Piezo-type mechanosensitive ion channel component

Overview
NamePiezo-type mechanosensitive ion channel component
Smed IDSMED30011204
Length (bp)7801
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Piezo-type mechanosensitive ion channel component (SMED30011204) t-SNE clustered cells

Violin plots show distribution of expression levels for Piezo-type mechanosensitive ion channel component (SMED30011204) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Piezo-type mechanosensitive ion channel component (SMED30011204) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Piezo-type mechanosensitive ion channel component (SMED30011204) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011204

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30011204SMESG000010240.1 SmedASXL_018511SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30011204SMESG000010240.1 dd_Smed_v4_13866_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011204SMESG000010240.1 dd_Smed_v4_13866_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011204SMESG000010240.1 dd_Smed_v4_13866_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Human
Match: PIEZO1 (piezo type mechanosensitive ion channel component 1 [Source:HGNC Symbol;Acc:HGNC:28993])

HSP 1 Score: 415.231 bits (1066), Expect = 6.279e-116
Identity = 331/1217 (27.20%), Postives = 584/1217 (47.99%), Query Frame = 1
Query:  811 HWATQSLFAFFNIVITGFAGIISPXXXXXXXXXXXXXXXTFWACGNNVMTSNFARMRLFLLLYSAAHVCLIFIVQLEFMQLYIPTGQRLSRLLGLY-LMFDTNCKNRGEIIFNNQRSID---YVSPFIILYVYYLSAIETRIWLEERKRINKERPAVDKETFI--HTESYLSGEEINQEESQRISNSFNVEIGSNVSDGPYIDFTDVPHVLDAQNSRSTLFIEEDITKDMEKNQVKERPLLLSIINTMISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNL-PELPTIFRISSSEMQSSEIGLHKSLIPTGPLAAMMSFLVVFWLTLRLFMTDE---------KINKSKICNEKISTQQKLEHYFGNVDNATYEKFVKCLKEKCENYWIFSCCFAMLFVSVNGSIVLFRIXXXXXXXXXXXXXXXSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIIQVRYFHSRFLELTSMKQ-----TQVCVESERERVKS-------------------------SKDE-----MDKNKFSVKNTVEFIRDVNNMVFTATEKLKSLYTLTQPSIWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSASIVILKMIYQIKIFQTFNWLTNCSQYGNFANSS----MEI---------IDNAKWLGLEK----LENFQLHILKWTAILVGCAVWHIVRYHQMQFYKLNLDQKP-KTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRID-VYSXXXXXXXXXXXXXXXXXCNVLWLPYMIFLGILLPVQYVICVGLPPGLCIEYPLN---VIP---KLRQWLYLPNYKVSPVPGKILADFVQYIFVVLQYQVFQMEKRKKSDSHKLVKQRLLEGFQKSIHK--DFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCINPMSWEIRGIHGKNADKQCSSVASGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLXXXXXXXXXXXXXXXXLNRIERKIKKIEQRQAQH 4227
            HW   +      + +   AGI  PS L+ VYLL +L + T+WAC   + T  F+R+ + +  + A H+  ++  Q+   Q  +P     +R+LGL   +  TNC +   ++ N    +D   Y SP ++L + Y +A          +++   RP+  ++     +    L   E++Q   +R S+   V    +           + H L  Q+S     +   +    ++ + +E   L S+ + ++  S++   +AMM WS+ Y SW +F+ LL +C +W +     + +  SP I+ Y   L  ++Y++  +L PELPT        +   ++GL  +  P   L AM+ + + FWL LR F+ ++          + +  + + + +  Q L    G +    Y K           YWI+ C    + VS  G +V+++IVYM L +  L +F + YS WR+ +K FWW V+ Y +  L+++Y FQFQ      +N+TG ++E L D+GL++F  S+L  S+ +P  FL+  I+Q+ YFH  F++LT M+      T++   + R+   S                         S+DE            V         V   +         + +  Q  + RL E H  K + +  V+V + +V  MN++L+++     P+PR   +      V +  I++ KM+YQ+K+     + +NC++   F NS+     EI         +D A W G+ K    L   Q H+     +L+   V+  + Y + + Y+      P     +F         ++    LKY +NF F K GLE+ F+  V V   R++ + +L    ++ +     R     LW  Y +FL + L  QY++C+G+PP LCI+YP      +P    L +WLYLP++  +P    +++DF+  +    Q+QVF  E+ ++      V    LE  +   +   +FI  +S Y+D LK  VF + +WL L ++F+TG   I++FGLGYLL  F  L  G  +L    ++ +   + ++ YN  VI++K +  L+ CVF+  ++T G CW++ LF++ C     ++ + +  ++ D       +G+ WD VCFFF++LQR +F +  +L V+ DL      +SRG  L N   +KSI+  ++ EEK L +++R++++I  +Q +H
Sbjct:  193 HWLLVAAGRVLAVTLLALAGIAHPSALSSVYLLLFLALCTWWACHFPISTRGFSRLCVAVGCFGAGHLICLYCYQMPLAQALLPPAGIWARVLGLKDFVGPTNCSSPHALVLNT--GLDWPVYASPGVLLLLCYATA--------SLRKLRAYRPSGQRKEAAKGYEARELELAELDQWPQERESDQHVVPTAPDTEAD-----NCIVHELTGQSS----VLRRPVRP--KRAEPREASPLHSLGHLIMDQSYVCALIAMMVWSITYHSWLTFVLLLWACLIWTVRSRHQLAMLCSPCILLYGMTLCCLRYVWAMDLRPELPTTL----GPVSLRQLGLEHTRYPCLDLGAMLLYTLTFWLLLRQFVKEKLLKWAESPAALTEVTVADTEPTRTQTLLQSLGELVKGVYAK-----------YWIYVCAGMFIVVSFAGRLVVYKIVYMFLFLLCLTLFQVYYSLWRKLLKAFWWLVVAYTMLVLIAVYTFQFQDFPAYWRNLTGFTDEQLGDLGLEQFSVSELFSSILVPGFFLLACILQLHYFHRPFMQLTDMEHVSLPGTRLPRWAHRQDAVSGTPLLREEQQEHQQQQQEEEEEEEDSRDEGLGVATPHQATQVPEGAAKWGLVAERLLELAAGFSDVLSRVQVFLRRLLELHVFKLVALYTVWVALKEVSVMNLLLVVLWAFALPYPRFRPMASCLSTVWTCVIIVCKMLYQLKVVNPQEYSSNCTE--PFPNSTNLLPTEISQSLLYRGPVDPANWFGVRKGFPNLGYIQNHL---QVLLL--LVFEAIVYRRQEHYRRQHQLAPLPAQAVFASGTRQQLDQDLLGCLKYFINFFFYKFGLEICFLMAVNVIGQRMNFLVTLHGCWLVAILTRRHRQAIARLWPNYCLFLALFLLYQYLLCLGMPPALCIDYPWRWSRAVPMNSALIKWLYLPDFFRAPNSTNLISDFLLLLCASQQWQVFSAERTEEWQRMAGVNTDRLEPLRGEPNPVPNFIHCRS-YLDMLKVAVFRYLFWLVLVVVFVTGATRISIFGLGYLLACFYLLLFGTALLQRDTRARLVLWDCLILYNVTVIISKNMLSLLACVFVEQMQT-GFCWVIQLFSLVCTVKGYYDPKEMMDRDQDCLLPVEEAGIIWDSVCFFFLLLQRRVFLSHYYLHVRADLQATALLASRGFALYNAANLKSIDFHRRIEEKSLAQLKRQMERIRAKQEKH 1364          

HSP 2 Score: 348.977 bits (894), Expect = 1.505e-95
Identity = 217/599 (36.23%), Postives = 349/599 (58.26%), Query Frame = 1
Query: 5764 KQLKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKI----NMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQ---NQNNTYLNISLSMKTDNA------MMWWEVNEIIQGQSYCPNPDSPAKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQH 7518
            + L++F+  + + K     DVYA+MFL +    +III G+++FG  + +       +  ++ P  F+ M++ QF  +++DRAL+LRK V GK  FQ+  V+ IH W+FF LP +T+R FN     QL YF+KC+YFALS+YQ+R GYP RILGNFLT+ YN+ NL  F+ +  +PFL ELR VMDW+WTD++++   WM VEDI++ IF++KC R  E  +P  +G+ ++ +VKY +G LI++F    IW PL+  S +  +  V   PI+ + ++ +G Y PLF  S+++ ++ P T + +EE+         +  ++  + P+D     I+ +S  +W I+PP   ++K +L    A + +    N Q    +  T   + EK +           + A+LL   + +    +V +P +FP+++ A      EAN + Q   N+   YL + + ++ +        + WW V E+ + ++ C            L + IF++++S    G + + YGI+G+Y +   V+ +F+R F+S IS+ I  EELP VDRI KL  +I+LVRE ++L LEE+L AKLIFLYRS ETMIKWT+ 
Sbjct: 1940 RPLRRFFHDILHTKYRAATDVYALMFLADVVDFIIIIFGFWAFGKHS-AATDITSSLSDDQVPEAFLVMLLIQFSTMVVDRALYLRKTVLGKLAFQVALVLAIHLWMFFILPAVTERMFNQNVVAQLWYFVKCIYFALSAYQIRCGYPTRILGNFLTKKYNHLNLFLFQGFRLVPFLVELRAVMDWVWTDTTLSLSSWMCVEDIYANIFIIKCSRETEKKYPQPKGQKKKKIVKYGMGGLIILFLIAIIWFPLLFMSLVRSVVGVVNQPIDVTVTLKLGGYEPLFTMSAQQPSIIPFTAQAYEELSRQFDPQPLAMQFISQYSPEDIVTAQIEGSSGALWRISPPSRAQMKRELYNGTADITLRFTWNFQRDLAKGGTVEYANEKHMLALAPNSTARRQLASLLEGTSDQ----SVVIPNLFPKYIRAPNG--PEANPVKQLQPNEEADYLGVRIQLRREQGAGATGFLEWW-VIELQECRTDCN----------LLPMVIFSDKVSPPSLGFL-AGYGIMGLYVSIVLVIGKFVRGFFSEISHSIMFEELPCVDRILKLCQDIFLVRETRELELEEELYAKLIFLYRSPETMIKWTRE 2519          

HSP 3 Score: 113.62 bits (283), Expect = 5.374e-24
Identity = 62/146 (42.47%), Postives = 87/146 (59.59%), Query Frame = 1
Query: 5230 SRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLN---VLPVPEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLWRDHSE 5658
             + +   LL +  +    +SE  CYF++I+NH+++ +  SL  P LVF W MLS+PRPSK FW+  I +TE+ +V KY+ QF     N   VL   E++  P   P ILG+EK+  Y   D++QL+ LF HRS L   GLW DH E
Sbjct: 1668 GQGRALRLLRAVYQCVAAHSELLCYFIIILNHMVTASAGSLVLPVLVFLWAMLSIPRPSKRFWMTAIVFTEIAVVVKYLFQFGFFPWNSHVVLRRYENK--PYFPPRILGLEKTDGYIKYDLVQLMALFFHRSQLLCYGLW-DHEE 1810          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Human
Match: PIEZO2 (piezo type mechanosensitive ion channel component 2 [Source:HGNC Symbol;Acc:HGNC:26270])

HSP 1 Score: 388.652 bits (997), Expect = 1.279e-107
Identity = 221/595 (37.14%), Postives = 360/595 (60.50%), Query Frame = 1
Query: 5758 PIKQLKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLI---NTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAMM----WWEVNEIIQGQSYCPNPDSPAKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQH 7518
            PIKQ   F+  + + + +   DVY +MFL +    +II+ G+++FG  + +       +  ++ P PF+ M++ QF  +++DRAL+LRK V GK +FQ+  V  IH W+FF LP +T+RKF+     QL YF+KCVYF LS+YQ+R GYP R+LGNFLT++YNY NL  F+ +  +PFL ELR VMDW+WTD++++   W+ VEDI++ IF+LKCWR  E  +P  RG+ ++ VVKY +G +I++     +W PL+  S I  +  V   P++ S +I +G Y P+F  S++++ ++ + +++F +  +       +  +L+++E +D T   ++  S+++W I+PP  +K+  +L  P +S  +      +R  +    +E I     S  L N  + N+  +I   +T+ + T V +  I+P ++ A   + S+      ++NN +++I++ +  DN       WW +N +   + Y PN  +       L + +FN+++S    G + + YGI+G+YA+   V+ +F+R F+S IS+ I  EELPNVDRI KL  +I+LVRE  +L LEE L AKLIFLYRS ETMIKWT+ 
Sbjct: 2170 PIKQ---FFYNLIHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHS-AAADITSSLSEDQVPGPFLVMVLIQFGTMVVDRALYLRKTVLGKVIFQVILVFGIHFWMFFILPGVTERKFSQNLVAQLWYFVKCVYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFILKCWRESEKRYPQPRGQKKKKVVKYGMGGMIIVLLICIVWFPLLFMSLIKSVAGVINQPLDVSVTITLGGYQPIFTMSAQQSQLKVMDQQSFNKFIQAFSRDTGAMQFLENYEKEDITVAELEGNSNSLWTISPPSKQKMIHELLDPNSSFSVVFSWSIQRNLSLGAKSE-IATDKLSFPLKNITRKNIAKMIAGNSTESSKTPVTIEKIYPYYVKAPSDSNSKPIKQLLSENN-FMDITIILSRDNTTKYNSEWWVLN-LTGNRIYNPNSQA-------LELVVFNDKVSPPSLGFL-AGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPNVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTRE 2749          

