT+VGLP  D+SLI+ VDWLLDR+RTSINVLGDA GA +V+H  K  LD  D       ++ +   DE
Sbjct:   38 IMYISFPGELLMHMLKMMILPLIMSSLISGLAQLDARQSGKLGSLAVTYYMFTTAVAVVTGIFLVLVIHPGDPTIKKEIGTGTEGKTV-STVDTLLDLLRNMFPENVVQATFQQVQTKYIK----VRPKVVKN---NDSATLAALNNGSLDYVKASVEYTSGMNVLGVIVFCIAIGISLSQLGQEAHVMVQFFVIMDKVIMKLVMTVMWYSPFGILCLIMGKILEIHDLADTARMLAMYMVTVLSGLAIHSLISLPLIFFVTTKKNPYVFMRGLFQAWITGLGTASSSDTLPITYICLEENLGVDRRVTRFVLPVGATINMDGTALYEAVAAIFIAQINGVHLSFGQVVTVSLTATLASIGAASVPSAGLVTMLLVLTAVGLPVKDVSLIVAVDWLLDRIRTSINVLGDAMGAGIVYHYSKADLDAHDRLAATTRSHSIAMNDE 473          
BLAST of slc1a-2 vs. UniProt/SwissProt
Match: sp|P43004|EAA2_HUMAN (Excitatory amino acid transporter 2 OS=Homo sapiens OX=9606 GN=SLC1A2 PE=1 SV=2)

HSP 1 Score: 437.187 bits (1123), Expect = 1.330e-144
Identity = 256/442 (57.92%), Postives = 334/442 (75.57%), Query Frame = 1
Query:  358 VMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISS------------KYVNKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAE 1647
            VMLI+FPG++LM MLKMLI+PLI+SSLI+GL+GLD K+SG++G  A++YY STT++A VLG+ILV+ IHPGN  +KKQLG G  K    S+LD+FLDL+RN+FP N++QA  QQI +            +  N T AV   +       N+T   +   + +  +    E  D  NVLG++ F + FG+ + +MG++A +MV FF +LNE+VMK+V +IMWYSP+GI  L+ GK++ I+ LE  A  LGMYM+TVI GL IH    L LIY V+ RK+P  FF GIFQAWITALGTASSA TLP+TFRCLEE +GIDKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+N   L+  QI TVS+TATLA++GAAS+PSAGLVTM+++LT+VGLPT+DISL++ VDWLLDR+RTS+NV+GD++GA +V+HL K  LD  D++
Sbjct:   75 VMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRAMVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPG-KKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLL-------NETVTEVPEETKMVIK-KGLEFKDGMNVLGLIGFFIAFGIAMGKMGDQAKLMVDFFNILNEIVMKLVIMIMWYSPLGIACLICGKIIAIKDLEVVARQLGMYMVTVIIGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVVLDGGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQ 507          
BLAST of slc1a-2 vs. TrEMBL
Match: A0A0H3YF08 (Amino acid transporter OS=Schmidtea mediterranea OX=79327 GN=slc1a-2 PE=2 SV=1)

HSP 1 Score: 1086.25 bits (2808), Expect = 0.000e+0
Identity = 595/595 (100.00%), Postives = 595/595 (100.00%), Query Frame = 1
Query:  103 MTFGKLKRRNPQDCESANDGATRELMSPDESRSPSNMSTKTCLDKVKGAFKNADNIXXXXXXXXXXXXXXXXXXXXXXXRYDDYAVMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAEILKEAANYLEKTDETLTVLPAPKRLSVALALRLNEVDGQKLHKNRSIDSGVRGNEELDGPSISKEIPNKEDNTDYKNTSV 1887
            MTFGKLKRRNPQDCESANDGATRELMSPDESRSPSNMSTKTCLDKVKGAFKNADNILVSLTVLSVVLGMGVGLVVKLTLRYDDYAVMLISFPGELLMNMLKMLIIPLIVSSLISGLAGLDPKSSGQIGKWALIYYFSTTMMAVVLGIILVVLIHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWITALGTASSAATLPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAEILKEAANYLEKTDETLTVLPAPKRLSVALALRLNEVDGQKLHKNRSIDSGVRGNEELDGPSISKEIPNKEDNTDYKNTSV
Sbjct:    1 MTFGKLKRRNPQDCESANDGATRELMSPDESRSPSNMSTKTCLDKVKGAFKNADNILVSLTVLSVVLGMGVGLVVKLTLRYDDYAVMLISFPGELLMNMLKMLIIPLIVSSLISGLAGLDPKSSGQIGKWALIYYFSTTMMAVVLGIILVVLIHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWITALGTASSAATLPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAEILKEAANYLEKTDETLTVLPAPKRLSVALALRLNEVDGQKLHKNRSIDSGVRGNEELDGPSISKEIPNKEDNTDYKNTSV 595          
BLAST of slc1a-2 vs. TrEMBL
Match: A0A4E0RAH7 (Amino acid transporter OS=Fasciola hepatica OX=6192 GN=D915_003789 PE=3 SV=1)

HSP 1 Score: 538.11 bits (1385), Expect = 0.000e+0
Identity = 326/541 (60.26%), Postives = 411/541 (75.97%), Query Frame = 1
Query:  235 KVKGAFKNADNIXXXXXXXXXXXXXXXXXXXXXXXRYDDYAVMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYV------------------NKTKAVTDRMLKDMLSQ--NKTTEG-LTTNSTITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAEILKEAANYLEKTDETLTVLPAP--------------KRLSVALALRLNE 1752
            K K  F+N DN+ V LTV +V+LGM +GL++K+ +      + LISFPGELLMNMLKMLIIPLIVSSL++GLAGLDPKSSG+IG +AL+YY  TT +AVVLGI LV+ I PGNA+IK+ +G+GT   R P TLDS LDL+RN+FP NI+QA +QQ  S++V                  ++T  +T  +  D + Q  N+TT+  + T+   +YE    +  DSTNVLG+V+FS+ FGLVL QMG+KA++MVQFF++LNEVVM+MV++IM YSP GIF L++GK+L+I++L++TA +LG+YM TV+TGL IH+  TL L+Y VI RK+P  F+KGIFQAWITALGTASSAATLPITFRCLE  + IDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINA+ L  +++F VS+TATLAAIGAASVPSAGLVTM++VLTSVGLPT DISLIL VDWLLDR+RTSINVLGDA GA +V HLC+K L E+DAEI +E    +E   + +++  +P              KR+SVA AL+L E
Sbjct:   45 KAKLWFRNVDNVFVILTVAAVILGMTIGLLIKIRVDPAPRTIYLISFPGELLMNMLKMLIIPLIVSSLVAGLAGLDPKSSGKIGLYALVYYVVTTALAVVLGIALVLTIRPGNANIKETMGEGTIAVRRPETLDSLLDLMRNLFPENIVQACLQQQQSEFVTVHKRPKYVKLDNASQFTDQTNVITTTLASDAIEQLLNETTDAPIQTSQLSSYEAVRPKYVDSTNVLGLVSFSIMFGLVLGQMGDKAVVMVQFFSILNEVVMRMVQIIMLYSPFGIFFLILGKMLEIDNLKDTATSLGLYMTTVVTGLAIHSLGTLALMYFVITRKNPYRFYKGIFQAWITALGTASSAATLPITFRCLENNLNIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINAKDLSVVEVFIVSLTATLAAIGAASVPSAGLVTMMLVLTSVGLPTKDISLILAVDWLLDRIRTSINVLGDAVGAGIVDHLCRKELAEKDAEIERELDEAVEAFSKRMSLPSSPSATDQPVDKRRWSKKRMSVAAALKLQE 585          
BLAST of slc1a-2 vs. TrEMBL
Match: A0A504YUN0 (Amino acid transporter OS=Fasciola gigantica OX=46835 GN=FGIG_04945 PE=3 SV=1)

HSP 1 Score: 536.954 bits (1382), Expect = 1.783e-180
Identity = 326/541 (60.26%), Postives = 411/541 (75.97%), Query Frame = 1
Query:  235 KVKGAFKNADNIXXXXXXXXXXXXXXXXXXXXXXXRYDDYAVMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYV------------------NKTKAVTDRMLKDMLSQ--NKTTEG-LTTNSTITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAEILKEAANYLEKTDETLTVLPAP--------------KRLSVALALRLNE 1752
            K K  F+N DN+ V LTV +V+LGM +GL++K+ +      + LISFPGELLMNMLKMLIIPLIVSSL++GLAGLDPKSSG+IG +AL+YY  TT +AVVLGI LV+ I PGNA+IK+ +G+GT   R P TLDS LDL+RN+FP NI+QA +QQ  S++V                  ++T  +T  +  D + Q  N+TT+  + T+   +YE    +  DSTNVLG+V+FS+ FGLVL QMG+KA++MVQFF++LNEVVM+MV++IM YSP GIF L++GK+L+I++L++TA +LG+YM TV+TGL IH+  TL L+Y VI RK+P  F+KGIFQAWITALGTASSAATLPITFRCLE  + IDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINA+ L  +++F VS+TATLAAIGAASVPSAGLVTM++VLTSVGLPT DISLIL VDWLLDR+RTSINVLGDA GA +V HLC+K L E+DAEI +E    +E   + +++  +P              KR+SVA AL+L E
Sbjct:   45 KAKLWFRNVDNVFVILTVAAVILGMTIGLLIKIRVDPAPRTIYLISFPGELLMNMLKMLIIPLIVSSLVAGLAGLDPKSSGKIGLYALVYYVVTTALAVVLGIALVLTIRPGNANIKETMGEGTIAVRRPETLDSLLDLMRNLFPENIVQACLQQQQSEFVTVHKRPKYVKLDNASQFTDQTNVITTTLASDAMEQVLNETTDTPIQTSQLSSYEAVRPKYVDSTNVLGLVSFSIMFGLVLGQMGDKAVVMVQFFSILNEVVMRMVQIIMLYSPFGIFFLILGKMLEIDNLKDTATSLGLYMTTVVTGLAIHSLGTLALMYFVITRKNPYRFYKGIFQAWITALGTASSAATLPITFRCLENNLNIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINAKDLSVVEVFIVSLTATLAAIGAASVPSAGLVTMMLVLTSVGLPTKDISLILAVDWLLDRIRTSINVLGDAVGAGIVDHLCRKELAEKDAEIERELDEAVEAFSKRMSLPSSPSATDQPVDKRRWSKKRMSVAAALKLQE 585          
BLAST of slc1a-2 vs. TrEMBL
Match: A0A4Z2CXD8 (Amino acid transporter OS=Schistosoma japonicum OX=6182 GN=EWB00_006708 PE=3 SV=1)

HSP 1 Score: 535.413 bits (1378), Expect = 3.922e-180
Identity = 328/555 (59.10%), Postives = 417/555 (75.14%), Query Frame = 1
Query:  139 DCESANDGATRELMS--PDESRSPSNMSTKTCLDKVKGAFKNADNIXXXXXXXXXXXXXXXXXXXXXXXRYDDYAVMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKTKAVTDRMLKDMLSQNKTTEGLT---TNSTITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAEILKEAANYLEKTDETLTVLP------------APKRLSVALALRLNE 1752
            D    ND    E+++  PD+    + ++ ++ L K+K    N DN+ V+ TVL+V+LGM +GL+VK+        + L+SFPGELLMNMLKMLIIPLIVSSLI+GLAGLDPKSSG+IG +ALIYY  TTM+AV+LGI LV+ IHPG+  IK+++G+GT   R P TLDS LDLLRN+FP NI+ A +QQ  S YV  TK       K +   NKT + L     +  I+YE    +  D TNVLG+V+FS+ FG++L QMG+KA+IMVQFF++LNEV+M+MV+VIM+YSP GIF L++GK+L+IE+L +TA ALG+YM+TV+TGL IH   TL L+Y ++ RK+P  F+KG+FQAWITALGTASSAATLPITFRCLE+ +GIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQIN + L  +++F VS+TATLAAIGAASVPSAGLVTM++VLTSVGLPT DISLIL VDWLLDR+RTSINV+GDA GA +V+HLC   L ++D EI KE  + +E+    L++              + KR+S+A ALRL E
Sbjct:   16 DQNKPNDNRRFEILTCNPDKK---NEVNRQSKLYKMKKWITNIDNLFVTFTVLAVILGMTIGLLVKIYTSPSPRTIYLLSFPGELLMNMLKMLIIPLIVSSLIAGLAGLDPKSSGKIGSYALIYYVVTTMLAVILGIGLVLCIHPGDKSIKQEIGEGTIAERRPETLDSLLDLLRNLFPENIVHACLQQQQSTYVTITKRP-----KYIPLTNKTNDTLNIVDASKPISYEAVQPKFVDGTNVLGLVSFSIIFGIILGQMGDKAVIMVQFFSILNEVIMRMVQVIMFYSPFGIFFLILGKMLEIENLRDTARALGLYMVTVVTGLAIHLLGTLALLYFLVTRKNPFTFYKGLFQAWITALGTASSAATLPITFRCLEQNLGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGKYLTIVEVFIVSLTATLAAIGAASVPSAGLVTMMLVLTSVGLPTKDISLILAVDWLLDRIRTSINVMGDAVGAGIVNHLCHNELAQKDVEIEKEIDDAVEEYTRELSITTDHEKRNSTSCRHSKKRMSLAAALRLQE 562          
BLAST of slc1a-2 vs. TrEMBL
Match: A0A3Q0KCR1 (Amino acid transporter OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 534.258 bits (1375), Expect = 6.624e-180
Identity = 327/554 (59.03%), Postives = 406/554 (73.29%), Query Frame = 1
Query:  139 DCESANDGATRELMSPDESRSPSNMSTKTCLDKVKGAFKNADNIXXXXXXXXXXXXXXXXXXXXXXXRYDDYAVMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAEILKEAANYLEKTDETLTVLPA----------------PKRLSVALALRLNE 1752
            D    ND    E+ + ++         +  L K K    N DN+ V+ TVL+V+LGM +GL+VK+        + L+SFPGELLMNMLKMLIIPLIVSSLI+GLAGLDPKSSG+IG +ALIYY  TTM+AV+LGI LV+ IHPG+  IK ++G+GT + R P TLDS LDLLRN+FP N++QA +QQ  S YV   K      L D    N T       + I+YE    +  DSTNVLG+V+FS+ FG++L QMG++A+IMVQFF++LNEVVM+MV+VIM YSP GIF L++GK+L+IE+L +TA ALG+YM+TVI+GL IH   TL L+Y  + RK+P  F+KG+FQAWITALGTASSAATLPITFRCLE+ +GIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQIN + L  I++F VS+TATLAAIGAASVPSAGLVTM++VLTSVGLPT DISLIL VDWLLDR+RTSINV+GDA GA +V+HLC K L ++DAEI KE    +E+    L+   +                 KR+S+A A+RL E
Sbjct:   16 DKNKPNDNTGYEMKTINQDNKKRETKRRNKLSKFKKWIFNLDNLFVTFTVLAVILGMTIGLLVKIYATPSPRTIYLLSFPGELLMNMLKMLIIPLIVSSLIAGLAGLDPKSSGKIGSYALIYYVVTTMLAVILGIGLVLCIHPGDTSIKDEIGEGTIEERRPETLDSLLDLLRNLFPENVVQACLQQQQSSYVTIVKRPKYVRLTD--GTNGTLNMNNKTNLISYEAIKAKYVDSTNVLGLVSFSIIFGIILGQMGDRAVIMVQFFSVLNEVVMRMVQVIMLYSPFGIFFLILGKMLEIENLSDTAKALGLYMVTVISGLAIHLLGTLALLYYAVTRKNPFVFYKGLFQAWITALGTASSAATLPITFRCLEQNLGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGKYLTIIEVFIVSLTATLAAIGAASVPSAGLVTMMLVLTSVGLPTKDISLILAVDWLLDRIRTSINVMGDAVGAGIVNHLCSKELAQKDAEIDKEIDEVVEEYTRELSNTTSMIDREKRNSSSLNRHHKKRMSLAAAIRLQE 567          
BLAST of slc1a-2 vs. Ensembl Cavefish
Match: slc1a2b (solute carrier family 1 member 2 [Source:NCBI gene;Acc:103022057])

HSP 1 Score: 453.366 bits (1165), Expect = 4.135e-152
Identity = 253/434 (58.29%), Postives = 329/434 (75.81%), Query Frame = 1
Query:  346 DDYAVMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAE 1647
            DD  VM+I+FPG++LM MLKMLI+PLI+SSLI+GLAGLD KSSG++G  A++YY +TT++A +LG+ILV++IHPGN  +K+ LG+G       S+LD+F DL+RN+FP N++QA  QQI +  V K   V         + ++   G T    I  +  + +     NVLG++ F + FG+ + +MGEKA +M++FF +LNE+VMK+V +IMWYSP GI  L+ GK++ I+ LE  A  LGMYM+TVI GL IH    L  IY  I RK+P  FF GIFQAWITALGTASSA TLP+TFRCLEE +GIDKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+N   L+P QI TVS+TATLA++GAAS+PSAGLVTM+++LT+VGLPT DISL++ VDWLLDR RTS+NV+GD+YGA +V+HL K  L+  DA+
Sbjct:   62 DDNIVMVIAFPGDILMRMLKMLILPLIISSLITGLAGLDAKSSGRLGTRAMVYYMTTTIIAAILGVILVLIIHPGNPKLKENLGEGLQNDDV-SSLDAFFDLIRNLFPENLVQACFQQIQT--VVKKVEVQPDFDDSNSTMDEFLSGATKPPPIFKQKKSLQFKSGMNVLGLIGFFIAFGICMGKMGEKARLMIEFFNILNEIVMKLVIMIMWYSPFGIACLICGKIISIKDLEVVARQLGMYMITVIVGLIIHGAIFLPCIYFAIVRKNPFTFFMGIFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVVLDPGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTQDISLLVAVDWLLDRFRTSVNVVGDSYGAGIVYHLSKAELEALDAQ 492          
BLAST of slc1a-2 vs. Ensembl Cavefish
Match: slc1a2b (solute carrier family 1 member 2 [Source:NCBI gene;Acc:103022057])

HSP 1 Score: 453.366 bits (1165), Expect = 4.454e-152
Identity = 253/434 (58.29%), Postives = 329/434 (75.81%), Query Frame = 1
Query:  346 DDYAVMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAE 1647
            DD  VM+I+FPG++LM MLKMLI+PLI+SSLI+GLAGLD KSSG++G  A++YY +TT++A +LG+ILV++IHPGN  +K+ LG+G       S+LD+F DL+RN+FP N++QA  QQI +  V K   V         + ++   G T    I  +  + +     NVLG++ F + FG+ + +MGEKA +M++FF +LNE+VMK+V +IMWYSP GI  L+ GK++ I+ LE  A  LGMYM+TVI GL IH    L  IY  I RK+P  FF GIFQAWITALGTASSA TLP+TFRCLEE +GIDKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+N   L+P QI TVS+TATLA++GAAS+PSAGLVTM+++LT+VGLPT DISL++ VDWLLDR RTS+NV+GD+YGA +V+HL K  L+  DA+
Sbjct:   67 DDNIVMVIAFPGDILMRMLKMLILPLIISSLITGLAGLDAKSSGRLGTRAMVYYMTTTIIAAILGVILVLIIHPGNPKLKENLGEGLQNDDV-SSLDAFFDLIRNLFPENLVQACFQQIQT--VVKKVEVQPDFDDSNSTMDEFLSGATKPPPIFKQKKSLQFKSGMNVLGLIGFFIAFGICMGKMGEKARLMIEFFNILNEIVMKLVIMIMWYSPFGIACLICGKIISIKDLEVVARQLGMYMITVIVGLIIHGAIFLPCIYFAIVRKNPFTFFMGIFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVVLDPGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTQDISLLVAVDWLLDRFRTSVNVVGDSYGAGIVYHLSKAELEALDAQ 497          
BLAST of slc1a-2 vs. Ensembl Cavefish
Match: slc1a9 (excitatory amino acid transporter 2-like [Source:NCBI gene;Acc:103041419])