HSP 2 Score: 202.986 bits (515), Expect = 4.380e-51
Identity = 161/590 (27.29%), Postives = 292/590 (49.49%), Query Frame = 1
Query: 2596 QPSIWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSASIVILKMIYQIKIFQTFNWLTNCSQYG--------NFANSSM---EIIDNAKWLGLEKLENFQLHILKWTAILVGCAVWHIVRYHQMQFYK-LNLDQKPKTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNV-LWLPYMIFLGILLPVQYVICVGLPPGLCIEYPL---------NVIPKLRQWLYLPNYKVSPVPGKILADFVQYIFVVLQYQVFQMEKRKK-----SDSHKLVKQRLLEGF-QKSIHKDFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCINPMSWEIRGIHGKNADKQCS--SVASGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLXXXXXXXXXXXXXXXXLNRIERKIKKIEQRQAQHGKPELNEHYLVMRSGD 4275
            Q  +W + E H  K +   I++V + +V   N + ++      P+ +L  +  +   V +  I++ KM+YQ++  +  N+  NCS           N  N S+     ID  +W+GL K     ++ L+   +++    + +  Y   ++Y+  N    P +  IF ++      +   +  KY +N+ F K GLE  F+ +V V   R+D Y++++   L+  L  +R      +W  Y  FL  ++  QY IC+G+PP  C +YP          N+I    +WLY P++ V P P  ++ DF+  +   LQ Q+F+ E +        D+ ++        F Q +   DFI  +S Y+D  K ++F + +W  L IIFITG   I++F +GYL+  F +L  G  +L+   KS++R  + ++ YN  VI  K I  +  C ++  L     CW++  F++ C       ++G     A+  C+  S  +G+ WD +CF F++LQR +F +  FL V  D+      +SRGA L    I+K+++ + + E+K +++++R++ +I+ RQ ++ K +     L    G+
Sbjct:  931 QVFMWWILELHIIKIVSSYIIWVSVKEVSLFNYVFLISWAFALPYAKLRRLASSVCTVWTCVIIVCKMLYQLQTIKPENFSVNCSLPNENQTNIPFNELNKSLLYSAPIDPTEWVGLRKSSPLLVY-LRNNLLMLAILAFEVTIYRHQEYYRGRNNLTAPVSRTIFHDITRLHLDDGLINCAKYFINYFFYKFGLETCFLMSVNVIGQRMDFYAMIHACWLIAVLYRRRRKAIAEIWPKYCCFLACIITFQYFICIGIPPAPCRDYPWRFKGASFNDNII----KWLYFPDFIVRPNPVFLVYDFMLLLCASLQRQIFEDENKAAVRIMAGDNVEICMNLDAASFSQHNPVPDFIHCRS-YLDMSKVIIFSYLFWFVLTIIFITGTTRISIFCMGYLVACFYFLLFGGDLLLKPIKSILRYWDWLIAYNVFVITMKNILSIGACGYIGTL-VHNSCWLIQAFSLACT------VKGYQMPAANSPCTLPSGEAGIIWDSICFAFLLLQRRVFMSYYFLHVVADIKASQILASRGAELFQATIVKAVKARIEEEKKSMDQLKRQMDRIKARQQKYKKGKERMLSLTQEPGE 1507          

HSP 3 Score: 173.711 bits (439), Expect = 3.199e-42
Identity = 111/355 (31.27%), Postives = 179/355 (50.42%), Query Frame = 1
Query: 1513 LLSIINTMISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNLPELPTIFRISSSEMQSSEIGLHKSLIPTGPLAAMMSFLVVFWLTLRLFMTDEKINKSK---ICNEKISTQQKLE----------------------------------------------HYFGNVDNATYEKFVKCLKEKCENYWIFSCCFAMLFVSVNGSIVLFRIXXXXXXXXXXXXXXXSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIIQVRYFHSRFLELTSMK 2430
            ++S+   ++  S+I   +AMMAWS+ Y SW +F+ L+ SC LW+I + R   + +SP +V Y  LL+++QYI+ F LPE+  +             G  +   P G LA+ + F + FWL LR  +T++K  + K   +   KI +Q+  E                                                 GN+  A + K+           WI+ C     FVS  G IV+++I+YMVL ++ + ++ + Y +WR+ +K FW +V+ Y +  L+ IY +QF+      QN+TGL +E L D+GLK+F  ++L   +FIP  FL++ I+ + YFH RFLELT +K
Sbjct:  489 MVSVFQFIMKQSYICALIAMMAWSITYHSWLTFVLLIWSCTLWMIRNRRKYAMISSPFMVVYGNLLLILQYIWSFELPEIKKV------------PGFLEKKEP-GELASKILFTITFWLLLRQHLTEQKALQEKEALLSEVKIGSQENEEKDEELQDIQVEGEPKEEEEEEAKEEKQERKKVEQEEAEEEDEQDIMKVLGNLVVAMFIKY-----------WIYVCGGMFFFVSFEGKIVMYKIIYMVLFLFCVALYQVHYEWWRKILKYFWMSVVIYTMLVLIFIYTYQFENFPGLWQNMTGLKKEKLEDLGLKQFTVAELFTRIFIPTSFLLVCILHLHYFHDRFLELTDLK 819          

HSP 4 Score: 127.487 bits (319), Expect = 3.504e-28
Identity = 74/213 (34.74%), Postives = 113/213 (53.05%), Query Frame = 1
Query: 5173 RKSVSEDKEEKNKQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLPVPEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLW-------------------------RDHSEFYKDIKISNEEEVNHIQPLKPQSAMR 5736
            +K   +D+ E++++  F   + +F  L  +     +  SE  CYF++I+NH++S ++++L  P L+F W MLSVPRPS+ FW++ I YTE+ IV KY  QF     N   V  ++  P   P I+G+EK   Y + D+IQLL LF HRS LK +GLW                         RD S+  K I ++   E  H+   + Q+A+R
Sbjct: 1886 KKMFHDDELEESEK--FYVGQPRFLLLFYAMYNTLVARSEMVCYFVIILNHMVSASMITLLLPILIFLWAMLSVPRPSRRFWMMAIVYTEVAIVVKYFFQFGFFPWNK-NVEVNKDKPYHPPNIIGVEKKEGYVLYDLIQLLALFFHRSILKCHGLWDEDDMTESGMAREESDDELSLGHGRRDSSDSLKSINLAASVESVHVTFPEQQTAVR 2095          

HSP 5 Score: 56.9954 bits (136), Expect = 7.194e-7
Identity = 38/130 (29.23%), Postives = 72/130 (55.38%), Query Frame = 1
Query:  850 VITGFAGIISPXXXXXXXXXXXXXXXTFWACGNNVMTSNFARMRLFLLLYSAAHVCLIFIVQLEFMQLYIPTGQRLSRLLGLYLMFDTNCKNRGEIIFNNQRS-IDYVSPFIILYVYYLSAIETRIWLEE 1236
            ++ G +G++ PSL + VY   +LG+ T+W+         F+ + + L +++A H+  +++ Q +F Q  +P     +RL G+  +  T+C +  +II N   S   + +P ++L +YY  A   RIWL+E
Sbjct:  229 ILLGSSGMMLPSLTSSVYFFVFLGLCTWWSWCRTFDPLLFSCLCVLLAIFTAGHLIGLYLYQFQFFQEAVPPNDYYARLFGIKSVIQTDCSSTWKIIVNPDLSWYHHANPILLLVMYYTLATLIRIWLQE 358          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Human
Match: PIEZO2 (piezo type mechanosensitive ion channel component 2 [Source:HGNC Symbol;Acc:HGNC:26270])

HSP 1 Score: 388.267 bits (996), Expect = 1.608e-107
Identity = 221/595 (37.14%), Postives = 360/595 (60.50%), Query Frame = 1
Query: 5758 PIKQLKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLI---NTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAMM----WWEVNEIIQGQSYCPNPDSPAKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQH 7518
            PIKQ   F+  + + + +   DVY +MFL +    +II+ G+++FG  + +       +  ++ P PF+ M++ QF  +++DRAL+LRK V GK +FQ+  V  IH W+FF LP +T+RKF+     QL YF+KCVYF LS+YQ+R GYP R+LGNFLT++YNY NL  F+ +  +PFL ELR VMDW+WTD++++   W+ VEDI++ IF+LKCWR  E  +P  RG+ ++ VVKY +G +I++     +W PL+  S I  +  V   P++ S +I +G Y P+F  S++++ ++ + +++F +  +       +  +L+++E +D T   ++  S+++W I+PP  +K+  +L  P +S  +      +R  +    +E I     S  L N  + N+  +I   +T+ + T V +  I+P ++ A   + S+      ++NN +++I++ +  DN       WW +N +   + Y PN  +       L + +FN+++S    G + + YGI+G+YA+   V+ +F+R F+S IS+ I  EELPNVDRI KL  +I+LVRE  +L LEE L AKLIFLYRS ETMIKWT+ 
Sbjct: 2195 PIKQ---FFYNLIHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHS-AAADITSSLSEDQVPGPFLVMVLIQFGTMVVDRALYLRKTVLGKVIFQVILVFGIHFWMFFILPGVTERKFSQNLVAQLWYFVKCVYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFILKCWRESEKRYPQPRGQKKKKVVKYGMGGMIIVLLICIVWFPLLFMSLIKSVAGVINQPLDVSVTITLGGYQPIFTMSAQQSQLKVMDQQSFNKFIQAFSRDTGAMQFLENYEKEDITVAELEGNSNSLWTISPPSKQKMIHELLDPNSSFSVVFSWSIQRNLSLGAKSE-IATDKLSFPLKNITRKNIAKMIAGNSTESSKTPVTIEKIYPYYVKAPSDSNSKPIKQLLSENN-FMDITIILSRDNTTKYNSEWWVLN-LTGNRIYNPNSQA-------LELVVFNDKVSPPSLGFL-AGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPNVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTRE 2774          

HSP 2 Score: 202.601 bits (514), Expect = 5.430e-51
Identity = 161/590 (27.29%), Postives = 292/590 (49.49%), Query Frame = 1
Query: 2596 QPSIWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSASIVILKMIYQIKIFQTFNWLTNCSQYG--------NFANSSM---EIIDNAKWLGLEKLENFQLHILKWTAILVGCAVWHIVRYHQMQFYK-LNLDQKPKTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNV-LWLPYMIFLGILLPVQYVICVGLPPGLCIEYPL---------NVIPKLRQWLYLPNYKVSPVPGKILADFVQYIFVVLQYQVFQMEKRKK-----SDSHKLVKQRLLEGF-QKSIHKDFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCINPMSWEIRGIHGKNADKQCS--SVASGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLXXXXXXXXXXXXXXXXLNRIERKIKKIEQRQAQHGKPELNEHYLVMRSGD 4275
            Q  +W + E H  K +   I++V + +V   N + ++      P+ +L  +  +   V +  I++ KM+YQ++  +  N+  NCS           N  N S+     ID  +W+GL K     ++ L+   +++    + +  Y   ++Y+  N    P +  IF ++      +   +  KY +N+ F K GLE  F+ +V V   R+D Y++++   L+  L  +R      +W  Y  FL  ++  QY IC+G+PP  C +YP          N+I    +WLY P++ V P P  ++ DF+  +   LQ Q+F+ E +        D+ ++        F Q +   DFI  +S Y+D  K ++F + +W  L IIFITG   I++F +GYL+  F +L  G  +L+   KS++R  + ++ YN  VI  K I  +  C ++  L     CW++  F++ C       ++G     A+  C+  S  +G+ WD +CF F++LQR +F +  FL V  D+      +SRGA L    I+K+++ + + E+K +++++R++ +I+ RQ ++ K +     L    G+
Sbjct:  956 QVFMWWILELHIIKIVSSYIIWVSVKEVSLFNYVFLISWAFALPYAKLRRLASSVCTVWTCVIIVCKMLYQLQTIKPENFSVNCSLPNENQTNIPFNELNKSLLYSAPIDPTEWVGLRKSSPLLVY-LRNNLLMLAILAFEVTIYRHQEYYRGRNNLTAPVSRTIFHDITRLHLDDGLINCAKYFINYFFYKFGLETCFLMSVNVIGQRMDFYAMIHACWLIAVLYRRRRKAIAEIWPKYCCFLACIITFQYFICIGIPPAPCRDYPWRFKGASFNDNII----KWLYFPDFIVRPNPVFLVYDFMLLLCASLQRQIFEDENKAAVRIMAGDNVEICMNLDAASFSQHNPVPDFIHCRS-YLDMSKVIIFSYLFWFVLTIIFITGTTRISIFCMGYLVACFYFLLFGGDLLLKPIKSILRYWDWLIAYNVFVITMKNILSIGACGYIGTL-VHNSCWLIQAFSLACT------VKGYQMPAANSPCTLPSGEAGIIWDSICFAFLLLQRRVFMSYYFLHVVADIKASQILASRGAELFQATIVKAVKARIEEEKKSMDQLKRQMDRIKARQQKYKKGKERMLSLTQEPGE 1532          

HSP 3 Score: 173.326 bits (438), Expect = 3.522e-42
Identity = 111/355 (31.27%), Postives = 179/355 (50.42%), Query Frame = 1
Query: 1513 LLSIINTMISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNLPELPTIFRISSSEMQSSEIGLHKSLIPTGPLAAMMSFLVVFWLTLRLFMTDEKINKSK---ICNEKISTQQKLE----------------------------------------------HYFGNVDNATYEKFVKCLKEKCENYWIFSCCFAMLFVSVNGSIVLFRIXXXXXXXXXXXXXXXSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIIQVRYFHSRFLELTSMK 2430
            ++S+   ++  S+I   +AMMAWS+ Y SW +F+ L+ SC LW+I + R   + +SP +V Y  LL+++QYI+ F LPE+  +             G  +   P G LA+ + F + FWL LR  +T++K  + K   +   KI +Q+  E                                                 GN+  A + K+           WI+ C     FVS  G IV+++I+YMVL ++ + ++ + Y +WR+ +K FW +V+ Y +  L+ IY +QF+      QN+TGL +E L D+GLK+F  ++L   +FIP  FL++ I+ + YFH RFLELT +K
Sbjct:  489 MVSVFQFIMKQSYICALIAMMAWSITYHSWLTFVLLIWSCTLWMIRNRRKYAMISSPFMVVYGNLLLILQYIWSFELPEIKKV------------PGFLEKKEP-GELASKILFTITFWLLLRQHLTEQKALQEKEALLSEVKIGSQENEEKDEELQDIQVEGEPKEEEEEEAKEEKQERKKVEQEEAEEEDEQDIMKVLGNLVVAMFIKY-----------WIYVCGGMFFFVSFEGKIVMYKIIYMVLFLFCVALYQVHYEWWRKILKYFWMSVVIYTMLVLIFIYTYQFENFPGLWQNMTGLKKEKLEDLGLKQFTVAELFTRIFIPTSFLLVCILHLHYFHDRFLELTDLK 819          

HSP 4 Score: 127.102 bits (318), Expect = 3.662e-28
Identity = 74/213 (34.74%), Postives = 113/213 (53.05%), Query Frame = 1
Query: 5173 RKSVSEDKEEKNKQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLPVPEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLW-------------------------RDHSEFYKDIKISNEEEVNHIQPLKPQSAMR 5736
            +K   +D+ E++++  F   + +F  L  +     +  SE  CYF++I+NH++S ++++L  P L+F W MLSVPRPS+ FW++ I YTE+ IV KY  QF     N   V  ++  P   P I+G+EK   Y + D+IQLL LF HRS LK +GLW                         RD S+  K I ++   E  H+   + Q+A+R
Sbjct: 1911 KKMFHDDELEESEK--FYVGQPRFLLLFYAMYNTLVARSEMVCYFVIILNHMVSASMITLLLPILIFLWAMLSVPRPSRRFWMMAIVYTEVAIVVKYFFQFGFFPWNK-NVEVNKDKPYHPPNIIGVEKKEGYVLYDLIQLLALFFHRSILKCHGLWDEDDMTESGMAREESDDELSLGHGRRDSSDSLKSINLAASVESVHVTFPEQQTAVR 2120          

HSP 5 Score: 56.9954 bits (136), Expect = 7.962e-7
Identity = 38/130 (29.23%), Postives = 72/130 (55.38%), Query Frame = 1
Query:  850 VITGFAGIISPXXXXXXXXXXXXXXXTFWACGNNVMTSNFARMRLFLLLYSAAHVCLIFIVQLEFMQLYIPTGQRLSRLLGLYLMFDTNCKNRGEIIFNNQRS-IDYVSPFIILYVYYLSAIETRIWLEE 1236
            ++ G +G++ PSL + VY   +LG+ T+W+         F+ + + L +++A H+  +++ Q +F Q  +P     +RL G+  +  T+C +  +II N   S   + +P ++L +YY  A   RIWL+E
Sbjct:  229 ILLGSSGMMLPSLTSSVYFFVFLGLCTWWSWCRTFDPLLFSCLCVLLAIFTAGHLIGLYLYQFQFFQEAVPPNDYYARLFGIKSVIQTDCSSTWKIIVNPDLSWYHHANPILLLVMYYTLATLIRIWLQE 358          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Human
Match: PIEZO2 (piezo type mechanosensitive ion channel component 2 [Source:HGNC Symbol;Acc:HGNC:26270])

HSP 1 Score: 387.882 bits (995), Expect = 2.054e-107
Identity = 221/595 (37.14%), Postives = 360/595 (60.50%), Query Frame = 1
Query: 5758 PIKQLKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLI---NTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAMM----WWEVNEIIQGQSYCPNPDSPAKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQH 7518
            PIKQ   F+  + + + +   DVY +MFL +    +II+ G+++FG  + +       +  ++ P PF+ M++ QF  +++DRAL+LRK V GK +FQ+  V  IH W+FF LP +T+RKF+     QL YF+KCVYF LS+YQ+R GYP R+LGNFLT++YNY NL  F+ +  +PFL ELR VMDW+WTD++++   W+ VEDI++ IF+LKCWR  E  +P  RG+ ++ VVKY +G +I++     +W PL+  S I  +  V   P++ S +I +G Y P+F  S++++ ++ + +++F +  +       +  +L+++E +D T   ++  S+++W I+PP  +K+  +L  P +S  +      +R  +    +E I     S  L N  + N+  +I   +T+ + T V +  I+P ++ A   + S+      ++NN +++I++ +  DN       WW +N +   + Y PN  +       L + +FN+++S    G + + YGI+G+YA+   V+ +F+R F+S IS+ I  EELPNVDRI KL  +I+LVRE  +L LEE L AKLIFLYRS ETMIKWT+ 
Sbjct: 2121 PIKQ---FFYNLIHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHS-AAADITSSLSEDQVPGPFLVMVLIQFGTMVVDRALYLRKTVLGKVIFQVILVFGIHFWMFFILPGVTERKFSQNLVAQLWYFVKCVYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFILKCWRESEKRYPQPRGQKKKKVVKYGMGGMIIVLLICIVWFPLLFMSLIKSVAGVINQPLDVSVTITLGGYQPIFTMSAQQSQLKVMDQQSFNKFIQAFSRDTGAMQFLENYEKEDITVAELEGNSNSLWTISPPSKQKMIHELLDPNSSFSVVFSWSIQRNLSLGAKSE-IATDKLSFPLKNITRKNIAKMIAGNSTESSKTPVTIEKIYPYYVKAPSDSNSKPIKQLLSENN-FMDITIILSRDNTTKYNSEWWVLN-LTGNRIYNPNSQA-------LELVVFNDKVSPPSLGFL-AGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPNVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTRE 2700          

HSP 2 Score: 197.208 bits (500), Expect = 2.011e-49
Identity = 160/589 (27.16%), Postives = 291/589 (49.41%), Query Frame = 1
Query: 2605 IWRLWECHFTKFLVILIVYVCIID--VHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSASIVILKMIYQIKIFQTFNWLTNCSQYG--------NFANSSM---EIIDNAKWLGLEKLENFQLHILKWTAILVGCAVWHIVRYHQMQFYK-LNLDQKPKTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNV-LWLPYMIFLGILLPVQYVICVGLPPGLCIEYPL---------NVIPKLRQWLYLPNYKVSPVPGKILADFVQYIFVVLQYQVFQMEKRKK-----SDSHKLVKQRLLEGF-QKSIHKDFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCINPMSWEIRGIHGKNADKQCS--SVASGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLXXXXXXXXXXXXXXXXLNRIERKIKKIEQRQAQHGKPELNEHYLVMRSGD 4275
            +W + E H  K +   I++V + +  V   N + ++      P+ +L  +  +   V +  I++ KM+YQ++  +  N+  NCS           N  N S+     ID  +W+GL K     ++ L+   +++    + +  Y   ++Y+  N    P +  IF ++      +   +  KY +N+ F K GLE  F+ +V V   R+D Y++++   L+  L  +R      +W  Y  FL  ++  QY IC+G+PP  C +YP          N+I    +WLY P++ V P P  ++ DF+  +   LQ Q+F+ E +        D+ ++        F Q +   DFI  +S Y+D  K ++F + +W  L IIFITG   I++F +GYL+  F +L  G  +L+   KS++R  + ++ YN  VI  K I  +  C ++  L     CW++  F++ C       ++G     A+  C+  S  +G+ WD +CF F++LQR +F +  FL V  D+      +SRGA L    I+K+++ + + E+K +++++R++ +I+ RQ ++ K +     L    G+
Sbjct:  883 MWWILELHIIKIVSSYIIWVSVKEARVSLFNYVFLISWAFALPYAKLRRLASSVCTVWTCVIIVCKMLYQLQTIKPENFSVNCSLPNENQTNIPFNELNKSLLYSAPIDPTEWVGLRKSSPLLVY-LRNNLLMLAILAFEVTIYRHQEYYRGRNNLTAPVSRTIFHDITRLHLDDGLINCAKYFINYFFYKFGLETCFLMSVNVIGQRMDFYAMIHACWLIAVLYRRRRKAIAEIWPKYCCFLACIITFQYFICIGIPPAPCRDYPWRFKGASFNDNII----KWLYFPDFIVRPNPVFLVYDFMLLLCASLQRQIFEDENKAAVRIMAGDNVEICMNLDAASFSQHNPVPDFIHCRS-YLDMSKVIIFSYLFWFVLTIIFITGTTRISIFCMGYLVACFYFLLFGGDLLLKPIKSILRYWDWLIAYNVFVITMKNILSIGACGYIGTL-VHNSCWLIQAFSLACT------VKGYQMPAANSPCTLPSGEAGIIWDSICFAFLLLQRRVFMSYYFLHVVADIKASQILASRGAELFQATIVKAVKARIEEEKKSMDQLKRQMDRIKARQQKYKKGKERMLSLTQEPGE 1458          

HSP 3 Score: 173.326 bits (438), Expect = 3.757e-42
Identity = 111/355 (31.27%), Postives = 179/355 (50.42%), Query Frame = 1
Query: 1513 LLSIINTMISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNLPELPTIFRISSSEMQSSEIGLHKSLIPTGPLAAMMSFLVVFWLTLRLFMTDEKINKSK---ICNEKISTQQKLE----------------------------------------------HYFGNVDNATYEKFVKCLKEKCENYWIFSCCFAMLFVSVNGSIVLFRIXXXXXXXXXXXXXXXSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIIQVRYFHSRFLELTSMK 2430
            ++S+   ++  S+I   +AMMAWS+ Y SW +F+ L+ SC LW+I + R   + +SP +V Y  LL+++QYI+ F LPE+  +             G  +   P G LA+ + F + FWL LR  +T++K  + K   +   KI +Q+  E                                                 GN+  A + K+           WI+ C     FVS  G IV+++I+YMVL ++ + ++ + Y +WR+ +K FW +V+ Y +  L+ IY +QF+      QN+TGL +E L D+GLK+F  ++L   +FIP  FL++ I+ + YFH RFLELT +K
Sbjct:  438 MVSVFQFIMKQSYICALIAMMAWSITYHSWLTFVLLIWSCTLWMIRNRRKYAMISSPFMVVYGNLLLILQYIWSFELPEIKKV------------PGFLEKKEP-GELASKILFTITFWLLLRQHLTEQKALQEKEALLSEVKIGSQENEEKDEELQDIQVEGEPKEEEEEEAKEEKQERKKVEQEEAEEEDEQDIMKVLGNLVVAMFIKY-----------WIYVCGGMFFFVSFEGKIVMYKIIYMVLFLFCVALYQVHYEWWRKILKYFWMSVVIYTMLVLIFIYTYQFENFPGLWQNMTGLKKEKLEDLGLKQFTVAELFTRIFIPTSFLLVCILHLHYFHDRFLELTDLK 768          

HSP 4 Score: 127.102 bits (318), Expect = 4.022e-28
Identity = 74/213 (34.74%), Postives = 113/213 (53.05%), Query Frame = 1
Query: 5173 RKSVSEDKEEKNKQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLPVPEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLW-------------------------RDHSEFYKDIKISNEEEVNHIQPLKPQSAMR 5736
            +K   +D+ E++++  F   + +F  L  +     +  SE  CYF++I+NH++S ++++L  P L+F W MLSVPRPS+ FW++ I YTE+ IV KY  QF     N   V  ++  P   P I+G+EK   Y + D+IQLL LF HRS LK +GLW                         RD S+  K I ++   E  H+   + Q+A+R
Sbjct: 1837 KKMFHDDELEESEK--FYVGQPRFLLLFYAMYNTLVARSEMVCYFVIILNHMVSASMITLLLPILIFLWAMLSVPRPSRRFWMMAIVYTEVAIVVKYFFQFGFFPWNK-NVEVNKDKPYHPPNIIGVEKKEGYVLYDLIQLLALFFHRSILKCHGLWDEDDMTESGMAREESDDELSLGHGRRDSSDSLKSINLAASVESVHVTFPEQQTAVR 2046          

HSP 5 Score: 56.9954 bits (136), Expect = 7.811e-7
Identity = 38/130 (29.23%), Postives = 72/130 (55.38%), Query Frame = 1
Query:  850 VITGFAGIISPXXXXXXXXXXXXXXXTFWACGNNVMTSNFARMRLFLLLYSAAHVCLIFIVQLEFMQLYIPTGQRLSRLLGLYLMFDTNCKNRGEIIFNNQRS-IDYVSPFIILYVYYLSAIETRIWLEE 1236
            ++ G +G++ PSL + VY   +LG+ T+W+         F+ + + L +++A H+  +++ Q +F Q  +P     +RL G+  +  T+C +  +II N   S   + +P ++L +YY  A   RIWL+E
Sbjct:  178 ILLGSSGMMLPSLTSSVYFFVFLGLCTWWSWCRTFDPLLFSCLCVLLAIFTAGHLIGLYLYQFQFFQEAVPPNDYYARLFGIKSVIQTDCSSTWKIIVNPDLSWYHHANPILLLVMYYTLATLIRIWLQE 307          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Human
Match: PIEZO2 (piezo type mechanosensitive ion channel component 2 [Source:HGNC Symbol;Acc:HGNC:26270])

HSP 1 Score: 207.994 bits (528), Expect = 1.242e-52
Identity = 102/220 (46.36%), Postives = 150/220 (68.18%), Query Frame = 1
Query: 5758 PIKQLKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGE 6417
            PIKQ   F+  + + + +   DVY +MFL +    +II+ G+++FG  + +       +  ++ P PF+ M++ QF  +++DRAL+LRK V GK +FQ+  V  IH W+FF LP +T+RKF+     QL YF+KCVYF LS+YQ+R GYP R+LGNFLT++YNY NL  F+ +  +PFL ELR VMDW+WTD++++   W+ VEDI++ IF+LKCWR  E
Sbjct: 2170 PIKQ---FFYNLIHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHS-AAADITSSLSEDQVPGPFLVMVLIQFGTMVVDRALYLRKTVLGKVIFQVILVFGIHFWMFFILPGVTERKFSQNLVAQLWYFVKCVYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFILKCWRESE 2385          

HSP 2 Score: 202.986 bits (515), Expect = 3.978e-51
Identity = 161/590 (27.29%), Postives = 292/590 (49.49%), Query Frame = 1
Query: 2596 QPSIWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSASIVILKMIYQIKIFQTFNWLTNCSQYG--------NFANSSM---EIIDNAKWLGLEKLENFQLHILKWTAILVGCAVWHIVRYHQMQFYK-LNLDQKPKTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNV-LWLPYMIFLGILLPVQYVICVGLPPGLCIEYPL---------NVIPKLRQWLYLPNYKVSPVPGKILADFVQYIFVVLQYQVFQMEKRKK-----SDSHKLVKQRLLEGF-QKSIHKDFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCINPMSWEIRGIHGKNADKQCS--SVASGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLXXXXXXXXXXXXXXXXLNRIERKIKKIEQRQAQHGKPELNEHYLVMRSGD 4275
            Q  +W + E H  K +   I++V + +V   N + ++      P+ +L  +  +   V +  I++ KM+YQ++  +  N+  NCS           N  N S+     ID  +W+GL K     ++ L+   +++    + +  Y   ++Y+  N    P +  IF ++      +   +  KY +N+ F K GLE  F+ +V V   R+D Y++++   L+  L  +R      +W  Y  FL  ++  QY IC+G+PP  C +YP          N+I    +WLY P++ V P P  ++ DF+  +   LQ Q+F+ E +        D+ ++        F Q +   DFI  +S Y+D  K ++F + +W  L IIFITG   I++F +GYL+  F +L  G  +L+   KS++R  + ++ YN  VI  K I  +  C ++  L     CW++  F++ C       ++G     A+  C+  S  +G+ WD +CF F++LQR +F +  FL V  D+      +SRGA L    I+K+++ + + E+K +++++R++ +I+ RQ ++ K +     L    G+
Sbjct:  931 QVFMWWILELHIIKIVSSYIIWVSVKEVSLFNYVFLISWAFALPYAKLRRLASSVCTVWTCVIIVCKMLYQLQTIKPENFSVNCSLPNENQTNIPFNELNKSLLYSAPIDPTEWVGLRKSSPLLVY-LRNNLLMLAILAFEVTIYRHQEYYRGRNNLTAPVSRTIFHDITRLHLDDGLINCAKYFINYFFYKFGLETCFLMSVNVIGQRMDFYAMIHACWLIAVLYRRRRKAIAEIWPKYCCFLACIITFQYFICIGIPPAPCRDYPWRFKGASFNDNII----KWLYFPDFIVRPNPVFLVYDFMLLLCASLQRQIFEDENKAAVRIMAGDNVEICMNLDAASFSQHNPVPDFIHCRS-YLDMSKVIIFSYLFWFVLTIIFITGTTRISIFCMGYLVACFYFLLFGGDLLLKPIKSILRYWDWLIAYNVFVITMKNILSIGACGYIGTL-VHNSCWLIQAFSLACT------VKGYQMPAANSPCTLPSGEAGIIWDSICFAFLLLQRRVFMSYYFLHVVADIKASQILASRGAELFQATIVKAVKARIEEEKKSMDQLKRQMDRIKARQQKYKKGKERMLSLTQEPGE 1507          