HSP 1 Score: 427.557 bits (1098), Expect = 1.504e-140
Identity = 246/438 (56.16%), Postives = 321/438 (73.29%), Query Frame = 1
Query:  346 DDYAVMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAEILKE 1659
            D   +MLI+FPG++LM MLKMLI+PLI+SSLI+GLAGLD +SSG++G  A++YY STT++A VLG+ILV+ IHPGN  ++    + +NK +  S+LD+FLDL+RN+FP N++QA  QQ+ +  + K     D   + +L   K                  E     NVLG++ F + FG+ + +MGEK  +M  FF +LNE++MKMV +IMWYSP+GI SL+ GK+  I  LE  A  LGMYM+TVI GL IH    L +I+  + RK+P  F+ GIFQAWITALGTASSA TLP+TFRCLEE + IDKRVTRFVLPIGATINMDGTALYEAVA+IFIAQ+N   L+  QI TVS+TATLA++GAAS+PSAGLVTM+++LT+VGLPT DISL++ VDWLLDR+RTSINV+GD++GA +V  L +  L + D EI +E
Sbjct:   78 DADILMLIAFPGDILMRMLKMLILPLIISSLITGLAGLDARSSGRMGTRAMVYYMSTTVIAAVLGVILVLGIHPGNPKLRGTQARSSNKDQEVSSLDAFLDLIRNLFPENLVQACFQQVQT-VLKKVAVPVDNQTEPILINKK----------------KLEFKWGMNVLGLIGFFITFGIFMGKMGEKGKLMTDFFNILNEIIMKMVSMIMWYSPVGIASLICGKIAAIGDLEVVARQLGMYMVTVIVGLIIHGGIILPIIFFAVTRKNPFVFYSGIFQAWITALGTASSAGTLPVTFRCLEENLKIDKRVTRFVLPIGATINMDGTALYEAVAAIFIAQMNDIDLDGGQIATVSMTATLASVGAASIPSAGLVTMLLILTAVGLPTQDISLLIAVDWLLDRMRTSINVVGDSFGAGIVDFLSRAELAQIDGEIPEE 498          
BLAST of slc1a-2 vs. Ensembl Cavefish
Match: slc1a9 (excitatory amino acid transporter 2-like [Source:NCBI gene;Acc:103041419])

HSP 1 Score: 426.787 bits (1096), Expect = 2.636e-140
Identity = 246/438 (56.16%), Postives = 321/438 (73.29%), Query Frame = 1
Query:  346 DDYAVMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAEILKE 1659
            D   +MLI+FPG++LM MLKMLI+PLI+SSLI+GLAGLD +SSG++G  A++YY STT++A VLG+ILV+ IHPGN  ++    + +NK +  S+LD+FLDL+RN+FP N++QA  QQ+ +  + K     D   + +L   K                  E     NVLG++ F + FG+ + +MGEK  +M  FF +LNE++MKMV +IMWYSP+GI SL+ GK+  I  LE  A  LGMYM+TVI GL IH    L +I+  + RK+P  F+ GIFQAWITALGTASSA TLP+TFRCLEE + IDKRVTRFVLPIGATINMDGTALYEAVA+IFIAQ+N   L+  QI TVS+TATLA++GAAS+PSAGLVTM+++LT+VGLPT DISL++ VDWLLDR+RTSINV+GD++GA +V  L +  L + D EI +E
Sbjct:   73 DADILMLIAFPGDILMRMLKMLILPLIISSLITGLAGLDARSSGRMGTRAMVYYMSTTVIAAVLGVILVLGIHPGNPKLRGTQARSSNKDQEVSSLDAFLDLIRNLFPENLVQACFQQVQT-VLKKVAVPVDNQTEPILINKK----------------KLEFKWGMNVLGLIGFFITFGIFMGKMGEKGKLMTDFFNILNEIIMKMVSMIMWYSPVGIASLICGKIAAIGDLEVVARQLGMYMVTVIVGLIIHGGIILPIIFFAVTRKNPFVFYSGIFQAWITALGTASSAGTLPVTFRCLEENLKIDKRVTRFVLPIGATINMDGTALYEAVAAIFIAQMNDIDLDGGQIATVSMTATLASVGAASIPSAGLVTMLLILTAVGLPTQDISLLIAVDWLLDRMRTSINVVGDSFGAGIVDFLSRAELAQIDGEIPEE 493          
BLAST of slc1a-2 vs. Ensembl Cavefish
Match: slc1a2a (solute carrier family 1 member 2a [Source:ZFIN;Acc:ZDB-GENE-100422-11])

HSP 1 Score: 421.394 bits (1082), Expect = 5.014e-140
Identity = 237/410 (57.80%), Postives = 311/410 (75.85%), Query Frame = 1
Query:  358 VMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEVTAT-ELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGD 1584
            +M+I+FPG++LM MLKMLI+PLI+SSLI+GLAGLD KSSG++G  A++YY +TT++A VLG+ILV+ IHPGN  +K  LG+G  K    S+LD+F DL+RN+FP N++QA  QQI +       A       +   +N      TT     Y V  T +     NVLG++ F + FG+++ +MGE+A +M+ FF +LNE+VM++V +IMWYSP+GI  L+ GK++ I  LE  A  LGMYM+TVI GL IH    L LIY +I R++P  FF G+FQAW+TALGTASSA TLP+TFRCLEE +GIDKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+N  +L+P QI TVS+TATLA++GAAS+PSAGLVTM+++LT+VGLPT DISL++ VDWLLDR RTS+NV+ +
Sbjct:   56 IMVIAFPGDILMRMLKMLILPLIISSLITGLAGLDAKSSGRLGTRAMVYYMTTTIIAAVLGVILVLAIHPGNPKLKANLGEG-KKNDEVSSLDAFFDLIRNLFPENLVQACFQQIQTVSSKVEIAPPPPPHPNRFGRN------TTKGAAKYIVKKTLQFKSGMNVLGLIGFFVAFGIIMGKMGERARLMLDFFNVLNEIVMRLVGMIMWYSPVGIACLICGKIISINDLEVVARQLGMYMVTVIVGLIIHGGIFLPLIYFIIVRQNPFTFFMGVFQAWVTALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVQLDPGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTQDISLLVAVDWLLDRFRTSVNVVDE 458          
BLAST of slc1a-2 vs. Ensembl Sea Lamprey
Match: slc1a4 (solute carrier family 1 member 4 [Source:ZFIN;Acc:ZDB-GENE-030616-566])

HSP 1 Score: 301.597 bits (771), Expect = 3.155e-95
Identity = 183/428 (42.76%), Postives = 274/428 (64.02%), Query Frame = 1
Query:  370 SFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNK-RRAPSTLDSFLDLL-RNIFPPNIIQAAMQQISSKYVNKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAE 1647
            SFPGELL+ MLKM+IIPL+V SL+SG A LDP+S G++G  A++++  TT++A  +G+    ++ PG   +K  +  G     ++   +DSFLDL  RNIFP N++ AA Q  ++ Y    + V  +M       N TTE  T       +V      D  N+LG+V F++ FG+ L ++G +   ++ FF   NE  M +V  IMWY+P+GI  LV  K+++++ L +  ++LG Y+L  I G  +H    L LIY    R++P  F  GI     TA GTASS+ATLP+  +C+EE  G+DK+++RF+LPIGAT+NMDG AL++ VA++FIA +N   L+  QIFT+ +TAT +++GAA +P+ G++T+ ++L +V LPT+DISLIL VDWL+DR  T INV GDA GA ++H L ++   ++  E
Sbjct:   16 SFPGELLIRMLKMIIIPLVVCSLVSGAASLDPRSLGRLGGLAILFFLVTTLIASSVGVAFAFMLKPGAGGVKPAVYTGAVALPQSKEAVDSFLDLASRNIFPANLVSAAFQSYATTY----ETVFIKM-------NLTTENGTMEIIKQEKVPVGSDADGMNILGLVMFAICFGIALRKLGPEGEALIGFFNSFNEATMVLVSWIMWYAPLGIMFLVASKIVEMDDLVQLISSLGKYILCCILGHAMHGGIILPLIYFACTRQNPYRFLLGIITPLTTAFGTASSSATLPLMIKCIEENNGVDKKISRFILPIGATVNMDGAALFQCVAAVFIAYMNNVTLDAGQIFTILVTATASSVGAAGIPAGGVLTLAIILEAVSLPTNDISLILAVDWLVDRTCTVINVEGDAIGAGILHVLSQRDQKKRGRE 432          
BLAST of slc1a-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010766.1 (pep scaffold:Pmarinus_7.0:GL477422:6105:14255:1 gene:ENSPMAG00000009750.1 transcript:ENSPMAT00000010766.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 295.434 bits (755), Expect = 4.962e-94
Identity = 181/361 (50.14%), Postives = 249/361 (68.98%), Query Frame = 1
Query:  358 VMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKTKAVTDRMLKDMLSQNKTTEGLTTNST--ITYE----VTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWI-XXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSIT 1419
            +++ISFPGE+LM MLKMLI+PLI+SSLI+GL+GLD +SSG++G  AL+YY +T++ A +LGI+LV+ IHPG+  +K   G    + +A S+ D+ LDL+RN+FP N++QA MQQ       + +      ++  LS+   T G   NST  +T +    ++A E    T  L +V F + FG+VL +MG++A  M++FF++LNE+VM+++ +++WYSPIGI SL+ GK+ ++  L      LGMYMLTVI GL IH    L L+Y VI RK+P+ FF GIFQ+          SA TLP+TFRCLEE + IDKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+N   L+  QI  V  T
Sbjct:   22 ILIISFPGEILMRMLKMLILPLIISSLITGLSGLDAQSSGRMGCRALVYYMATSVTAAILGIVLVLAIHPGDPSLKPDKGH-EEELQAVSSFDAILDLIRNVFPENLVQACMQQQDFGLHGRHERSGSANVRVTLSERSPT-GREKNSTNQVTEQRGGCISAGEHVIGTATLRLVCFVIAFGVVLGKMGDEATPMLKFFSILNEIVMRLIIIVIWYSPIGIASLICGKIAELSDLHVVMRQLGMYMLTVIVGLLIHGAVILPLVYFVITRKNPLKFFVGIFQSLTDARALCGRSAGTLPVTFRCLEENLKIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVVLDGGQIVVVRYT 380          
BLAST of slc1a-2 vs. Ensembl Sea Lamprey
Match: SLC1A2 (solute carrier family 1 member 2 [Source:HGNC Symbol;Acc:HGNC:10940])