HSP 3 Score: 173.711 bits (439), Expect = 3.277e-42
Identity = 111/355 (31.27%), Postives = 179/355 (50.42%), Query Frame = 1
Query: 1513 LLSIINTMISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNLPELPTIFRISSSEMQSSEIGLHKSLIPTGPLAAMMSFLVVFWLTLRLFMTDEKINKSK---ICNEKISTQQKLE----------------------------------------------HYFGNVDNATYEKFVKCLKEKCENYWIFSCCFAMLFVSVNGSIVLFRIXXXXXXXXXXXXXXXSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIIQVRYFHSRFLELTSMK 2430
            ++S+   ++  S+I   +AMMAWS+ Y SW +F+ L+ SC LW+I + R   + +SP +V Y  LL+++QYI+ F LPE+  +             G  +   P G LA+ + F + FWL LR  +T++K  + K   +   KI +Q+  E                                                 GN+  A + K+           WI+ C     FVS  G IV+++I+YMVL ++ + ++ + Y +WR+ +K FW +V+ Y +  L+ IY +QF+      QN+TGL +E L D+GLK+F  ++L   +FIP  FL++ I+ + YFH RFLELT +K
Sbjct:  489 MVSVFQFIMKQSYICALIAMMAWSITYHSWLTFVLLIWSCTLWMIRNRRKYAMISSPFMVVYGNLLLILQYIWSFELPEIKKV------------PGFLEKKEP-GELASKILFTITFWLLLRQHLTEQKALQEKEALLSEVKIGSQENEEKDEELQDIQVEGEPKEEEEEEAKEEKQERKKVEQEEAEEEDEQDIMKVLGNLVVAMFIKY-----------WIYVCGGMFFFVSFEGKIVMYKIIYMVLFLFCVALYQVHYEWWRKILKYFWMSVVIYTMLVLIFIYTYQFENFPGLWQNMTGLKKEKLEDLGLKQFTVAELFTRIFIPTSFLLVCILHLHYFHDRFLELTDLK 819          

HSP 4 Score: 153.68 bits (387), Expect = 3.181e-36
Identity = 99/311 (31.83%), Postives = 175/311 (56.27%), Query Frame = 1
Query: 6607 PLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLI---NTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAMM----WWEVNEIIQGQSYCPNPDSPAKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQH 7518
            P+F  S++++ ++ + +++F +  +       +  +L+++E +D T   ++  S+++W I+PP  +K+  +L  P +S  +      +R  +    +E I     S  L N  + N+  +I   +T+ + T V +  I+P ++ A   + S+      ++NN +++I++ +  DN       WW +N +   + Y PN  +       L + +FN+++S    G + + YGI+G+YA+   V+ +F+R F+S IS+ I  EELPNVDRI KL  +I+LVRE  +L LEE L AKLIFLYRS ETMIKWT+ 
Sbjct: 2387 PIFTMSAQQSQLKVMDQQSFNKFIQAFSRDTGAMQFLENYEKEDITVAELEGNSNSLWTISPPSKQKMIHELLDPNSSFSVVFSWSIQRNLSLGAKSE-IATDKLSFPLKNITRKNIAKMIAGNSTESSKTPVTIEKIYPYYVKAPSDSNSKPIKQLLSENN-FMDITIILSRDNTTKYNSEWWVLN-LTGNRIYNPNSQA-------LELVVFNDKVSPPSLGFL-AGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPNVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTRE 2686          

HSP 5 Score: 127.102 bits (318), Expect = 3.662e-28
Identity = 74/213 (34.74%), Postives = 113/213 (53.05%), Query Frame = 1
Query: 5173 RKSVSEDKEEKNKQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLPVPEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLW-------------------------RDHSEFYKDIKISNEEEVNHIQPLKPQSAMR 5736
            +K   +D+ E++++  F   + +F  L  +     +  SE  CYF++I+NH++S ++++L  P L+F W MLSVPRPS+ FW++ I YTE+ IV KY  QF     N   V  ++  P   P I+G+EK   Y + D+IQLL LF HRS LK +GLW                         RD S+  K I ++   E  H+   + Q+A+R
Sbjct: 1886 KKMFHDDELEESEK--FYVGQPRFLLLFYAMYNTLVARSEMVCYFVIILNHMVSASMITLLLPILIFLWAMLSVPRPSRRFWMMAIVYTEVAIVVKYFFQFGFFPWNK-NVEVNKDKPYHPPNIIGVEKKEGYVLYDLIQLLALFFHRSILKCHGLWDEDDMTESGMAREESDDELSLGHGRRDSSDSLKSINLAASVESVHVTFPEQQTAVR 2095          

HSP 6 Score: 56.9954 bits (136), Expect = 7.613e-7
Identity = 38/130 (29.23%), Postives = 72/130 (55.38%), Query Frame = 1
Query:  850 VITGFAGIISPXXXXXXXXXXXXXXXTFWACGNNVMTSNFARMRLFLLLYSAAHVCLIFIVQLEFMQLYIPTGQRLSRLLGLYLMFDTNCKNRGEIIFNNQRS-IDYVSPFIILYVYYLSAIETRIWLEE 1236
            ++ G +G++ PSL + VY   +LG+ T+W+         F+ + + L +++A H+  +++ Q +F Q  +P     +RL G+  +  T+C +  +II N   S   + +P ++L +YY  A   RIWL+E
Sbjct:  229 ILLGSSGMMLPSLTSSVYFFVFLGLCTWWSWCRTFDPLLFSCLCVLLAIFTAGHLIGLYLYQFQFFQEAVPPNDYYARLFGIKSVIQTDCSSTWKIIVNPDLSWYHHANPILLLVMYYTLATLIRIWLQE 358          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Celegans
Match: pezo-1 (Piezo-type mechanosensitive ion channel component [Source:UniProtKB/TrEMBL;Acc:A0A061AE33])

HSP 1 Score: 342.813 bits (878), Expect = 6.864e-98
Identity = 261/938 (27.83%), Postives = 440/938 (46.91%), Query Frame = 1
Query: 4993 FIGSTMASLTVLFNEWTREYYRNIRKLEEEKKLVKSHVLSTFIEIDEKLGQEIEKFVKDGRKSVSEDKEEKNKQD----VFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLP-VPEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLWRDH-----------------SEFYKDIKISNEEEVNHIQ--------------PLKPQSAMRTG-IKFRNPIKQ-----LKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENN-----MRPLTKKTFEEMKECHKFHLPSKD------------YLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAY-----KRTLSEANSLHQ---NQNNTYLNISLSMKTDNAMMWWE--VNEIIQGQSY--------CPNP-DSPAKKYL-----------FLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFL-RTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQHWKSTLE 7536
             I S +   +V  N+  RE+      L +EK+ +KS    +      KL  +I   V      + +   +  K +    V  + +S    LL +       +++  CYF  IM  +++G L++LP P +  FWG LS PRPSK FW+ +ITYTE VIV K++CQF  +  N +    EH++DP++L  + G+ +  ++A+ D++ L  LF HR  L+  GLW+D                  S+     KI+ E +V   Q              P  P +      +    PI +     + +F  ++ + K     D+Y IMF  +    LI+  GY +FG G    G+ +D +K ++ PV  + M++   + IIIDRAL+LRK V GK ++Q+  +  +H W+F  LP +T+R   S    Q LY IK  YF +S++Q+R+GYP   +GN LT +Y   N+I FK++M IPFL+ELR  +DW WTD+S+  + +  +E+ ++ IF +KC R  E  +P  RG  +  +VKY +G  I+I     I+ PL++ S +        P + +  I++  Y PL+   ++ +N     +  +       + +       ++D            YL+ +  +D   +     S+  W I+      + +KLS    +  +N +   E       +    ++ ++S  +       +   I +       + P + P+ + A+     +  L+   S+     N  N  +N +   K+D A  W++     + QG+S           +P D  AK ++           +L +  F +R   +    +F   G++ +Y +   VV R L R  ++     +   ELPN D + K+  +IYLVRE K   LE+ L AKLIFL+RS  T+I+WT+  K   E
Sbjct:  109 MIASALDLCSVTLNKLCREHRYVGFVLSKEKQKLKSGHSESLSNTSRKL-TDIRSAVDLPSLQLVQSANDVEKMETAVSVDWQQKSSATRLLNAVVNCIGAHTDILCYFFAIMTQVMTGGLITLPLPLMSLFWGNLSNPRPSKFFWVTMITYTECVIVIKFVCQFAFMPYNSITWRTEHQMDPMSLDKLFGVSQRDSFALWDIVLLFSLFFHRYMLRKLGLWKDANLTDTFTLKEEPRSASGSDTGSPKKIAQEPKVVVTQSDTLEGTSGGEIVIPSDPNAVSNMEELDCEPPIPEKQSGPIGRFIHQLFHPKFRYIRDLYPIMFGIDVICFLIMTFGYSAFGEG--GSGNVLDDVKASRIPVTLVVMLVGMTLAIIIDRALYLRKSVVGKLIYQVLMIAFLHIWVFLVLPNMTRRSAISNHVAQALYVIKSCYFLVSAWQIRNGYPELCIGNLLTHSYGMTNMIAFKVFMNIPFLFELRTAIDWTWTDTSMPLFDFFNMENFYAHIFNIKCARQFEAAYPAPRGIPKGKLVKYMMGFPIIIGVVIFIFSPLLLWSLLNQIGTISMPEKVTLRISIEGYPPLYEMEAQGSNHDNAELGMIKPDQLASLNQALTDSYTTRDTNSILRSRMSVSYLKGYTYEDILIVRFRPESEIYWPISQDSRNAMIDKLS---RNTSVNFEVSLEFTRPYDPNENAALKHSKSWLVPISLDMTIRAKIQSALRGDPGH-PILIPQSIPAFIQVPNQGELTLPTSIGNTIINDGNPRINTTGMEKSDEARAWFDSLTLNLEQGKSQNEKMWIATSEHPGDQNAKLWIKTANTTYSGRPYLQVVGFIDRAFPSFLAKVFKG-GVIAVYLSVILVVGRGLVRGIFTTSPSTVMFTELPNADHLLKICLDIYLVREAKDFMLEQDLFAKLIFLFRSPATLIEWTRMSKKKQE 1038          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Celegans
Match: pezo-1 (Piezo-type mechanosensitive ion channel component [Source:UniProtKB/TrEMBL;Acc:A0A061AE33])

HSP 1 Score: 342.043 bits (876), Expect = 1.510e-94
Identity = 261/937 (27.85%), Postives = 442/937 (47.17%), Query Frame = 1
Query: 4996 IGSTMASLTVLFNEWTREYYRNIRKLEEEKKLVKSHVLSTFIEIDEKLGQEIEKFVKDGR----KSVSEDKEEKNKQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLP-VPEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLWRDH-----------------SEFYKDIKISNEEEVNHIQ--------------PLKPQSAMRTG-IKFRNPIKQ-----LKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENN-----MRPLTKKTFEEMKECHKFHLPSKD------------YLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAY-----KRTLSEANSLHQ---NQNNTYLNISLSMKTDNAMMWWE--VNEIIQGQSY--------CPNP-DSPAKKYL-----------FLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFL-RTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQHWKSTLE 7536
            I S +   +V  N+  RE+      L +EK+ +KS    +      KL  +I   V        +S ++ ++ +    V  + +S    LL +       +++  CYF  IM  +++G L++LP P +  FWG LS PRPSK FW+ +ITYTE VIV K++CQF  +  N +    EH++DP++L  + G+ +  ++A+ D++ L  LF HR  L+  GLW+D                  S+     KI+ E +V   Q              P  P +      +    PI +     + +F  ++ + K     D+Y IMF  +    LI+  GY +FG G    G+ +D +K ++ PV  + M++   + IIIDRAL+LRK V GK ++Q+  +  +H W+F  LP +T+R   S    Q LY IK  YF +S++Q+R+GYP   +GN LT +Y   N+I FK++M IPFL+ELR  +DW WTD+S+  + +  +E+ ++ IF +KC R  E  +P  RG  +  +VKY +G  I+I     I+ PL++ S +        P + +  I++  Y PL+   ++ +N     +  +       + +       ++D            YL+ +  +D   +     S+  W I+      + +KLS    +  +N +   E       +    ++ ++S  +       +   I +       + P + P+ + A+     +  L+   S+     N  N  +N +   K+D A  W++     + QG+S           +P D  AK ++           +L +  F +R   +    +F   G++ +Y +   VV R L R  ++     +   ELPN D + K+  +IYLVRE K   LE+ L AKLIFL+RS  T+I+WT+  K   E
Sbjct:  776 IASALDLCSVTLNKLCREHRYVGFVLSKEKQKLKSGHSESLSNTSRKL-TDIRSAVDLPSLQLVQSANDVEKMETAVSVDWQQKSSATRLLNAVVNCIGAHTDILCYFFAIMTQVMTGGLITLPLPLMSLFWGNLSNPRPSKFFWVTMITYTECVIVIKFVCQFAFMPYNSITWRTEHQMDPMSLDKLFGVSQRDSFALWDIVLLFSLFFHRYMLRKLGLWKDANLTDTFTLKEEPRSASGSDTGSPKKIAQEPKVVVTQSDTLEGTSGGEIVIPSDPNAVSNMEELDCEPPIPEKQSGPIGRFIHQLFHPKFRYIRDLYPIMFGIDVICFLIMTFGYSAFGEG--GSGNVLDDVKASRIPVTLVVMLVGMTLAIIIDRALYLRKSVVGKLIYQVLMIAFLHIWVFLVLPNMTRRSAISNHVAQALYVIKSCYFLVSAWQIRNGYPELCIGNLLTHSYGMTNMIAFKVFMNIPFLFELRTAIDWTWTDTSMPLFDFFNMENFYAHIFNIKCARQFEAAYPAPRGIPKGKLVKYMMGFPIIIGVVIFIFSPLLLWSLLNQIGTISMPEKVTLRISIEGYPPLYEMEAQGSNHDNAELGMIKPDQLASLNQALTDSYTTRDTNSILRSRMSVSYLKGYTYEDILIVRFRPESEIYWPISQDSRNAMIDKLS---RNTSVNFEVSLEFTRPYDPNENAALKHSKSWLVPISLDMTIRAKIQSALRGDPGH-PILIPQSIPAFIQVPNQGELTLPTSIGNTIINDGNPRINTTGMEKSDEARAWFDSLTLNLEQGKSQNEKMWIATSEHPGDQNAKLWIKTANTTYSGRPYLQVVGFIDRAFPSFLAKVFKG-GVIAVYLSVILVVGRGLVRGIFTTSPSTVMFTELPNADHLLKICLDIYLVREAKDFMLEQDLFAKLIFLFRSPATLIEWTRMSKKKQE 1704          

HSP 2 Score: 160.229 bits (404), Expect = 1.094e-38
Identity = 164/613 (26.75%), Postives = 283/613 (46.17%), Query Frame = 1
Query: 2557 TATEKLKSLYTLTQPSIWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSAS--IVILKMIYQIKIFQTFNWLTNCSQYGNFANSSMEIIDNAKWLGLEK-LENFQLHILKWTAI--LVGCAVWHIVRYHQMQF-YKLNLDQKPKTSVI--FQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNVLWLPYMIFLGILLPVQYVICVGLPPGLCIEYPLNV-IPK--------LRQWLYLPNYKVSPVPGKILADFVQYIFVVLQYQVFQMEKRKKSDSHKLVKQRLLEGFQKSIHKDFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRS-------CNVILYYNFLVILTKCIFQLMGCVFMNLLKTKG-----LCWMVSLFAIQCINPMSWEIRGIHGKNADKQCSSVASGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLXXXXXXXXXXXXXXXXLNRIERKIKKIEQR---QAQHGKPELN----EHYLVMRSGDYYLF 4287
            T  +KL  L   T   +WR +E H +K + ++I      +++A+ I L++++ +    P      + +LF+C+    + + KMIYQ+ I      L+   +     N S   I   +W GL+K +E  +   + +  I  ++  A   IV Y Q  +   L L +  +  V   F       S++N    +++ +++GF K GLE++ I   +    R+D  + +    L+LF + KR     +W+ Y+I++ IL P+Q+   VGLPP  CIEYP +  IP         L   L L  Y V+     ++ DF   +    Q  VF   +R+  D+  +          ++   DFI  K SYVDY K  VF++ +W+TL      G+   +LF LGY++     LW G  + +    S +RS        N +L Y    I  K   Q+ GCVF++     G     LC +  LF+I C+N     ++ +   +      +    + +DV+   F++ Q  IF +  F    ++   +   ++RGA L N  I K +++Q + ++ + N I R+ + I +R   Q + G  E +     +    R+GDYY+F
Sbjct:   68 TLVKKLHKLANQTIELLWRFFEVHISKIVFVIIAIFIANNINALYIPLVILLSLAICLPSAAD-GIFSLFMCAYLFLVALSKMIYQLDIVPE---LSQIDRGVGADNCSHGNISMPEWFGLKKEVEGTEPIYMLFGVIVSIIALAFQSIVIYRQRHYRASLGLPESMRAKVFPDFHHSHFDRSLKN---AIQFLIDYGFYKFGLEITMIAIGIDIFNRMDALAAIQCFWLVLFALNKRVFVRRIWVFYVIYMAILYPLQFFSYVGLPPDSCIEYPWSYWIPSYSDDARFNLSYLLNLSIYGVNWPSAYLIGDFFVLLLASCQLAVF---RREGEDNDSIYNDGNFVIKPENPQYDFIDTKKSYVDYFKSFVFHYGHWITLMSTLAAGIAGTSLFALGYIIFTLTMLWSGNNLYV--MNSTLRSFEHTLKRWNALLGYTLFTITMKVCLQIFGCVFLSWFDQSGGWGKTLCIVRQLFSITCVNNECHVLKELEDFSKACAVETKEGNIGFDVIALSFLVFQIRIFHSWYFQHCMVEYRSEVILANRGAVLKNQLIEKEMKEQNEQQKAKFNDIRRRTEAIRERYQKQIERGAAERDFEPVTYGHAKRAGDYYMF 668          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Celegans
Match: pezo-1 (Piezo-type mechanosensitive ion channel component [Source:UniProtKB/TrEMBL;Acc:A0A061AE33])

HSP 1 Score: 342.043 bits (876), Expect = 1.510e-94
Identity = 261/937 (27.85%), Postives = 442/937 (47.17%), Query Frame = 1
Query: 4996 IGSTMASLTVLFNEWTREYYRNIRKLEEEKKLVKSHVLSTFIEIDEKLGQEIEKFVKDGR----KSVSEDKEEKNKQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLP-VPEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLWRDH-----------------SEFYKDIKISNEEEVNHIQ--------------PLKPQSAMRTG-IKFRNPIKQ-----LKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENN-----MRPLTKKTFEEMKECHKFHLPSKD------------YLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAY-----KRTLSEANSLHQ---NQNNTYLNISLSMKTDNAMMWWE--VNEIIQGQSY--------CPNP-DSPAKKYL-----------FLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFL-RTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQHWKSTLE 7536
            I S +   +V  N+  RE+      L +EK+ +KS    +      KL  +I   V        +S ++ ++ +    V  + +S    LL +       +++  CYF  IM  +++G L++LP P +  FWG LS PRPSK FW+ +ITYTE VIV K++CQF  +  N +    EH++DP++L  + G+ +  ++A+ D++ L  LF HR  L+  GLW+D                  S+     KI+ E +V   Q              P  P +      +    PI +     + +F  ++ + K     D+Y IMF  +    LI+  GY +FG G    G+ +D +K ++ PV  + M++   + IIIDRAL+LRK V GK ++Q+  +  +H W+F  LP +T+R   S    Q LY IK  YF +S++Q+R+GYP   +GN LT +Y   N+I FK++M IPFL+ELR  +DW WTD+S+  + +  +E+ ++ IF +KC R  E  +P  RG  +  +VKY +G  I+I     I+ PL++ S +        P + +  I++  Y PL+   ++ +N     +  +       + +       ++D            YL+ +  +D   +     S+  W I+      + +KLS    +  +N +   E       +    ++ ++S  +       +   I +       + P + P+ + A+     +  L+   S+     N  N  +N +   K+D A  W++     + QG+S           +P D  AK ++           +L +  F +R   +    +F   G++ +Y +   VV R L R  ++     +   ELPN D + K+  +IYLVRE K   LE+ L AKLIFL+RS  T+I+WT+  K   E
Sbjct:  776 IASALDLCSVTLNKLCREHRYVGFVLSKEKQKLKSGHSESLSNTSRKL-TDIRSAVDLPSLQLVQSANDVEKMETAVSVDWQQKSSATRLLNAVVNCIGAHTDILCYFFAIMTQVMTGGLITLPLPLMSLFWGNLSNPRPSKFFWVTMITYTECVIVIKFVCQFAFMPYNSITWRTEHQMDPMSLDKLFGVSQRDSFALWDIVLLFSLFFHRYMLRKLGLWKDANLTDTFTLKEEPRSASGSDTGSPKKIAQEPKVVVTQSDTLEGTSGGEIVIPSDPNAVSNMEELDCEPPIPEKQSGPIGRFIHQLFHPKFRYIRDLYPIMFGIDVICFLIMTFGYSAFGEG--GSGNVLDDVKASRIPVTLVVMLVGMTLAIIIDRALYLRKSVVGKLIYQVLMIAFLHIWVFLVLPNMTRRSAISNHVAQALYVIKSCYFLVSAWQIRNGYPELCIGNLLTHSYGMTNMIAFKVFMNIPFLFELRTAIDWTWTDTSMPLFDFFNMENFYAHIFNIKCARQFEAAYPAPRGIPKGKLVKYMMGFPIIIGVVIFIFSPLLLWSLLNQIGTISMPEKVTLRISIEGYPPLYEMEAQGSNHDNAELGMIKPDQLASLNQALTDSYTTRDTNSILRSRMSVSYLKGYTYEDILIVRFRPESEIYWPISQDSRNAMIDKLS---RNTSVNFEVSLEFTRPYDPNENAALKHSKSWLVPISLDMTIRAKIQSALRGDPGH-PILIPQSIPAFIQVPNQGELTLPTSIGNTIINDGNPRINTTGMEKSDEARAWFDSLTLNLEQGKSQNEKMWIATSEHPGDQNAKLWIKTANTTYSGRPYLQVVGFIDRAFPSFLAKVFKG-GVIAVYLSVILVVGRGLVRGIFTTSPSTVMFTELPNADHLLKICLDIYLVREAKDFMLEQDLFAKLIFLFRSPATLIEWTRMSKKKQE 1704          

HSP 2 Score: 160.229 bits (404), Expect = 1.094e-38
Identity = 164/613 (26.75%), Postives = 283/613 (46.17%), Query Frame = 1
Query: 2557 TATEKLKSLYTLTQPSIWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSAS--IVILKMIYQIKIFQTFNWLTNCSQYGNFANSSMEIIDNAKWLGLEK-LENFQLHILKWTAI--LVGCAVWHIVRYHQMQF-YKLNLDQKPKTSVI--FQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNVLWLPYMIFLGILLPVQYVICVGLPPGLCIEYPLNV-IPK--------LRQWLYLPNYKVSPVPGKILADFVQYIFVVLQYQVFQMEKRKKSDSHKLVKQRLLEGFQKSIHKDFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRS-------CNVILYYNFLVILTKCIFQLMGCVFMNLLKTKG-----LCWMVSLFAIQCINPMSWEIRGIHGKNADKQCSSVASGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLXXXXXXXXXXXXXXXXLNRIERKIKKIEQR---QAQHGKPELN----EHYLVMRSGDYYLF 4287
            T  +KL  L   T   +WR +E H +K + ++I      +++A+ I L++++ +    P      + +LF+C+    + + KMIYQ+ I      L+   +     N S   I   +W GL+K +E  +   + +  I  ++  A   IV Y Q  +   L L +  +  V   F       S++N    +++ +++GF K GLE++ I   +    R+D  + +    L+LF + KR     +W+ Y+I++ IL P+Q+   VGLPP  CIEYP +  IP         L   L L  Y V+     ++ DF   +    Q  VF   +R+  D+  +          ++   DFI  K SYVDY K  VF++ +W+TL      G+   +LF LGY++     LW G  + +    S +RS        N +L Y    I  K   Q+ GCVF++     G     LC +  LF+I C+N     ++ +   +      +    + +DV+   F++ Q  IF +  F    ++   +   ++RGA L N  I K +++Q + ++ + N I R+ + I +R   Q + G  E +     +    R+GDYY+F
Sbjct:   68 TLVKKLHKLANQTIELLWRFFEVHISKIVFVIIAIFIANNINALYIPLVILLSLAICLPSAAD-GIFSLFMCAYLFLVALSKMIYQLDIVPE---LSQIDRGVGADNCSHGNISMPEWFGLKKEVEGTEPIYMLFGVIVSIIALAFQSIVIYRQRHYRASLGLPESMRAKVFPDFHHSHFDRSLKN---AIQFLIDYGFYKFGLEITMIAIGIDIFNRMDALAAIQCFWLVLFALNKRVFVRRIWVFYVIYMAILYPLQFFSYVGLPPDSCIEYPWSYWIPSYSDDARFNLSYLLNLSIYGVNWPSAYLIGDFFVLLLASCQLAVF---RREGEDNDSIYNDGNFVIKPENPQYDFIDTKKSYVDYFKSFVFHYGHWITLMSTLAAGIAGTSLFALGYIIFTLTMLWSGNNLYV--MNSTLRSFEHTLKRWNALLGYTLFTITMKVCLQIFGCVFLSWFDQSGGWGKTLCIVRQLFSITCVNNECHVLKELEDFSKACAVETKEGNIGFDVIALSFLVFQIRIFHSWYFQHCMVEYRSEVILANRGAVLKNQLIEKEMKEQNEQQKAKFNDIRRRTEAIRERYQKQIERGAAERDFEPVTYGHAKRAGDYYMF 668          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Celegans
Match: pezo-1 (Piezo-type mechanosensitive ion channel component [Source:UniProtKB/TrEMBL;Acc:A0A061AE33])

HSP 1 Score: 341.658 bits (875), Expect = 1.865e-94
Identity = 261/937 (27.85%), Postives = 442/937 (47.17%), Query Frame = 1
Query: 4996 IGSTMASLTVLFNEWTREYYRNIRKLEEEKKLVKSHVLSTFIEIDEKLGQEIEKFVKDGR----KSVSEDKEEKNKQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLP-VPEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLWRDH-----------------SEFYKDIKISNEEEVNHIQ--------------PLKPQSAMRTG-IKFRNPIKQ-----LKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENN-----MRPLTKKTFEEMKECHKFHLPSKD------------YLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAY-----KRTLSEANSLHQ---NQNNTYLNISLSMKTDNAMMWWE--VNEIIQGQSY--------CPNP-DSPAKKYL-----------FLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFL-RTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQHWKSTLE 7536
            I S +   +V  N+  RE+      L +EK+ +KS    +      KL  +I   V        +S ++ ++ +    V  + +S    LL +       +++  CYF  IM  +++G L++LP P +  FWG LS PRPSK FW+ +ITYTE VIV K++CQF  +  N +    EH++DP++L  + G+ +  ++A+ D++ L  LF HR  L+  GLW+D                  S+     KI+ E +V   Q              P  P +      +    PI +     + +F  ++ + K     D+Y IMF  +    LI+  GY +FG G    G+ +D +K ++ PV  + M++   + IIIDRAL+LRK V GK ++Q+  +  +H W+F  LP +T+R   S    Q LY IK  YF +S++Q+R+GYP   +GN LT +Y   N+I FK++M IPFL+ELR  +DW WTD+S+  + +  +E+ ++ IF +KC R  E  +P  RG  +  +VKY +G  I+I     I+ PL++ S +        P + +  I++  Y PL+   ++ +N     +  +       + +       ++D            YL+ +  +D   +     S+  W I+      + +KLS    +  +N +   E       +    ++ ++S  +       +   I +       + P + P+ + A+     +  L+   S+     N  N  +N +   K+D A  W++     + QG+S           +P D  AK ++           +L +  F +R   +    +F   G++ +Y +   VV R L R  ++     +   ELPN D + K+  +IYLVRE K   LE+ L AKLIFL+RS  T+I+WT+  K   E
Sbjct:  758 IASALDLCSVTLNKLCREHRYVGFVLSKEKQKLKSGHSESLSNTSRKL-TDIRSAVDLPSLQLVQSANDVEKMETAVSVDWQQKSSATRLLNAVVNCIGAHTDILCYFFAIMTQVMTGGLITLPLPLMSLFWGNLSNPRPSKFFWVTMITYTECVIVIKFVCQFAFMPYNSITWRTEHQMDPMSLDKLFGVSQRDSFALWDIVLLFSLFFHRYMLRKLGLWKDANLTDTFTLKEEPRSASGSDTGSPKKIAQEPKVVVTQSDTLEGTSGGEIVIPSDPNAVSNMEELDCEPPIPEKQSGPIGRFIHQLFHPKFRYIRDLYPIMFGIDVICFLIMTFGYSAFGEG--GSGNVLDDVKASRIPVTLVVMLVGMTLAIIIDRALYLRKSVVGKLIYQVLMIAFLHIWVFLVLPNMTRRSAISNHVAQALYVIKSCYFLVSAWQIRNGYPELCIGNLLTHSYGMTNMIAFKVFMNIPFLFELRTAIDWTWTDTSMPLFDFFNMENFYAHIFNIKCARQFEAAYPAPRGIPKGKLVKYMMGFPIIIGVVIFIFSPLLLWSLLNQIGTISMPEKVTLRISIEGYPPLYEMEAQGSNHDNAELGMIKPDQLASLNQALTDSYTTRDTNSILRSRMSVSYLKGYTYEDILIVRFRPESEIYWPISQDSRNAMIDKLS---RNTSVNFEVSLEFTRPYDPNENAALKHSKSWLVPISLDMTIRAKIQSALRGDPGH-PILIPQSIPAFIQVPNQGELTLPTSIGNTIINDGNPRINTTGMEKSDEARAWFDSLTLNLEQGKSQNEKMWIATSEHPGDQNAKLWIKTANTTYSGRPYLQVVGFIDRAFPSFLAKVFKG-GVIAVYLSVILVVGRGLVRGIFTTSPSTVMFTELPNADHLLKICLDIYLVREAKDFMLEQDLFAKLIFLFRSPATLIEWTRMSKKKQE 1686          