HSP 1 Score: 214.542 bits (545), Expect = 5.412e-66
Identity = 98/139 (70.50%), Postives = 123/139 (88.49%), Query Frame = 1
Query: 1231 PITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAE 1647
            P+TFRCLEE +GIDKR+TRFVLP+GATINMDGTALYEAVA+IFIAQ+N   L+  QI TVS+TATLA++GAAS+PSAGLVTM+++LT+VGLPT DISL++ VDWLLDR+RTS+NV+GD++GA +V+HL +  LD  DA 
Sbjct:    6 PVTFRCLEENLGIDKRITRFVLPVGATINMDGTALYEAVAAIFIAQMNGVVLDGGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTSDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSRAELDAIDAR 144          
BLAST of slc1a-2 vs. Ensembl Sea Lamprey
Match: SLC1A2 (solute carrier family 1 member 2 [Source:HGNC Symbol;Acc:HGNC:10940])

HSP 1 Score: 174.481 bits (441), Expect = 2.138e-50
Identity = 97/220 (44.09%), Postives = 138/220 (62.73%), Query Frame = 1
Query:  562 HPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQ------ISSKYV---NKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWI 1194
            HPGN  +KKQLG+G       S+LD+FLDL+RN+FP N++QA  QQ      I S  V    +  AV + +  D+ + ++  E   T   ++     T    +T ++G   F + FG+++ +MG++A +MV+FF++LNE++M++V +IMWYSP GI SL+ GK+  I+ LE  A  LGMYM+TVI GL IH    L LIY  I RK+P  FF GIFQAWI
Sbjct:   10 HPGNPKLKKQLGKGQLNEEV-SSLDAFLDLIRNLFPENLVQACFQQVWTISSIRSAMVLCAPRAVAVGNGVSADLPAAHR--EMRITLPLMSLIPANTPSYWATRLIG---FFIAFGIIMGKMGDQAKLMVEFFSILNEIIMRLVIMIMWYSPFGIASLICGKISDIKDLEVVARQLGMYMITVIVGLIIHGAIILPLIYFSITRKNPFKFFVGIFQAWI 223          
BLAST of slc1a-2 vs. Ensembl Sea Lamprey
Match: slc1a1 (solute carrier family 1 member 1 [Source:ZFIN;Acc:ZDB-GENE-040718-414])

HSP 1 Score: 170.629 bits (431), Expect = 7.505e-48
Identity = 117/288 (40.62%), Postives = 182/288 (63.19%), Query Frame = 1
Query:  343 YDDYAVMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKTKAVTDRMLKDMLSQNKTTE---GLTTNSTITYEVTAT-ELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITG--LFIHACFTLTLIYVVICRKSPIGFFKGIFQA 1188
            ++   ++  SFPG++LM MLK++I+PLIVSS+I+GLA LD   SG+IG  A+ YY STT++AV+LGI LV+LI PG +    ++ + T      +T+D+ LDL+RN+FP N++QA  QQ  ++   +++   + ++ +  +   TT     L+TN T+  E   T E +   NVLG++ F + FG V+ +MG    I+  FF  LNE  M++V +IMWY PIGIF LV GK+++++   E    LG+YM TV++G  L IH+   L LIY ++ R++P  +  G+  A
Sbjct:   44 FNSLDIVYFSFPGDVLMRMLKLIILPLIVSSMITGLASLDSNVSGKIGGLAVAYYLSTTVLAVLLGIALVLLIKPGVSQSTDEIDR-TGSTPNATTVDTLLDLVRNMFPENLVQACFQQYRTR---RSEIDPEVVIVNSTASPVTTTLSMALSTNVTVIKEFRLTGEYSSGINVLGLIVFCVAFGSVIRRMGPSGEILAAFFDALNEATMRIVAIIMWYMPIGIFFLVAGKIMEVDDW-EIFRKLGLYMATVLSGSSLAIHSLVVLPLIYFIVVRRNPFSYIAGLTHA 326          
BLAST of slc1a-2 vs. Ensembl Nematostella
Match: EDO39457 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9W7])

HSP 1 Score: 334.339 bits (856), Expect = 2.778e-107
Identity = 201/456 (44.08%), Postives = 298/456 (65.35%), Query Frame = 1
Query:  358 VMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPS---TLDSFLDLLRNIFPPNIIQAA-MQQISS--------KYVNKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEVTATELT----------DSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAEILKE 1659
            +MLI FPGEL MNMLK+L++PL+V+S+I  LA LD +SS ++ +   +YY +TT++AV++G++LV  + PG+       G+   K   PS    LD+ LDL+R+ FP NII AA MQQ +          YVN+T  V +    ++ S    + G    +T    + A   T          ++ N+LG++ FS+ FG VL +MGE+ + +   F  LNEV++KM+ ++MW++PIG+ SL+  ++  +E +  + + LG+YM TVI GL  HA F L L++++  R++P+ F  G+  A +TA GT+SS ATLP T RCLE++  +D R++RFVLP+G+T+NMDGTALYE VA++FIAQI+  +L    +    +TAT A+IGA+ +P AGLVTM+MVLT+V LPT+DI LIL+VDW +DR+RT++NVLGDA GA +V HL +  L   D    +E
Sbjct:   44 IMLIGFPGELFMNMLKLLMVPLVVASVICALAALDGRSSNRVSRRTFVYYLATTLLAVIIGVVLVTFMKPGS------YGKPEGKGLKPSFYRPLDAVLDLIRSCFPSNIITAAFMQQRTHYTSTAAKVSYVNRTVNVHNMSQAELNSMRILSNGTHNYTTTPQAIRAASNTVPDGSKADSGENANILGLLVFSLVFGAVLGRMGERGVPLKALFESLNEVILKMLALVMWFAPIGVCSLIAAQMASMEDIMGSLSMLGLYMATVIAGLLAHALFILPLLFIIATRRNPLTFICGMRDALLTAFGTSSSTATLPCTIRCLEDRNRVDARISRFVLPLGSTVNMDGTALYEVVAAVFIAQIHGIELGLDDLAITCLTATAASIGASGIPQAGLVTMVMVLTAVNLPTEDIGLILSVDWFIDRIRTTVNVLGDAIGAGIVEHLSRDDLMNLDYTTREE 493          
BLAST of slc1a-2 vs. Ensembl Nematostella
Match: EDO33620 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRP9])

HSP 1 Score: 329.717 bits (844), Expect = 5.153e-105
Identity = 204/448 (45.54%), Postives = 293/448 (65.40%), Query Frame = 1
Query:  358 VMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNA--DIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYV---------NKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEV--------TATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDA 1644
            +MLI FPGEL MNMLK++I+PLIV+SLIS LA +DPK++G+IG+  L++YF TT+ A +LG+ILV+ I PG     ++KQ GQ  + R    T+DSFLDLLR++FP NI++A   Q  +KY          N T+ +T   +   ++    + G    +T+  EV        +  + +  TNVLGI  F + FG++LS+MG KA  +  FF  LN+ VM++V +IMW SPIGI S+V  KV ++  +    + +G +MLTVI+ + IH  F L L+Y V+ RK+P  F  G+  A +TA G +SS+ATLP T RC EE  G+D+R+ +FVLP+GAT+NMDG AL+E+   IFIAQIN   +E   +F   + A   ++GAA +PSAG +  ++VL SVGLP +D++L+L ++WLLDR RT++NV GDA GA +V+H+ K  L   DA
Sbjct:   63 IMLIGFPGELFMNMLKLVILPLIVASLISALACMDPKATGKIGRRVLLFYFLTTISAAILGLILVLAIRPGRVVKPVEKQ-GQPVSYR----TMDSFLDLLRSLFPNNIVEACFIQYKTKYAYDPGKYMSYNTTENITS--ITSRVTTTIISNGTHNITTVVKEVYPPSNLIPSGRQASSGTNVLGIAMFCLVFGIILSRMGAKAEPLRAFFCSLNDAVMRLVMIIMWLSPIGICSIVAAKVGEMGDIVGVLSMVGYFMLTVISSILIHGLFVLPLMYFVMTRKNPYKFMLGMGDALVTAFGISSSSATLPTTIRCAEET-GVDERIAKFVLPLGATVNMDGGALFESCVVIFIAQINGVPMEAAFLFNTVLMAAAISVGAAGIPSAGFIYPVIVLQSVGLPVEDLALVLPIEWLLDRFRTTVNVWGDAVGAGIVNHMSKADLVAMDA 502          
BLAST of slc1a-2 vs. Ensembl Nematostella
Match: EDO37906 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SED2])

HSP 1 Score: 295.434 bits (755), Expect = 4.156e-93
Identity = 197/418 (47.13%), Postives = 270/418 (64.59%), Query Frame = 1
Query:  391 MNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKK--QLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEVTAT-----ELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKK 1623
            M MLKMLI+PLI++SLI  L  LD  ++G+IG+  ++YY  TT++AV+LGI +V +I PG  D  K  ++ Q    RR    LDSFLDL+R++FP NI++A   Q+  +  N              ++   T  +TT     Y  + T       T   NVLGIV FS+ FG+VL +MGE+   +  FF  LNEV+M+M+ ++MW SPIGI SL+   ++Q+  +     ALGM++ T +  L IH    L L+Y +  R++P  +   +  A +TA GT SS+ATLP T RC EE+  +DKR+ RFVLP+GAT+NMDGTALYE V  ++IAQ+N  +L P +I T  +TAT AAIGAA +PSAGLVTM++VL +VGLPTDDI+LI +VDW +DR RT +N+ GDAYGA VV HL  K
Sbjct:    1 MAMLKMLILPLIMASLICALGVLDSSATGKIGRRTVLYYLCTTLIAVLLGIAMVSIIQPGKGDKPKGERIEQSAGPRR---NLDSFLDLIRSLFPNNIVEATFMQMEYRIRN--------------AKINGTHNITTLRNTIYGPSETIPDGYSRTWGLNVLGIVMFSIVFGIVLGRMGERGAPLKSFFETLNEVIMQMITIVMWLSPIGICSLIAKNLVQMGDIPSAFKALGMFIGTSLAALLIHGLVILPLVYFICTRRNPFKYMFNLVDALVTAFGTDSSSATLPTTIRCCEEENHVDKRIVRFVLPLGATVNMDGTALYEGVCCLWIAQMNGIELGPGEIVTTVLTATAAAIGAAGIPSAGLVTMLIVLQAVGLPTDDIALIWSVDWFIDRFRTMVNITGDAYGAGVVEHLSLK 401          
BLAST of slc1a-2 vs. Ensembl Nematostella
Match: EDO32707 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUA1])

HSP 1 Score: 259.996 bits (663), Expect = 5.580e-81
Identity = 161/332 (48.49%), Postives = 215/332 (64.76%), Query Frame = 1
Query:  649 LLRNIFPPNIIQAAMQQISSKYVNKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEV-------TATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKK 1623
            L R +FPPNI +A   Q+S+  + K    T ++  +       T  LTT   + +         T      S NVLG+V FS+  G +LS+MG+K L +  FF  LN+VVM+MV ++MWYSP+GI SL+  KV  +  +  +   LGM+MLT I G+ +H   TL +IY V+ +K+P  F KG+  A +T  GTASSAATLP T RC EE  G+D R+TRFVLP+GAT+NMDGTALYE V +I+IAQIN   L   QI T S+TAT AAIGAA+VPSAGL+TM++V  ++ +P DDI LI  VDW +DR R   N++GD+YGA +V HL K+
Sbjct:    1 LHRQVFPPNIAEATFNQVSTNTI-KQVFFTIKIFSN------GTHNLTTIRQLVHRAYDQIPGGTFPTPGSSMNVLGLVMFSIVLGAMLSKMGDKGLPLKCFFQALNDVVMRMVTLVMWYSPVGICSLIASKVAGMGDIALSLKLLGMFMLTSILGILLHTLITLPIIYYVMTKKNPFKFMKGMSDALVTVWGTASSAATLPTTIRCAEENNGLDSRITRFVLPLGATVNMDGTALYEGVGAIWIAQINNIPLTAGQIVTTSLTATAAAIGAAAVPSAGLITMVIVCQAINVPPDDIGLIFAVDWFIDRFRGLPNIMGDSYGAGIVQHLSKE 325          
BLAST of slc1a-2 vs. Ensembl Nematostella
Match: EDO28941 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T521])

HSP 1 Score: 147.902 bits (372), Expect = 1.505e-41
Identity = 80/133 (60.15%), Postives = 99/133 (74.44%), Query Frame = 1
Query: 1231 PITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTL 1629
            P T RC EE  G+D R+TRFVLP+GAT+NMDGTALYE V +I+IAQIN   L   QI T S+TAT AAIGAA+VPSAGL+TM++V  ++ +P DDI LI  VDW +DR R   N++GD+YGA +V HL K  L
Sbjct:   21 PTTIRCAEENNGLDSRITRFVLPLGATVNMDGTALYEGVGAIWIAQINNIPLTAGQIVTTSLTATAAAIGAAAVPSAGLITMVIVCQAINVPPDDIGLIFAVDWFIDRFRGLPNIMGDSYGAGIVQHLSKDEL 153          
BLAST of slc1a-2 vs. Ensembl Medaka
Match: slc1a2b (solute carrier family 1 member 2 [Source:NCBI gene;Acc:101170755])

HSP 1 Score: 455.292 bits (1170), Expect = 2.384e-153
Identity = 259/438 (59.13%), Postives = 337/438 (76.94%), Query Frame = 1
Query:  358 VMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEVT-----ATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAEILK 1656
            VM+I+FPG++LM MLKMLI+PLI+SSLI+GLAGLD KSSG++G  A++YY +TT++A VLG+ILV+LIHPGN  +K+ LG+G  K    S+LD+F DL+RN+FP N++QA  QQI +     TK V   ++++ ++   +  GL  N  IT+E       + +     NVLG++ F + FG+ + +MGE+A +M++FF +LNE+VMK+V +IMWYSP GI  L+ GK++ I+ LE  A  LGMYM+TVI GL IH    L  IY  I RK+P  FF GIFQAWITALGTASSA TLP+TFRCLEE +GIDKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+N   L+P QI TVS+TATLA++GAAS+PSAGLVTM+++LT+VGLPT DISL++ VDWLLDR RTS+NV+GD+YGA +V+HL K  LDE DA + K
Sbjct:   66 VMVIAFPGDILMRMLKMLILPLIISSLITGLAGLDAKSSGRLGTRAMVYYMTTTVIAAVLGVILVLLIHPGNPKLKENLGEG-EKNEDVSSLDAFFDLIRNLFPENLVQACFQQIQTV----TKKV--EVIEEEVNTTTSMGGLLVN--ITHEPQYIVKKSLQFKSGMNVLGLIGFFIAFGICMGKMGERARLMIEFFNILNEIVMKLVIMIMWYSPFGIACLICGKIISIKDLEVVARQLGMYMITVIIGLIIHGVIFLPSIYFAITRKNPFTFFLGIFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVHLDPGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTQDISLLVAVDWLLDRFRTSVNVVGDSYGAGIVYHLSKAELDELDAHMAK 494          
BLAST of slc1a-2 vs. Ensembl Medaka
Match: slc1a2b (solute carrier family 1 member 2 [Source:NCBI gene;Acc:101170755])

HSP 1 Score: 455.292 bits (1170), Expect = 2.750e-153
Identity = 259/438 (59.13%), Postives = 337/438 (76.94%), Query Frame = 1
Query:  358 VMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEVT-----ATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAEILK 1656
            VM+I+FPG++LM MLKMLI+PLI+SSLI+GLAGLD KSSG++G  A++YY +TT++A VLG+ILV+LIHPGN  +K+ LG+G  K    S+LD+F DL+RN+FP N++QA  QQI +     TK V   ++++ ++   +  GL  N  IT+E       + +     NVLG++ F + FG+ + +MGE+A +M++FF +LNE+VMK+V +IMWYSP GI  L+ GK++ I+ LE  A  LGMYM+TVI GL IH    L  IY  I RK+P  FF GIFQAWITALGTASSA TLP+TFRCLEE +GIDKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+N   L+P QI TVS+TATLA++GAAS+PSAGLVTM+++LT+VGLPT DISL++ VDWLLDR RTS+NV+GD+YGA +V+HL K  LDE DA + K
Sbjct:   71 VMVIAFPGDILMRMLKMLILPLIISSLITGLAGLDAKSSGRLGTRAMVYYMTTTVIAAVLGVILVLLIHPGNPKLKENLGEG-EKNEDVSSLDAFFDLIRNLFPENLVQACFQQIQTV----TKKV--EVIEEEVNTTTSMGGLLVN--ITHEPQYIVKKSLQFKSGMNVLGLIGFFIAFGICMGKMGERARLMIEFFNILNEIVMKLVIMIMWYSPFGIACLICGKIISIKDLEVVARQLGMYMITVIIGLIIHGVIFLPSIYFAITRKNPFTFFLGIFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVHLDPGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTQDISLLVAVDWLLDRFRTSVNVVGDSYGAGIVYHLSKAELDELDAHMAK 499          
BLAST of slc1a-2 vs. Ensembl Medaka
Match: slc1a2a (excitatory amino acid transporter 2-like [Source:NCBI gene;Acc:101160301])