HSP 2 Score: 161.384 bits (407), Expect = 4.870e-39
Identity = 175/679 (25.77%), Postives = 310/679 (45.66%), Query Frame = 1
Query: 2377 IIQVRYFHSRFLELTSMKQTQVCVESERERVKSSKDEMDKNKFSVKNTVEFIRDVNNMVFTATEKLKSLYTLTQPSIWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSAS--IVILKMIYQIKIFQTFNWLT------NCSQYGNFANSSMEIIDNAKWLGLEK-LENFQLHILKWTAI--LVGCAVWHIVRYHQMQF-YKLNLDQKPKTSVI--FQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNVLWLPYMIFLGILLPVQYVICVGLPPGLCIEYPLNV-IPK--------LRQWLYLPNYKVSPVPGKILADFVQYIFVVLQYQVFQMEKRKKSDSHKLVKQRLLEGFQKSIHKDFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRS-------CNVILYYNFLVILTKCIFQLMGCVFMNLLKTKG-----LCWMVSLFAIQCINPMSWEIRGIHGKNADKQCSSVASGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLXXXXXXXXXXXXXXXXLNRIERKIKKIEQR---QAQHGKPELN----EHYLVMRSGDYYLF 4287
            ++Q+++FH  +   TS ++      +E +   S+ +       +V +T       +    T  +KL  L   T   +WR +E H +K + ++I      +++A+ I L++++ +    P      + +LF+C+    + + KMIYQ+ I    + +       NCS +GN        I   +W GL+K +E  +   + +  I  ++  A   IV Y Q  +   L L +  +  V   F       S++N    +++ +++GF K GLE++ I   +    R+D  + +    L+LF + KR     +W+ Y+I++ IL P+Q+   VGLPP  CIEYP +  IP         L   L L  Y V+     ++ DF   +    Q  VF   +R+  D+  +          ++   DFI  K SYVDY K  VF++ +W+TL      G+   +LF LGY++     LW G  + +    S +RS        N +L Y    I  K   Q+ GCVF++     G     LC +  LF+I C+N     ++ +   +      +    + +DV+   F++ Q  IF +  F    ++   +   ++RGA L N  I K +++Q + ++ + N I R+ + I +R   Q + G  E +     +    R+GDYY+F
Sbjct:    1 MLQLKFFHGPWSRATSPRR------AENDPPTSTTEAA-----AVASTSGTQGRAHAAGDTLVKKLHKLANQTIELLWRFFEVHISKIVFVIIAIFIANNINALYIPLVILLSLAICLPSAAD-GIFSLFMCAYLFLVALSKMIYQLDIVPELSQIDRGVGADNCS-HGN--------ISMPEWFGLKKEVEGTEPIYMLFGVIVSIIALAFQSIVIYRQRHYRASLGLPESMRAKVFPDFHHSHFDRSLKN---AIQFLIDYGFYKFGLEITMIAIGIDIFNRMDALAAIQCFWLVLFALNKRVFVRRIWVFYVIYMAILYPLQFFSYVGLPPDSCIEYPWSYWIPSYSDDARFNLSYLLNLSIYGVNWPSAYLIGDFFVLLLASCQLAVF---RREGEDNDSIYNDGNFVIKPENPQYDFIDTKKSYVDYFKSFVFHYGHWITLMSTLAAGIAGTSLFALGYIIFTLTMLWSGNNLYV--MNSTLRSFEHTLKRWNALLGYTLFTITMKVCLQIFGCVFLSWFDQSGGWGKTLCIVRQLFSITCVNNECHVLKELEDFSKACAVETKEGNIGFDVIALSFLVFQIRIFHSWYFQHCMVEYRSEVILANRGAVLKNQLIEKEMKEQNEQQKAKFNDIRRRTEAIRERYQKQIERGAAERDFEPVTYGHAKRAGDYYMF 650          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Celegans
Match: pezo-1 (Piezo-type mechanosensitive ion channel component [Source:UniProtKB/TrEMBL;Acc:A0A061AE33])

HSP 1 Score: 341.658 bits (875), Expect = 2.030e-94
Identity = 261/937 (27.85%), Postives = 442/937 (47.17%), Query Frame = 1
Query: 4996 IGSTMASLTVLFNEWTREYYRNIRKLEEEKKLVKSHVLSTFIEIDEKLGQEIEKFVKDGR----KSVSEDKEEKNKQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLP-VPEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLWRDH-----------------SEFYKDIKISNEEEVNHIQ--------------PLKPQSAMRTG-IKFRNPIKQ-----LKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENN-----MRPLTKKTFEEMKECHKFHLPSKD------------YLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAY-----KRTLSEANSLHQ---NQNNTYLNISLSMKTDNAMMWWE--VNEIIQGQSY--------CPNP-DSPAKKYL-----------FLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFL-RTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQHWKSTLE 7536
            I S +   +V  N+  RE+      L +EK+ +KS    +      KL  +I   V        +S ++ ++ +    V  + +S    LL +       +++  CYF  IM  +++G L++LP P +  FWG LS PRPSK FW+ +ITYTE VIV K++CQF  +  N +    EH++DP++L  + G+ +  ++A+ D++ L  LF HR  L+  GLW+D                  S+     KI+ E +V   Q              P  P +      +    PI +     + +F  ++ + K     D+Y IMF  +    LI+  GY +FG G    G+ +D +K ++ PV  + M++   + IIIDRAL+LRK V GK ++Q+  +  +H W+F  LP +T+R   S    Q LY IK  YF +S++Q+R+GYP   +GN LT +Y   N+I FK++M IPFL+ELR  +DW WTD+S+  + +  +E+ ++ IF +KC R  E  +P  RG  +  +VKY +G  I+I     I+ PL++ S +        P + +  I++  Y PL+   ++ +N     +  +       + +       ++D            YL+ +  +D   +     S+  W I+      + +KLS    +  +N +   E       +    ++ ++S  +       +   I +       + P + P+ + A+     +  L+   S+     N  N  +N +   K+D A  W++     + QG+S           +P D  AK ++           +L +  F +R   +    +F   G++ +Y +   VV R L R  ++     +   ELPN D + K+  +IYLVRE K   LE+ L AKLIFL+RS  T+I+WT+  K   E
Sbjct:  802 IASALDLCSVTLNKLCREHRYVGFVLSKEKQKLKSGHSESLSNTSRKL-TDIRSAVDLPSLQLVQSANDVEKMETAVSVDWQQKSSATRLLNAVVNCIGAHTDILCYFFAIMTQVMTGGLITLPLPLMSLFWGNLSNPRPSKFFWVTMITYTECVIVIKFVCQFAFMPYNSITWRTEHQMDPMSLDKLFGVSQRDSFALWDIVLLFSLFFHRYMLRKLGLWKDANLTDTFTLKEEPRSASGSDTGSPKKIAQEPKVVVTQSDTLEGTSGGEIVIPSDPNAVSNMEELDCEPPIPEKQSGPIGRFIHQLFHPKFRYIRDLYPIMFGIDVICFLIMTFGYSAFGEG--GSGNVLDDVKASRIPVTLVVMLVGMTLAIIIDRALYLRKSVVGKLIYQVLMIAFLHIWVFLVLPNMTRRSAISNHVAQALYVIKSCYFLVSAWQIRNGYPELCIGNLLTHSYGMTNMIAFKVFMNIPFLFELRTAIDWTWTDTSMPLFDFFNMENFYAHIFNIKCARQFEAAYPAPRGIPKGKLVKYMMGFPIIIGVVIFIFSPLLLWSLLNQIGTISMPEKVTLRISIEGYPPLYEMEAQGSNHDNAELGMIKPDQLASLNQALTDSYTTRDTNSILRSRMSVSYLKGYTYEDILIVRFRPESEIYWPISQDSRNAMIDKLS---RNTSVNFEVSLEFTRPYDPNENAALKHSKSWLVPISLDMTIRAKIQSALRGDPGH-PILIPQSIPAFIQVPNQGELTLPTSIGNTIINDGNPRINTTGMEKSDEARAWFDSLTLNLEQGKSQNEKMWIATSEHPGDQNAKLWIKTANTTYSGRPYLQVVGFIDRAFPSFLAKVFKG-GVIAVYLSVILVVGRGLVRGIFTTSPSTVMFTELPNADHLLKICLDIYLVREAKDFMLEQDLFAKLIFLFRSPATLIEWTRMSKKKQE 1730          

HSP 2 Score: 152.525 bits (384), Expect = 2.171e-36
Identity = 158/593 (26.64%), Postives = 273/593 (46.04%), Query Frame = 1
Query: 2557 TATEKLKSLYTLTQPSIWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSAS--IVILKMIYQIKIFQTFNWLTNCSQYGNFANSSMEIIDNAKWLGLEK-LENFQLHILKWTAI--LVGCAVWHIVRYHQMQF-YKLNLDQKPKTSVI--FQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNVLWLPYMIFLGILLPVQYVICVGLPPGLCIEYPLNV-IPK--------LRQWLYLPNYKVSPVPGKILADFVQYIFVVLQYQVFQMEKRKKSDSHKLVKQRLLEGFQKSIHKDFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRS-------CNVILYYNFLVILTKCIFQLMGCVFMNLLKTKG-----LCWMVSLFAIQCINPMSWEIRGIHGKNADKQCSSVASGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLXXXXXXXXXXXXXXXXLNRIERKIKKIEQR---QAQHGKPE 4239
            T  +KL  L   T   +WR +E H +K + ++I      +++A+ I L++++ +    P      + +LF+C+    + + KMIYQ+ I      L+   +     N S   I   +W GL+K +E  +   + +  I  ++  A   IV Y Q  +   L L +  +  V   F       S++N    +++ +++GF K GLE++ I   +    R+D  + +    L+LF + KR     +W+ Y+I++ IL P+Q+   VGLPP  CIEYP +  IP         L   L L  Y V+     ++ DF   +    Q  VF   +R+  D+  +          ++   DFI  K SYVDY K  VF++ +W+TL      G+   +LF LGY++     LW G  + +    S +RS        N +L Y    I  K   Q+ GCVF++     G     LC +  LF+I C+N     ++ +   +      +    + +DV+   F++ Q  IF +  F    ++   +   ++RGA L N  I K +++Q + ++ + N I R+ + I +R   Q + G  E
Sbjct:   68 TLVKKLHKLANQTIELLWRFFEVHISKIVFVIIAIFIANNINALYIPLVILLSLAICLPSAAD-GIFSLFMCAYLFLVALSKMIYQLDIVPE---LSQIDRGVGADNCSHGNISMPEWFGLKKEVEGTEPIYMLFGVIVSIIALAFQSIVIYRQRHYRASLGLPESMRAKVFPDFHHSHFDRSLKN---AIQFLIDYGFYKFGLEITMIAIGIDIFNRMDALAAIQCFWLVLFALNKRVFVRRIWVFYVIYMAILYPLQFFSYVGLPPDSCIEYPWSYWIPSYSDDARFNLSYLLNLSIYGVNWPSAYLIGDFFVLLLASCQLAVF---RREGEDNDSIYNDGNFVIKPENPQYDFIDTKKSYVDYFKSFVFHYGHWITLMSTLAAGIAGTSLFALGYIIFTLTMLWSGNNLYV--MNSTLRSFEHTLKRWNALLGYTLFTITMKVCLQIFGCVFLSWFDQSGGWGKTLCIVRQLFSITCVNNECHVLKELEDFSKACAVETKEGNIGFDVIALSFLVFQIRIFHSWYFQHCMVEYRSEVILANRGAVLKNQLIEKEMKEQNEQQKAKFNDIRRRTEAIRERYQKQIERGAAE 648          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Fly
Match: Piezo (gene:FBgn0264953 transcript:FBtr0335183)

HSP 1 Score: 422.55 bits (1085), Expect = 2.028e-118
Identity = 299/958 (31.21%), Postives = 486/958 (50.73%), Query Frame = 1
Query: 4834 PIPSENETRYQSSHNTAIVNTGTESSVDPVSNGNQRLESSWENFKN--VIKLCVCFIGSTMASLTVLFNEWTREYYRNIRKLEEEKKLVKSHVLSTFIEIDEKLGQEIEKFVKDGRKSVSE-DKEEKNKQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLPVPEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLW--------------------RDHSEFYK--DIKISNEEEVNHIQPLKPQSAMRTGIKF-RNPIKQLK---------KFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPG-TDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPE-KANLLHLI-----------NTKFNSTN------VYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAM--MWWEVNEIIQGQSYCPNP--DSPAKKYLF------LTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQ 7515
            P PS    R Q+S  T+   +  E     V +G    + S E+F    +I+L   F    + +LT+  N ++R Y    R L  EKK +K    S+   +       +  F+K   +S  E + EE+N     +R       +LIS     +  ++  CY ++ +N +++ +L+SLP P +VF WG LS+PRP+K FW+ LI YT+ +++ K I QF LI  N   +P     PL    I G+E    YAI D+I LL LFLHR  LK  GLW                    RD S+     D +  N++    +     Q+++    +F +  I QL+         KF+  + ++      DVYA+MFLC+F    +++ G+ +FG   T+S      ++  NK P+PF+ M++ QF+ I+IDRAL+LRK +  K +F  F VI IH W+FF +P +T+R FNS  PP + Y IKC Y  LSSYQ++SGYP RILGNF T+ ++  N+I FK+YM IPFLYELR ++DW+  DS++  + W+++EDIFS I++++C R  ET +P  R + +  + K  +G  I++    CIWGPL + +          P   S SI +G Y P++  ++  +++  +  + + +M   +     +  ++  ++  D   + +   S ++W I PP  ++L   L     +LK        R +      E +          + E +A L+H++           N   N T       V +P + P+F+       +   S+   ++  Y  + + M  DN    +WWE+ +      YC +   +    K+ +      + ++ FN++   + F  + ++ GI+G+Y  +  +  RF+++F    +  I  E+LP VDR+ +L  +IYLVRE  +  LEE L AKL+FLYRS ET+IKWT+
Sbjct: 1570 PPPSTGLGREQTSKETSDSKSKME-----VDSGEVTAKDSDEDFDTNPIIRLLEGF----LVTLTIRLNRFSRNYRFVNRILAGEKKTLKES--SSLNRLGLSSAAAMFHFLKSNLESAGEFNLEEEN---FAQRDHHIIVEVLISSWYALLANTDLICYIVVFINQVVNASLISLPLPIMVFLWGTLSLPRPTKTFWVTLIAYTQAIVLIKCIFQFKLIWSNYHQLPNQ---PLTPAKIFGVENKAHYAIYDLILLLVLFLHRYLLKSQGLWKSGYKDTDNQFTKPTASIDERDDSDNLSQPDSRQLNDDAAQKLSLQVSQASLPGSPEFSKTGINQLERTKYTSSLYKFFFSLVHKS-RLATDVYALMFLCDFVNFFVLLFGFTAFGTQQTESDEGVQTYLAENKVPIPFLIMLLVQFLLIVIDRALYLRKALVNKIIFHFFSVIGIHIWMFFVVPAVTERTFNSLAPPIIFYVIKCFYMLLSSYQIKSGYPKRILGNFFTKGFSMVNMIAFKVYMQIPFLYELRTILDWVCIDSTMTIFDWLKMEDIFSNIYLIRCTRQSETDFPAMRAQKKASLSKLIMGGTIVLLIVICIWGPLCLFALGNAVGTSNVPFHVSLSIRIGPYDPIYT-TNNYDSIFEINPEMYSQMTNAYIKEKQALTFIAGYDATDVAAVRLAGNSPSLWNIAPPDRQRLLNDLR-NNHTLKARFSYSLTRKAPAKGLKENVGDEHAISLDESFEGRAALIHMLSETHDVEPIYSNGTTNGTTPEVEEVVVIPGMIPKFIKVLNSGDAAVVSVLSPKHYDYRPLVIKMHRDNETNGLWWEIRD------YCNDTFYNETLSKFAYSNCTSGIVMYTFNDKKFPSTFSFL-TAGGIIGLYTTFVLLASRFMKSFIGGQNRKIMFEDLPYVDRVLQLCLDIYLVREALEFALEEDLFAKLLFLYRSPETLIKWTR 2500          