HSP 1 Score: 442.195 bits (1136), Expect = 3.357e-148
Identity = 250/430 (58.14%), Postives = 326/430 (75.81%), Query Frame = 1
Query:  358 VMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAE 1647
            +M+I+FPGE+LM MLKMLI+PL+VSSL++GLAGLD KSSG++G  A++YY STT++A VLG+ILV+LIHPGN  ++  LG G  K    S++D+F DL+RN+FP N++QA  QQI +  + K +  T+R         +     T   ++ ++          NVLG++ F + FG+++ +MGEKA +M++FF +LNE+VMK+V  IMWYSP GI  L+ GK++ I  LE  A  LGMYM+TVI GL IH    L LIY VI +K+P  FF GIFQAW+TALGTASSA TLP+TFRCLEE +GIDKRVTRFVLP+GATINMDGTALYEAVA+IFIAQ+N   L+  QI TVS+TATLA++GAAS+PSAGLVTM+++LT+VGLPT DISL++ VDWLLDR RTS+NV+GD+YGA +V+HL K  LD  DA+
Sbjct:   66 IMIIAFPGEILMRMLKMLILPLVVSSLVTGLAGLDAKSSGRLGTRAMVYYMSTTVIAAVLGVILVLLIHPGNPKLRANLGLG-KKNDEVSSVDAFFDLIRNLFPENLVQACFQQIQT-VITKVQVPTNR--------TRAPPQFTIKRSLQFK-------SGMNVLGLIGFFVAFGVIMGKMGEKAKLMLEFFNVLNEIVMKLVGAIMWYSPFGIACLICGKIISIADLEVVARQLGMYMVTVIVGLIIHGGIFLPLIYFVIVKKNPFTFFMGIFQAWVTALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGIDLDWGQIITVSMTATLASVGAASIPSAGLVTMLLILTAVGLPTQDISLLVAVDWLLDRFRTSVNVVGDSYGAGIVYHLSKDELDMFDAQ 478          
BLAST of slc1a-2 vs. Ensembl Medaka
Match: slc1a9 (excitatory amino acid transporter 2 [Source:NCBI gene;Acc:101167791])

HSP 1 Score: 419.853 bits (1078), Expect = 9.118e-138
Identity = 248/460 (53.91%), Postives = 325/460 (70.65%), Query Frame = 1
Query:  346 DDYAVMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAEILKEAANYLEKTDETLTVLPAPKRLS 1725
            D  A+ ++SFPGE+LM MLKMLI+PLI+SSLI+GLAGLD +SSG++G  A++YY STT++A VLG+ILV+ IHPGN  ++ +      K +  S+LD+FLDL+RN+FP N++QA +QQ+ +         +++                 +  ++      E     NVLG++ F + FG+ + +MGE+  IM  FF +LNE++M MV +IMWYSP+GI SL+ GK+  I  LE  A  LGMYM+TVI GL IH    L  I+  I RKSP  F+ GIFQAWITALGTASSA TLP+TFRCLEE + IDKRVTRFVLPIGATINMDGTALYEAVA+IFIAQ+N   L+  QI TVS+TATLA++GAAS+PSAGLVTM+++LT+VGLPT DISL++ VDWLLDR+RTSINV+GD++GA +V+HL K  L + DA     A   L   +  L  +P P  L+
Sbjct:   68 DLSALTMVSFPGEVLMRMLKMLILPLIISSLITGLAGLDARSSGRMGSRAMVYYMSTTVIAAVLGVILVLGIHPGNPKLRGRTASTATKNQEVSSLDAFLDLIRNLFPENLVQACIQQVQTVVKTVQVVPSNQ-----------------SEAVSVVKKKLEYKWGMNVLGLIGFFITFGICMGRMGERGKIMCDFFNILNEIIMTMVSMIMWYSPVGISSLIAGKIAAIGDLETVARQLGMYMVTVIVGLVIHGGLILPAIFFAITRKSPFAFYSGIFQAWITALGTASSAGTLPVTFRCLEENLKIDKRVTRFVLPIGATINMDGTALYEAVAAIFIAQMNDINLDSGQIVTVSMTATLASVGAASIPSAGLVTMLLILTAVGLPTQDISLLIAVDWLLDRMRTSINVVGDSFGAGIVYHLSKGELADLDA-----AEMQLLHPEGELDFIPPPPILT 505          
BLAST of slc1a-2 vs. Ensembl Medaka
Match: SLC1A3 (solute carrier family 1 member 3 [Source:NCBI gene;Acc:101170607])

HSP 1 Score: 397.127 bits (1019), Expect = 9.136e-131
Identity = 228/438 (52.05%), Postives = 317/438 (72.37%), Query Frame = 1
Query:  358 VMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLG-QGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEVTATEL------TDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAEI 1650
            V   SFPGE+LM ML+ML++PL+VSSLI+G+A LD K+SG++G  A+IYY +TT++AV +GI++V++IHPG    K + G Q T ++ +P+  D+FLDL+RN+FPPN++QA  QQ  +KY  +T  +T       ++ N T    T N+    E+T  E+       +  N LG+V FSM FGL++  M E+  ++ +FF  LNE +M++V +IMWY+PIGI  L+ GK+++++ L +    LGMY +TVI GL IHA   L ++Y VI R++P  F  G+ QA +TALGT+SS+ATLP+TF+CLEE   IDKR+TRFVLP+GATINMDGTALYEA+A+IFIAQ+N  ++   QI T+SITAT A+IGAA +P AGLVTM++VLTSVGLPTDDI+LI+ VDW LDRLRT+ NVLGD+ GA ++  L +  L  +D E+
Sbjct:   64 VKYFSFPGEVLMRMLQMLVLPLLVSSLITGMAALDSKASGKMGMRAVIYYMTTTIIAVFIGILIVLIIHPGKGS-KAEFGKQQTIEQISPA--DAFLDLIRNMFPPNLVQACTQQFKTKYGKRTVHLT-------VTINDTFFNSTNNTQEVMEITREEMIPIPGQVNGLNALGLVVFSMCFGLIIGNMKEQGQLLREFFDGLNEAIMQLVAIIMWYAPIGILFLIAGKIVEMDDLTQMGGQLGMYTITVIIGLMIHAVLILPMLYFVITRQNPFVFIAGLLQALVTALGTSSSSATLPVTFKCLEENNKIDKRITRFVLPVGATINMDGTALYEALAAIFIAQVNNMEMNFGQIITISITATAASIGAAGIPQAGLVTMVIVLTSVGLPTDDITLIIAVDWFLDRLRTTTNVLGDSIGAGIIEFLSRHELRSKDVEM 491          
BLAST of slc1a-2 vs. Planmine SMEST
Match: SMESG000022787.1 (SMESG000022787.1)

HSP 1 Score: 1086.25 bits (2808), Expect = 0.000e+0
Identity = 595/595 (100.00%), Postives = 595/595 (100.00%), Query Frame = 1
Query:  103 MTFGKLKRRNPQDCESANDGATRELMSPDESRSPSNMSTKTCLDKVKGAFKNADNIXXXXXXXXXXXXXXXXXXXXXXXRYDDYAVMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAEILKEAANYLEKTDETLTVLPAPKRLSVALALRLNEVDGQKLHKNRSIDSGVRGNEELDGPSISKEIPNKEDNTDYKNTSV 1887
            MTFGKLKRRNPQDCESANDGATRELMSPDESRSPSNMSTKTCLDKVKGAFKNADNILVSLTVLSVVLGMGVGLVVKLTLRYDDYAVMLISFPGELLMNMLKMLIIPLIVSSLISGLAGLDPKSSGQIGKWALIYYFSTTMMAVVLGIILVVLIHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWITALGTASSAATLPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAEILKEAANYLEKTDETLTVLPAPKRLSVALALRLNEVDGQKLHKNRSIDSGVRGNEELDGPSISKEIPNKEDNTDYKNTSV
Sbjct:    1 MTFGKLKRRNPQDCESANDGATRELMSPDESRSPSNMSTKTCLDKVKGAFKNADNILVSLTVLSVVLGMGVGLVVKLTLRYDDYAVMLISFPGELLMNMLKMLIIPLIVSSLISGLAGLDPKSSGQIGKWALIYYFSTTMMAVVLGIILVVLIHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWITALGTASSAATLPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAEILKEAANYLEKTDETLTVLPAPKRLSVALALRLNEVDGQKLHKNRSIDSGVRGNEELDGPSISKEIPNKEDNTDYKNTSV 595          
BLAST of slc1a-2 vs. Planmine SMEST
Match: SMESG000064126.1 (SMESG000064126.1)

HSP 1 Score: 489.189 bits (1258), Expect = 2.120e-167
Identity = 296/463 (63.93%), Postives = 365/463 (78.83%), Query Frame = 1
Query:  250 FKNADNIXXXXXXXXXXXXXXXXXXXXXXXRYDDYAVMLISFPGELLMNMLKMXXXXXXXXXXXXXXAGLDPKSSGQIGKWALIYYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGT-NKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDE 1635
            FKN DN+LV+LT+ SVVLG+ +GL++K      D  V LI FPGE+LMNMLKMLIIPLIVSSLI+GL+GLD KSSG++G +A++YY  TT+MAV+LGIILVV IHPGN +IKK LG G+  K+    TLD+FLDL+RN+ P N+I+A  +Q  + YV K +   +   K  ++         T   I ++       +STNVLG+V+FS+ FGL+L QMG++A IM +FF +LNEVVMK+VK+IMWYSPIGIF L++GK+L+I+ L  TA++LGMYM+TV+ GL IH C TL LI+ V  RK+P  +F G+ QAW+TALGTASS+ATLPITF+CLEE  G+DKRVTRFVLPIGATINMDGTALYEAVASIFIAQIN   L   QIFT+SITATLAAIGAASVPSAGLVTMI+VLTSVGLP +DI+LIL VDWLLDR+RTSINVLGDA+GA +V HLCKK L+E
Sbjct:   15 FKNKDNVLVALTIASVVLGLAMGLLLKFVATISDRQVYLIGFPGEMLMNMLKMLIIPLIVSSLITGLSGLDAKSSGKMGLYAIVYYVVTTLMAVILGIILVVAIHPGNPNIKKSLGPGSMTKKTDTDTLDAFLDLIRNLLPVNLIEACFRQSQTNYVTKLEHFYENGTKVFIN--------VTKMVINHQ-------ESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEE 462          
BLAST of slc1a-2 vs. Planmine SMEST
Match: SMESG000022787.1 (SMESG000022787.1)

HSP 1 Score: 387.111 bits (993), Expect = 7.773e-132
Identity = 190/190 (100.00%), Postives = 190/190 (100.00%), Query Frame = 1
Query: 1318 MDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAEILKEAANYLEKTDETLTVLPAPKRLSVALALRLNEVDGQKLHKNRSIDSGVRGNEELDGPSISKEIPNKEDNTDYKNTSV 1887
            MDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAEILKEAANYLEKTDETLTVLPAPKRLSVALALRLNEVDGQKLHKNRSIDSGVRGNEELDGPSISKEIPNKEDNTDYKNTSV
Sbjct:    1 MDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDEQDAEILKEAANYLEKTDETLTVLPAPKRLSVALALRLNEVDGQKLHKNRSIDSGVRGNEELDGPSISKEIPNKEDNTDYKNTSV 190          
BLAST of slc1a-2 vs. Planmine SMEST
Match: SMESG000064127.1 (SMESG000064127.1)

HSP 1 Score: 370.933 bits (951), Expect = 1.066e-122
Identity = 212/393 (53.94%), Postives = 284/393 (72.26%), Query Frame = 1
Query:  502 YYFSTTMMAXXXXXXXXXXXHPGNADIKKQLGQGTNKRR-APSTLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKT-KAVTDRMLKDMLSQNKTTEGLTTNSTITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKK-------TLDEQDAEIL 1653
            YY  TT+MAV++GIILVV IHPG+  +K  L      R+  P TLD+FLDL+RNIFP N+I +  +Q S+ YV++  K + +  LKD+           TN    Y+       D+TN+LG+++FS+ FGLV+  +G++A ++++ F +LN  +MK+V +IMWYSP GI  L++GK+++I  L  T  +LG YMLTV+ GL IHA   L L+Y +I RK+P  +F+G+ QA ITALGT+SS+ATLP+T +C+EE   IDKR++R VLPIGATINMDGTALYEAVASIFIAQINA  L   QI T+SITATLAA+GAAS+PS GL+TMI+VLTSVGLP DDISL+++VDWLLDR RT++NVLGDAYGA +V  LC+         +D Q+ ++L
Sbjct:    3 YYLFTTLMAVIIGIILVVSIHPGDPTVKDNLEPSKPGRKIPPKTLDAFLDLIRNIFPVNLISSCFRQASTFYVSEVEKILLNGTLKDVN---------ITNIRHGYQ-------DATNILGLLSFSIVFGLVIGNIGKEADVLIKIFHILNIAIMKIVNMIMWYSPFGIMFLIMGKIIEIRDLRTTVQSLGWYMLTVLLGLLIHAGIVLNLLYFIIVRKNPALYFRGMLQAVITALGTSSSSATLPVTIKCVEEINQIDKRISRLVLPIGATINMDGTALYEAVASIFIAQINAIPLNFGQILTISITATLAAVGAASIPSGGLITMIIVLTSVGLPIDDISLLISVDWLLDRFRTAVNVLGDAYGAGIVGSLCQVDSANTVLPVDNQNEQVL 379          
BLAST of slc1a-2 vs. Planmine SMEST
Match: SMESG000064127.1 (SMESG000064127.1)

HSP 1 Score: 360.918 bits (925), Expect = 4.981e-119
Identity = 208/386 (53.89%), Postives = 279/386 (72.28%), Query Frame = 1
Query:  523 MAXXXXXXXXXXXHPGNADIKKQLGQGTNKRR-APSTLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKT-KAVTDRMLKDMLSQNKTTEGLTTNSTITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWIXXXXXXXXXXXXPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKK-------TLDEQDAEIL 1653
            MAV++GIILVV IHPG+  +K  L      R+  P TLD+FLDL+RNIFP N+I +  +Q S+ YV++  K + +  LKD+           TN    Y+       D+TN+LG+++FS+ FGLV+  +G++A ++++ F +LN  +MK+V +IMWYSP GI  L++GK+++I  L  T  +LG YMLTV+ GL IHA   L L+Y +I RK+P  +F+G+ QA ITALGT+SS+ATLP+T +C+EE   IDKR++R VLPIGATINMDGTALYEAVASIFIAQINA  L   QI T+SITATLAA+GAAS+PS GL+TMI+VLTSVGLP DDISL+++VDWLLDR RT++NVLGDAYGA +V  LC+         +D Q+ ++L
Sbjct:    1 MAVIIGIILVVSIHPGDPTVKDNLEPSKPGRKIPPKTLDAFLDLIRNIFPVNLISSCFRQASTFYVSEVEKILLNGTLKDVN---------ITNIRHGYQ-------DATNILGLLSFSIVFGLVIGNIGKEADVLIKIFHILNIAIMKIVNMIMWYSPFGIMFLIMGKIIEIRDLRTTVQSLGWYMLTVLLGLLIHAGIVLNLLYFIIVRKNPALYFRGMLQAVITALGTSSSSATLPVTIKCVEEINQIDKRISRLVLPIGATINMDGTALYEAVASIFIAQINAIPLNFGQILTISITATLAAVGAASIPSGGLITMIIVLTSVGLPIDDISLLISVDWLLDRFRTAVNVLGDAYGAGIVGSLCQVDSANTVLPVDNQNEQVL 370          
The following BLAST results are available for this feature:
BLAST of slc1a-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC1A21.590e-14557.92solute carrier family 1 member 2 [Source:HGNC Symb... [more]
SLC1A21.830e-14557.92solute carrier family 1 member 2 [Source:HGNC Symb... [more]
SLC1A21.830e-14557.92solute carrier family 1 member 2 [Source:HGNC Symb... [more]
SLC1A21.830e-14557.92solute carrier family 1 member 2 [Source:HGNC Symb... [more]
SLC1A21.830e-14557.92solute carrier family 1 member 2 [Source:HGNC Symb... [more]
back to top
BLAST of slc1a-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glt-12.929e-15156.53Excitatory amino acid transporter [Source:UniProt... [more]
glt-17.980e-15156.53Excitatory amino acid transporter [Source:UniProt... [more]
glt-35.562e-12150.93Putative sodium-dependent excitatory amino acid tr... [more]
glt-51.435e-11951.84Amino acid transporter [Source:UniProtKB/TrEMBL;A... [more]
glt-61.356e-11847.45Putative sodium-dependent excitatory amino acid tr... [more]
back to top
BLAST of slc1a-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Eaat27.722e-9245.64gene:FBgn0026438 transcript:FBtr0078043[more]
Eaat27.722e-9245.64gene:FBgn0026438 transcript:FBtr0301317[more]
Eaat21.092e-9145.64gene:FBgn0026438 transcript:FBtr0301316[more]
Eaat11.159e-8943.22gene:FBgn0026439 transcript:FBtr0079800[more]
Eaat11.159e-8943.22gene:FBgn0026439 transcript:FBtr0079801[more]
back to top
BLAST of slc1a-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc1a2b9.928e-15459.59solute carrier family 1 member 2b [Source:ZFIN;Acc... [more]
slc1a2b4.114e-15359.59solute carrier family 1 member 2b [Source:ZFIN;Acc... [more]
slc1a2b4.733e-15359.59solute carrier family 1 member 2b [Source:ZFIN;Acc... [more]
slc1a2b7.055e-15359.59solute carrier family 1 member 2b [Source:ZFIN;Acc... [more]
slc1a2a4.865e-15058.01solute carrier family 1 member 2a [Source:ZFIN;Acc... [more]
back to top
BLAST of slc1a-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC1A22.065e-15159.40solute carrier family 1 member 2 [Source:NCBI gene... [more]
SLC1A22.358e-15159.40solute carrier family 1 member 2 [Source:NCBI gene... [more]
SLC1A22.705e-15159.40solute carrier family 1 member 2 [Source:NCBI gene... [more]
SLC1A22.772e-15159.40solute carrier family 1 member 2 [Source:NCBI gene... [more]
SLC1A22.790e-15159.40solute carrier family 1 member 2 [Source:NCBI gene... [more]
back to top
BLAST of slc1a-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc1a21.912e-15358.96solute carrier family 1 (glial high affinity gluta... [more]
Slc1a23.101e-15358.96solute carrier family 1 (glial high affinity gluta... [more]
Slc1a23.777e-15358.96solute carrier family 1 (glial high affinity gluta... [more]
Slc1a24.021e-15358.96solute carrier family 1 (glial high affinity gluta... [more]
Slc1a31.144e-12652.07solute carrier family 1 (glial high affinity gluta... [more]
back to top
BLAST of slc1a-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P43006|EAA2_MOUSE2.169e-15258.96Excitatory amino acid transporter 2 OS=Mus musculu... [more]
sp|P31596|EAA2_RAT2.871e-15258.96Excitatory amino acid transporter 2 OS=Rattus norv... [more]
sp|Q10901|EAA1_CAEEL1.015e-14956.53Excitatory amino acid transporter OS=Caenorhabditi... [more]
sp|Q25605|EAAT_ONCVO6.828e-14855.63Excitatory amino acid transporter OS=Onchocerca vo... [more]
sp|P43004|EAA2_HUMAN1.330e-14457.92Excitatory amino acid transporter 2 OS=Homo sapien... [more]
back to top
BLAST of slc1a-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YF080.000e+0100.00Amino acid transporter OS=Schmidtea mediterranea O... [more]
A0A4E0RAH70.000e+060.26Amino acid transporter OS=Fasciola hepatica OX=619... [more]
A0A504YUN01.783e-18060.26Amino acid transporter OS=Fasciola gigantica OX=46... [more]
A0A4Z2CXD83.922e-18059.10Amino acid transporter OS=Schistosoma japonicum OX... [more]
A0A3Q0KCR16.624e-18059.03Amino acid transporter OS=Schistosoma mansoni OX=6... [more]
back to top
BLAST of slc1a-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc1a2b4.135e-15258.29solute carrier family 1 member 2 [Source:NCBI gene... [more]
slc1a2b4.454e-15258.29solute carrier family 1 member 2 [Source:NCBI gene... [more]
slc1a91.504e-14056.16excitatory amino acid transporter 2-like [Source:N... [more]
slc1a92.636e-14056.16excitatory amino acid transporter 2-like [Source:N... [more]
slc1a2a5.014e-14057.80solute carrier family 1 member 2a [Source:ZFIN;Acc... [more]
back to top
BLAST of slc1a-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc1a43.155e-9542.76solute carrier family 1 member 4 [Source:ZFIN;Acc:... [more]
ENSPMAT00000010766.14.962e-9450.14pep scaffold:Pmarinus_7.0:GL477422:6105:14255:1 ge... [more]
SLC1A25.412e-6670.50solute carrier family 1 member 2 [Source:HGNC Symb... [more]
SLC1A22.138e-5044.09solute carrier family 1 member 2 [Source:HGNC Symb... [more]
slc1a17.505e-4840.63solute carrier family 1 member 1 [Source:ZFIN;Acc:... [more]
back to top
BLAST of slc1a-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc1a-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO394572.778e-10744.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO336205.153e-10545.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379064.156e-9347.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO327075.580e-8148.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO289411.505e-4160.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc1a-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc1a2b2.384e-15359.13solute carrier family 1 member 2 [Source:NCBI gene... [more]
slc1a2b2.750e-15359.13solute carrier family 1 member 2 [Source:NCBI gene... [more]
slc1a2a3.357e-14858.14excitatory amino acid transporter 2-like [Source:N... [more]
slc1a99.118e-13853.91excitatory amino acid transporter 2 [Source:NCBI g... [more]
SLC1A39.136e-13152.05solute carrier family 1 member 3 [Source:NCBI gene... [more]
back to top
BLAST of slc1a-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022787.10.000e+0100.00SMESG000022787.1[more]
SMESG000064126.12.120e-16763.93SMESG000064126.1[more]
SMESG000022787.17.773e-132100.00SMESG000022787.1[more]
SMESG000064127.11.066e-12253.94SMESG000064127.1[more]
SMESG000064127.14.981e-11953.89SMESG000064127.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30011216
GenBankAKN21392.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011216 ID=SMED30011216|Name=slc1a-2|organism=Schmidtea mediterranea sexual|type=transcript|length=2079bp
GCAATAAAAAAGAACAAGCATTTCCAAATTGAATTTTATTGGCATATATA
TTTATAAAAATATTTTTTTATATTTGTCTGTGATTATATTCCAAATAATA
AAATGACTTTTGGAAAGCTTAAACGCCGAAATCCACAAGATTGTGAATCT
GCAAATGATGGAGCCACACGAGAACTGATGAGTCCAGATGAATCCAGATC
TCCTTCAAATATGTCAACAAAAACATGCCTAGATAAAGTTAAAGGAGCCT
TCAAAAATGCTGACAATATTCTTGTTTCACTTACCGTTTTGTCTGTGGTT
TTGGGAATGGGAGTCGGTCTAGTCGTCAAGTTAACTCTGAGATACGATGA
TTATGCAGTTATGCTCATCTCTTTTCCAGGAGAATTACTAATGAATATGT
TGAAAATGCTCATAATCCCTTTAATTGTATCAAGTCTTATTTCAGGTCTA
GCTGGTTTGGATCCAAAAAGTAGTGGACAGATAGGAAAATGGGCTCTAAT
TTATTATTTTTCAACAACAATGATGGCAGTTGTTTTGGGAATTATTCTTG
TTGTTTTAATTCATCCAGGAAATGCGGATATTAAAAAACAACTTGGCCAA
GGAACGAACAAACGTCGAGCCCCATCTACTTTGGATTCATTTTTAGATTT
ATTAAGAAATATCTTTCCCCCTAACATTATCCAAGCAGCAATGCAACAGA
TCTCTTCGAAATATGTTAATAAAACTAAAGCCGTAACCGATAGGATGTTG
AAAGATATGTTGAGTCAAAATAAAACCACAGAAGGTCTTACAACTAATTC
AACAATTACGTATGAAGTTACAGCAACTGAACTTACGGATTCAACAAATG
TTTTAGGTATTGTTGCATTCTCAATGTGGTTTGGGCTAGTTCTTAGTCAA
ATGGGAGAAAAGGCGTTGATAATGGTTCAGTTTTTTGCTTTACTTAATGA
AGTGGTCATGAAAATGGTAAAAGTAATCATGTGGTATTCACCAATTGGAA
TATTTTCTCTGGTAATAGGAAAGGTTTTACAAATTGAAAGTCTGGAAGAA
ACCGCAGCGGCTTTAGGAATGTATATGTTAACAGTAATCACCGGTCTGTT
TATTCACGCGTGTTTTACGCTCACACTTATTTATGTTGTAATATGTAGGA
AAAGTCCTATTGGATTTTTCAAAGGGATTTTTCAAGCCTGGATAACTGCT
CTTGGCACAGCTTCAAGTGCTGCAACGTTACCAATCACATTTCGATGTTT
AGAAGAAAAAATTGGTATTGACAAAAGGGTAACAAGATTCGTATTGCCTA
TAGGCGCTACAATAAATATGGATGGAACTGCTCTTTACGAAGCTGTGGCA
TCTATATTTATCGCACAAATAAATGCCAGGAAACTGGAACCCATACAAAT
ATTTACTGTCAGTATAACAGCAACACTGGCTGCGATTGGCGCGGCTAGCG
TGCCCAGTGCCGGTTTAGTTACAATGATTATGGTTTTGACCTCTGTTGGA
CTTCCTACGGATGATATATCTTTAATATTGACAGTTGATTGGCTTTTAGA
TCGACTTAGAACATCAATTAATGTCCTTGGAGATGCCTATGGAGCAGCAG
TCGTTCATCACCTATGTAAAAAGACACTCGATGAACAAGACGCAGAAATT
CTAAAAGAAGCTGCAAATTATTTAGAAAAAACAGATGAAACGCTCACTGT
TCTTCCTGCACCAAAAAGGTTAAGTGTTGCTCTCGCGTTGAGACTAAATG
AGGTGGATGGCCAAAAGTTACATAAAAACAGATCCATTGACAGTGGAGTT
CGAGGTAATGAAGAATTAGATGGACCAAGTATTTCTAAAGAAATTCCGAA
TAAAGAAGACAATACTGATTATAAAAATACATCTGTCTAAATGATATTTA
ATATTCAAATTAATTGTTCATTATTTTTATGATGTTACATCATTTATGTT
ACCCTTAGATTATTCTGATAGTTGTTTCATCTAGATGATAGTGGTCTTGT
TTCTTGTGTAACCAATGATTTATATATTTATTCTTTATATTTGTTTATTA
TAATAGATCTGTATTTCAATGAAAAAAAA
back to top