HSP 2 Score: 361.303 bits (926), Expect = 1.199e-99
Identity = 345/1237 (27.89%), Postives = 580/1237 (46.89%), Query Frame = 1
Query:  862 FAGIISPXXXXXXXXXXXXXXXTFWACGNNVMTSNFARMRLFLLLYSAAHVCLIFIVQLEFMQLYIPTGQRLSRLLGLYLMFDTNCKNRGEI-IFNNQRSID-YVSPFIILYVYYLSAIETRIWLEERKRINKERPAVDKETFIHTESYLSGEEINQEESQRISNSFNVEIGSNVSDGPYIDFTDVPHVLDAQNSRSTLFIEEDITKDMEKNQVKERPLLLSIINTMISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNL--PELPTIFRISSSEMQSSEIGLHK----SLIPTGPLAAMMSFLVVFWLTLRLFMTDEKINKSK------ICNEKISTQQKLEHYFGNVDNATYEKFVKCLKEKCEN----YWIFSCCFAMLFVSVNG-SIVLFRIXXXXXXXXXXXXXXXSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIIQVRYFHSRFLELTSMKQTQVCVESERERVKSS------------------KDEMDKNKFSVKNTVEFIRDVNNMVFTATEKLKS----LYTLTQPSIWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSASIVIL-KMIYQIKIFQTFNWLTNCSQYGNFANSSMEIIDNAKWLGLEKLENFQ---LHILKWTAILVGCAVWH-IVRYHQMQF-YKLNLDQKPKTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNVLWLPYMIFLGILLPVQYVICVGLPPGLCIEYPLNVIP---KLRQWLYLPN-YKVSPVPGKILADFVQYIFVVLQYQVFQMEKRKKSD------SHKLVKQRLLE----GFQKSIHKDFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCIN---------PMSWEIRGIHGKNADKQCSSVASG--LHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLXXXXXXXXXXXXXXXXLNRIERKIKKIEQRQA-------------QHGKP----------ELNEHYLVMRSGDYYLF 4287
            FA ++ PS+    Y L +L  GT+WA     +   FA +   +++    H   I   Q  +MQ ++      +RL+GL  + ++ C     + ++NN+ S+D Y++PF + + Y+  A+ T+  ++ R      R A   +         SG  +    +QR         G+++              L++   RS    E++ T     +Q+      +S+   +  NS+I T + MMAWS+ Y SW +F+ LL +  LW+IP+ R   + +SP IV YA  L++ QYIYG +L   ELPT   + ++ +   +IG  +     + P  PL    +F+++FW+T R F  +++  +        I   +I+       Y  N D     KF+K   +  +N     WI+     +   ++ G ++  FRI YM L ++FLLVF  S   W + M  FW  +I Y +  L+ IY +QF +      +   +S  + +DIGLKR+Q  DL   L  P I +++ +IQV YFH RF  + S++Q  +   S +++   +                  K +    + +   T +F   V ++V  +  K+K+    ++   +   WR  E H  K + I      + +V  ++II +   V+G    +   V+++ L     ++++L KMIYQI+      +L++ SQ+ N   S     +NA+W+GL K +      + +L+   I +     H ++   Q+Q   K+     P T ++F  +    + ++   L+KY LNFGF K G+E+S I  V     R D+ ++VY L L++ L+L+R  C  +W  +  F  I +  QY++ VGLPP  C+ +P +  P    +++W  LP     + VP K++ DF+  + +  Q  +F +E+R  S+      S++ V   + +     F    H DF S   +Y D LK+ V    YW TLA++F+ G     L  LGYL+ AFI+LW G    +    ++I     +L +N   IL K  FQ+ GC+FM  L TK  CW+V +  I C +         P   E+    G     +C  +     L WD +CF FII Q  IF +  F  +  D    N  +SRGA +I     K I  +   E++ L++I+RK+++I   Q              +HG P          E+  H    R+GDYY+F
Sbjct:  223 FAAVLRPSVPGGFYFLIFLLSGTYWATCQT-LQRGFALLLRCVMVVLVLHSLSIVSYQTPWMQSHLNHTTLTARLIGLEPLIESYCSPDIRVFLYNNKLSLDSYLNPFALFFAYFALALTTKHLIKPRLVRQSTRKARTPQPL------ESGSSVAPSVTQR---------GNDMQ-------------LESMEQRS----EQENTTTSILDQISYG--FVSVGGFIYQNSYIFTNILMMAWSIVYHSWLTFVLLLSANVLWMIPNQRKAMMRSSPFIVLYAEALLIAQYIYGMDLNNEELPT--SVPTAGINLQQIGFERPIENQMRPCVPLIVKTAFVLMFWVTSRQFFKEKRDRRRDSTLADFIAPLQITVGSAGSSYLIN-DGKKTSKFLKKAGDVIKNLLVRLWIWLLVLVIFLCAITGENMTGFRICYMALFLFFLLVFQSSSKAWVKIMYGFWLFLIFYAMSILILIYTYQFDKFDTYWSDYLNVSATLQKDIGLKRYQTKDLFLHLVSPTIIVILTVIQVHYFHKRF--IASLQQQPLAGGSAQQKPTETTALEPAPSKRRGSAGSLRKSQGPSAEAAPGATTDFETSVRDLVRISFRKIKNKSEYIFKNFKDVFWRFLELHIMKAVYIAAFVCSVSEVCVLHIIFVGFCVLGATSRKAVQVVISRLISFIVTVIVLSKMIYQIE------YLSH-SQH-NVVCSDNRTANNAEWIGLTKADKVTGGLMSLLRTYIIYMVIVTMHAVISLRQLQMRVKIGALNAPPTKLLFPNIIRADAEKDLVGLVKYLLNFGFYKFGIEISLIALVSTITYRQDIVAVVYALWLVVLLLLRRSQCAKIWGVFQAFFAISILTQYIVLVGLPPSSCLVFPWDEGPFGEGIQRWAMLPGALHFNHVP-KLIFDFIVLVILNRQKSIFCIEQRYASNDDYPGGSNRSVIADIAQLGRVPFDNPTH-DFCSYIRNYSDILKNGVLCGFYWFTLAVVFLAGTNIADLLALGYLIGAFIFLWQGSDFYLRPIHTIIFRWKWLLAFNVANILIKTSFQMAGCLFMTQL-TKDCCWLVHMLGITCTSNVLTEQIMLPEEAELALKPG-----ECPKITHQVVLLWDTICFAFIIFQLRIFKSHYFCHIITDTKANNILASRGADIIESLRHKQIAHRHDHEKQVLHKIKRKMERIRATQQKMLRPLDKQTHFDEHGYPLPAPTVRRRKEIKLHPHATRAGDYYMF 1403          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Fly
Match: Piezo (gene:FBgn0264953 transcript:FBtr0335181)

HSP 1 Score: 416.772 bits (1070), Expect = 1.318e-116
Identity = 297/967 (30.71%), Postives = 488/967 (50.47%), Query Frame = 1
Query: 4834 PIPSENETRYQSSHNTAIVNTGTESSVDPVSNGNQRLESSWENFKN--VIKLCVCFIGSTMASLTVLFNEWTREYYRNIRKLEEEKKLVKSHVLSTFIEIDEKLGQEIEKFVK---DGRKSVSEDKEEKN-------KQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLPVPEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLW--------------------RDHSEFYK--DIKISNEEEVNHIQPLKPQSAMRTGIKF-RNPIKQLK---------KFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPG-TDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPE-KANLLHLI-----------NTKFNSTN------VYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAM--MWWEVNEIIQGQSYCPNP--DSPAKKYLF------LTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQ 7515
            P PS    R Q+S  T+   +  E     V +G    + S E+F    +I+L   F    + +LT+  N ++R Y    R L  EKK +K    S+   +       +  F+K   + ++S++     K        +++  +R       +LIS     +  ++  CY ++ +N +++ +L+SLP P +VF WG LS+PRP+K FW+ LI YT+ +++ K I QF LI  N   +P     PL    I G+E    YAI D+I LL LFLHR  LK  GLW                    RD S+     D +  N++    +     Q+++    +F +  I QL+         KF+  + + K     DVYA+MFLC+F    +++ G+ +FG   T+S      ++  NK P+PF+ M++ QF+ I+IDRAL+LRK +  K +F  F VI IH W+FF +P +T+R FNS  PP + Y IKC Y  LSSYQ++SGYP RILGNF T+ ++  N+I FK+YM IPFLYELR ++DW+  DS++  + W+++EDIFS I++++C R  ET +P  R + +  + K  +G  I++    CIWGPL + +          P   S SI +G Y P++  ++  +++  +  + + +M   +     +  ++  ++  D   + +   S ++W I PP  ++L   L     +LK        R +      E +          + E +A L+H++           N   N T       V +P + P+F+       +   S+   ++  Y  + + M  DN    +WWE+ +      YC +   +    K+ +      + ++ FN++   + F  + ++ GI+G+Y  +  +  RF+++F    +  I  E+LP VDR+ +L  +IYLVRE  +  LEE L AKL+FLYRS ET+IKWT+
Sbjct: 1596 PPPSTGLGREQTSKETSDSKSKME-----VDSGEVTAKDSDEDFDTNPIIRLLEGF----LVTLTIRLNRFSRNYRFVNRILAGEKKTLKES--SSLNRLGLSSAAAMFHFLKSNLERKQSINSSPPAKGAGEFNLEEENFAQRDHHIIVEVLISSWYALLANTDLICYIVVFINQVVNASLISLPLPIMVFLWGTLSLPRPTKTFWVTLIAYTQAIVLIKCIFQFKLIWSNYHQLPNQ---PLTPAKIFGVENKAHYAIYDLILLLVLFLHRYLLKSQGLWKSGYKDTDNQFTKPTASIDERDDSDNLSQPDSRQLNDDAAQKLSLQVSQASLPGSPEFSKTGINQLERTKYTSSLYKFFFSLVH-KSRLATDVYALMFLCDFVNFFVLLFGFTAFGTQQTESDEGVQTYLAENKVPIPFLIMLLVQFLLIVIDRALYLRKALVNKIIFHFFSVIGIHIWMFFVVPAVTERTFNSLAPPIIFYVIKCFYMLLSSYQIKSGYPKRILGNFFTKGFSMVNMIAFKVYMQIPFLYELRTILDWVCIDSTMTIFDWLKMEDIFSNIYLIRCTRQSETDFPAMRAQKKASLSKLIMGGTIVLLIVICIWGPLCLFALGNAVGTSNVPFHVSLSIRIGPYDPIYT-TNNYDSIFEINPEMYSQMTNAYIKEKQALTFIAGYDATDVAAVRLAGNSPSLWNIAPPDRQRLLNDLR-NNHTLKARFSYSLTRKAPAKGLKENVGDEHAISLDESFEGRAALIHMLSETHDVEPIYSNGTTNGTTPEVEEVVVIPGMIPKFIKVLNSGDAAVVSVLSPKHYDYRPLVIKMHRDNETNGLWWEIRD------YCNDTFYNETLSKFAYSNCTSGIVMYTFNDKKFPSTFSFL-TAGGIIGLYTTFVLLASRFMKSFIGGQNRKIMFEDLPYVDRVLQLCLDIYLVREALEFALEEDLFAKLLFLYRSPETLIKWTR 2538          