protein sequence of SMED30011216-orf-1

>SMED30011216-orf-1 ID=SMED30011216-orf-1|Name=SMED30011216-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=596bp
MTFGKLKRRNPQDCESANDGATRELMSPDESRSPSNMSTKTCLDKVKGAF
KNADNILVSLTVLSVVLGMGVGLVVKLTLRYDDYAVMLISFPGELLMNML
KMLIIPLIVSSLISGLAGLDPKSSGQIGKWALIYYFSTTMMAVVLGIILV
VLIHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQI
SSKYVNKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEVTATELTDSTNV
LGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGI
FSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRK
SPIGFFKGIFQAWITALGTASSAATLPITFRCLEEKIGIDKRVTRFVLPI
GATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASV
PSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAV
VHHLCKKTLDEQDAEILKEAANYLEKTDETLTVLPAPKRLSVALALRLNE
VDGQKLHKNRSIDSGVRGNEELDGPSISKEIPNKEDNTDYKNTSV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR036458Na:dicarbo_symporter_sf
IPR001991Na-dicarboxylate_symporter
IPR018107Na-dicarboxylate_symporter_CS
Vocabulary: molecular function
TermDefinition
GO:0015293symporter activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0055085transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00173EDTRNSPORTcoord: 396..422
score: 86.09
coord: 292..311
score: 50.68
coord: 329..348
score: 41.76
coord: 128..153
score: 50.94
coord: 245..267
score: 42.89
coord: 99..119
score: 67.18
coord: 431..450
score: 62.43
coord: 55..75
score: 42.6
coord: 458..478
score: 61.52
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 559..587
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..38
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 559..595
NoneNo IPR availablePANTHERPTHR11958SODIUM/DICARBOXYLATE SYMPORTER-RELATEDcoord: 54..526
NoneNo IPR availableTMHMMTMhelixcoord: 56..75
NoneNo IPR availableTMHMMTMhelixcoord: 258..280
NoneNo IPR availableTMHMMTMhelixcoord: 130..152
NoneNo IPR availableTMHMMTMhelixcoord: 398..420
NoneNo IPR availableTMHMMTMhelixcoord: 95..117
NoneNo IPR availableTMHMMTMhelixcoord: 433..455
NoneNo IPR availableTMHMMTMhelixcoord: 324..346
NoneNo IPR availableTMHMMTMhelixcoord: 359..378
NoneNo IPR availableTMHMMTMhelixcoord: 292..314
IPR001991Sodium:dicarboxylate symporterPFAMPF00375SDFcoord: 60..503
e-value: 6.4E-127
score: 423.8
IPR036458Sodium:dicarboxylate symporter superfamilyGENE3DG3DSA:1.10.3860.10coord: 215..522
e-value: 2.6E-98
score: 331.5
coord: 50..206
e-value: 4.4E-34
score: 119.8
IPR036458Sodium:dicarboxylate symporter superfamilySUPERFAMILYSSF118215Proton glutamate symport proteincoord: 57..503
IPR018107Sodium:dicarboxylate symporter, conserved sitePROSITEPS00713NA_DICARBOXYL_SYMP_1coord: 92..106
IPR018107Sodium:dicarboxylate symporter, conserved sitePROSITEPS00714NA_DICARBOXYL_SYMP_2coord: 399..422