HSP 2 Score: 340.502 bits (872), Expect = 2.524e-93
Identity = 298/1017 (29.30%), Postives = 489/1017 (48.08%), Query Frame = 1
Query: 1516 LSIINTMISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNL--PELPTIFRISSSEMQSSEIGLHK----SLIPTGPLAAMMSFLVVFWLTLRLFMTDEKINKSK------ICNEKISTQQKLEHYFGNVDNATYEKFVKCLKEKCEN----YWIFSCCFAMLFVSVNG-SIVLFRIXXXXXXXXXXXXXXXSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIIQVRYFHSRFLELTSMKQTQVCVESERERVKSS------------------KDEMDKNKFSVKNTVEFIRDVNNMVFTATEKLKS----LYTLTQPSIWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSASIVIL-KMIYQIKIFQTFNWLTNCSQYGNFANSSMEIIDNAKWLGLEKLENFQ---LHILKWTAILVGCAVWH-IVRYHQMQF-YKLNLDQKPKTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNVLWLPYMIFLGILLPVQYVICVGLPPGLCIEYPLNVIP---KLRQWLYLPN-YKVSPVPGKILADFVQYIFVVLQYQVFQMEKRKKSD------SHKLVKQRLLE----GFQKSIHKDFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCIN---------PMSWEIRGIHGKNADKQCSSVASG--LHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLXXXXXXXXXXXXXXXXLNRIERKIKKIEQRQA-------------QHGKP----------ELNEHYLVMRSGDYYLF 4287
            +S+   +  NS+I T + MMAWS+ Y SW +F+ LL +  LW+IP+ R   + +SP IV YA  L++ QYIYG +L   ELPT   + ++ +   +IG  +     + P  PL    +F+++FW+T R F  +++  +        I   +I+       Y  N D     KF+K   +  +N     WI+     +   ++ G ++  FRI YM L ++FLLVF  S   W + M  FW  +I Y +  L+ IY +QF +      +   +S  + +DIGLKR+Q  DL   L  P I +++ +IQV YFH RF  + S++Q  +   S +++   +                  K +    + +   T +F   V ++V  +  K+K+    ++   +   WR  E H  K + I      + +V  ++II +   V+G    +   V+++ L     ++++L KMIYQI+      +L++ SQ+ N   S     +NA+W+GL K +      + +L+   I +     H ++   Q+Q   K+     P T ++F  +    + ++   L+KY LNFGF K G+E+S I  V     R D+ ++VY L L++ L+L+R  C  +W  +  F  I +  QY++ VGLPP  C+ +P +  P    +++W  LP     + VP K++ DF+  + +  Q  +F +E+R  S+      S++ V   + +     F    H DF S   +Y D LK+ V    YW TLA++F+ G     L  LGYL+ AFI+LW G    +    ++I     +L +N   IL K  FQ+ GC+FM  L TK  CW+V +  I C +         P   E+    G     +C  +     L WD +CF FII Q  IF +  F  +  D    N  +SRGA +I     K I  +   E++ L++I+RK+++I   Q              +HG P          E+  H    R+GDYY+F
Sbjct:  501 VSVGGFIYQNSYIFTNILMMAWSIVYHSWLTFVLLLSANVLWMIPNQRKAMMRSSPFIVLYAEALLIAQYIYGMDLNNEELPT--SVPTAGINLQQIGFERPIENQMRPCVPLIVKTAFVLMFWVTSRQFFKEKRDRRRDSTLADFIAPLQITVGSAGSSYLIN-DGKKTSKFLKKAGDVIKNLLVRLWIWLLVLVIFLCAITGENMTGFRICYMALFLFFLLVFQSSSKAWVKIMYGFWLFLIFYAMSILILIYTYQFDKFDTYWSDYLNVSATLQKDIGLKRYQTKDLFLHLVSPTIIVILTVIQVHYFHKRF--IASLQQQPLAGGSAQQKPTETTALEPAPSKRRGSAGSLRKSQGPSAEAAPGATTDFETSVRDLVRISFRKIKNKSEYIFKNFKDVFWRFLELHIMKAVYIAAFVCSVSEVCVLHIIFVGFCVLGATSRKAVQVVISRLISFIVTVIVLSKMIYQIE------YLSH-SQH-NVVCSDNRTANNAEWIGLTKADKVTGGLMSLLRTYIIYMVIVTMHAVISLRQLQMRVKIGALNAPPTKLLFPNIIRADAEKDLVGLVKYLLNFGFYKFGIEISLIALVSTITYRQDIVAVVYALWLVVLLLLRRSQCAKIWGVFQAFFAISILTQYIVLVGLPPSSCLVFPWDEGPFGEGIQRWAMLPGALHFNHVP-KLIFDFIVLVILNRQKSIFCIEQRYASNDDYPGGSNRSVIADIAQLGRVPFDNPTH-DFCSYIRNYSDILKNGVLCGFYWFTLAVVFLAGTNIADLLALGYLIGAFIFLWQGSDFYLRPIHTIIFRWKWLLAFNVANILIKTSFQMAGCLFMTQL-TKDCCWLVHMLGITCTSNVLTEQIMLPEEAELALKPG-----ECPKITHQVVLLWDTICFAFIIFQLRIFKSHYFCHIITDTKANNILASRGADIIESLRHKQIAHRHDHEKQVLHKIKRKMERIRATQQKMLRPLDKQTHFDEHGYPLPAPTVRRRKEIKLHPHATRAGDYYMF 1496          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Fly
Match: Piezo (gene:FBgn0264953 transcript:FBtr0335182)

HSP 1 Score: 401.749 bits (1031), Expect = 4.592e-112
Identity = 264/830 (31.81%), Postives = 433/830 (52.17%), Query Frame = 1
Query: 5209 KQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLPVPEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLW--------------------RDHSEFYK--DIKISNEEEVNHIQPLKPQSAMRTGIKF-RNPIKQLK---------KFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPG-TDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPE-KANLLHLI-----------NTKFNSTN------VYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAM--MWWEVNEIIQGQSYCPNP--DSPAKKYLF------LTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQ 7515
            +++  +R       +LIS     +  ++  CY ++ +N +++ +L+SLP P +VF WG LS+PRP+K FW+ LI YT+ +++ K I QF LI  N   +P     PL    I G+E    YAI D+I LL LFLHR  LK  GLW                    RD S+     D +  N++    +     Q+++    +F +  I QL+         KF+  + ++      DVYA+MFLC+F    +++ G+ +FG   T+S      ++  NK P+PF+ M++ QF+ I+IDRAL+LRK +  K +F  F VI IH W+FF +P +T+R FNS  PP + Y IKC Y  LSSYQ++SGYP RILGNF T+ ++  N+I FK+YM IPFLYELR ++DW+  DS++  + W+++EDIFS I++++C R  ET +P  R + +  + K  +G  I++    CIWGPL + +          P   S SI +G Y P++  ++  +++  +  + + +M   +     +  ++  ++  D   + +   S ++W I PP  ++L   L     +LK        R +      E +          + E +A L+H++           N   N T       V +P + P+F+       +   S+   ++  Y  + + M  DN    +WWE+ +      YC +   +    K+ +      + ++ FN++   + F  + ++ GI+G+Y  +  +  RF+++F    +  I  E+LP VDR+ +L  +IYLVRE  +  LEE L AKL+FLYRS ET+IKWT+
Sbjct: 1702 EENFAQRDHHIIVEVLISSWYALLANTDLICYIVVFINQVVNASLISLPLPIMVFLWGTLSLPRPTKTFWVTLIAYTQAIVLIKCIFQFKLIWSNYHQLPNQ---PLTPAKIFGVENKAHYAIYDLILLLVLFLHRYLLKSQGLWKSGYKDTDNQFTKPTASIDERDDSDNLSQPDSRQLNDDAAQKLSLQVSQASLPGSPEFSKTGINQLERTKYTSSLYKFFFSLVHKS-RLATDVYALMFLCDFVNFFVLLFGFTAFGTQQTESDEGVQTYLAENKVPIPFLIMLLVQFLLIVIDRALYLRKALVNKIIFHFFSVIGIHIWMFFVVPAVTERTFNSLAPPIIFYVIKCFYMLLSSYQIKSGYPKRILGNFFTKGFSMVNMIAFKVYMQIPFLYELRTILDWVCIDSTMTIFDWLKMEDIFSNIYLIRCTRQSETDFPAMRAQKKASLSKLIMGGTIVLLIVICIWGPLCLFALGNAVGTSNVPFHVSLSIRIGPYDPIYT-TNNYDSIFEINPEMYSQMTNAYIKEKQALTFIAGYDATDVAAVRLAGNSPSLWNIAPPDRQRLLNDLR-NNHTLKARFSYSLTRKAPAKGLKENVGDEHAISLDESFEGRAALIHMLSETHDVEPIYSNGTTNGTTPEVEEVVVIPGMIPKFIKVLNSGDAAVVSVLSPKHYDYRPLVIKMHRDNETNGLWWEIRD------YCNDTFYNETLSKFAYSNCTSGIVMYTFNDKKFPSTFSFL-TAGGIIGLYTTFVLLASRFMKSFIGGQNRKIMFEDLPYVDRVLQLCLDIYLVREALEFALEEDLFAKLLFLYRSPETLIKWTR 2518          

HSP 2 Score: 375.17 bits (962), Expect = 7.074e-104
Identity = 344/1216 (28.29%), Postives = 591/1216 (48.60%), Query Frame = 1
Query:  862 FAGIISPXXXXXXXXXXXXXXXTFWACGNNVMTSNFARMRLFLLLYSAAHVCLIFIVQLEFMQLYIPTGQRLSRLLGLYLMFDTNCKNRGEI-IFNNQRSID-YVSPFIILYVYYLSAIETRIWLEERKRINKERPAVDKETFIHTESYLSGEEINQEESQRISNSFNVEIGSNVSDGPYIDFTDVPHVLDAQNSRSTLFIEEDITKDMEKNQVKERPLLLSIINTMISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNL--PELPT-IFRISSSEMQSSEIGLHK----SLIPTGPLAAMMSFLVVFWLTLRLFMTDEKINKSK------ICNEKISTQQKLEHYFGNVDNATYEKFVKCLKEKCEN----YWIFSCCFAMLFVSVNG-SIVLFRIXXXXXXXXXXXXXXXSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIIQVRYFHSRFLELTSMKQTQVCVESERERVKSS------------------KDEMDKNKFSVKNTVEFIRDVNNMVFTATEKLKS----LYTLTQPSIWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSASIVIL-KMIYQIKIFQTFNWLTNCSQYGNFANSSMEIIDNAKWLGLEKLENFQ---LHILKWTAILVGCAVWH-IVRYHQMQF-YKLNLDQKPKTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNVLWLPYMIFLGILLPVQYVICVGLPPGLCIEYPLNVIP---KLRQWLYLPN-YKVSPVPGKILADFVQYIFVVLQYQVFQMEKRKKSD------SHKLVKQRLLE----GFQKSIHKDFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCIN---------PMSWEIRGIHGKNADKQCSSVASG--LHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLXXXXXXXXXXXXXXXXLNRIERKIKKIEQRQAQHGKP-ELNEHYLVMRSGDYYLF 4287
            FA ++ PS+    Y L +L  GT+WA     +   FA +   +++    H   I   Q  +MQ ++      +RL+GL  + ++ C     + ++NN+ S+D Y++PF + + Y+  A+ T+  ++ R  + +++ A   E    TE+      + ++ +++      +E GS+V+  P +        L++   RS    E++ T     +Q+      +S+   +  NS+I T + MMAWS+ Y SW +F+ LL +  LW+IP+ R   + +SP IV YA  L++ QYIYG +L   ELPT +  + ++ +   +IG  +     + P  PL    +F+++FW+T R F  +++  +        I   +I+       Y  N D     KF+K   +  +N     WI+     +   ++ G ++  FRI YM L ++FLLVF  S   W + M  FW  +I Y +  L+ IY +QF +      +   +S  + +DIGLKR+Q  DL   L  P I +++ +IQV YFH RF  + S++Q  +   S +++   +                  K +    + +   T +F   V ++V  +  K+K+    ++   +   WR  E H  K + I      + +V  ++II +   V+G    +   V+++ L     ++++L KMIYQI+      +L++ SQ+ N   S     +NA+W+GL K +      + +L+   I +     H ++   Q+Q   K+     P T ++F  +    + ++   L+KY LNFGF K G+E+S I  V     R D+ ++VY L L++ L+L+R  C  +W  +  F  I +  QY++ VGLPP  C+ +P +  P    +++W  LP     + VP K++ DF+  + +  Q  +F +E+R  S+      S++ V   + +     F    H DF S   +Y D LK+ V    YW TLA++F+ G     L  LGYL+ AFI+LW G    +    ++I     +L +N   IL K  FQ+ GC+FM  L TK  CW+V +  I C +         P   E+    G     +C  +     L WD +CF FII Q  IF +  F  +  D    N  +SRGA +I     K I  +   E++ L++I+RK+++I   Q +  +P +   H+   R+GDYY+F
Sbjct:  223 FAAVLRPSVPGGFYFLIFLLSGTYWATCQT-LQRGFALLLRCVMVVLVLHSLSIVSYQTPWMQSHLNHTTLTARLIGLEPLIESYCSPDIRVFLYNNKLSLDSYLNPFALFFAYFALALTTKHLIKPRVSLRRDQRATLNEP---TET----TPLVRQSTRKARTPQPLESGSSVA--PSVTQRGNDMQLESMEQRS----EQENTTTSILDQISYG--FVSVGGFIYQNSYIFTNILMMAWSIVYHSWLTFVLLLSANVLWMIPNQRKAMMRSSPFIVLYAEALLIAQYIYGMDLNNEELPTSVPYLQTAGINLQQIGFERPIENQMRPCVPLIVKTAFVLMFWVTSRQFFKEKRDRRRDSTLADFIAPLQITVGSAGSSYLIN-DGKKTSKFLKKAGDVIKNLLVRLWIWLLVLVIFLCAITGENMTGFRICYMALFLFFLLVFQSSSKAWVKIMYGFWLFLIFYAMSILILIYTYQFDKFDTYWSDYLNVSATLQKDIGLKRYQTKDLFLHLVSPTIIVILTVIQVHYFHKRF--IASLQQQPLAGGSAQQKPTETTALEPAPSKRRGSAGSLRKSQGPSAEAAPGATTDFETSVRDLVRISFRKIKNKSEYIFKNFKDVFWRFLELHIMKAVYIAAFVCSVSEVCVLHIIFVGFCVLGATSRKAVQVVISRLISFIVTVIVLSKMIYQIE------YLSH-SQH-NVVCSDNRTANNAEWIGLTKADKVTGGLMSLLRTYIIYMVIVTMHAVISLRQLQMRVKIGALNAPPTKLLFPNIIRADAEKDLVGLVKYLLNFGFYKFGIEISLIALVSTITYRQDIVAVVYALWLVVLLLLRRSQCAKIWGVFQAFFAISILTQYIVLVGLPPSSCLVFPWDEGPFGEGIQRWAMLPGALHFNHVP-KLIFDFIVLVILNRQKSIFCIEQRYASNDDYPGGSNRSVIADIAQLGRVPFDNPTH-DFCSYIRNYSDILKNGVLCGFYWFTLAVVFLAGTNIADLLALGYLIGAFIFLWQGSDFYLRPIHTIIFRWKWLLAFNVANILIKTSFQMAGCLFMTQL-TKDCCWLVHMLGITCTSNVLTEQIMLPEEAELALKPG-----ECPKITHQVVLLWDTICFAFIIFQLRIFKSHYFCHIITDTKANNILASRGADIIESLRHKQIAHRHDHEKQVLHKIKRKMERIRATQQKMLRPLDKQTHFDATRAGDYYMF 1403          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Fly
Match: Piezo (gene:FBgn0264953 transcript:FBtr0335179)

HSP 1 Score: 401.749 bits (1031), Expect = 5.217e-112
Identity = 264/830 (31.81%), Postives = 433/830 (52.17%), Query Frame = 1
Query: 5209 KQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLPVPEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLW--------------------RDHSEFYK--DIKISNEEEVNHIQPLKPQSAMRTGIKF-RNPIKQLK---------KFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPG-TDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPE-KANLLHLI-----------NTKFNSTN------VYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAM--MWWEVNEIIQGQSYCPNP--DSPAKKYLF------LTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQ 7515
            +++  +R       +LIS     +  ++  CY ++ +N +++ +L+SLP P +VF WG LS+PRP+K FW+ LI YT+ +++ K I QF LI  N   +P     PL    I G+E    YAI D+I LL LFLHR  LK  GLW                    RD S+     D +  N++    +     Q+++    +F +  I QL+         KF+  + ++      DVYA+MFLC+F    +++ G+ +FG   T+S      ++  NK P+PF+ M++ QF+ I+IDRAL+LRK +  K +F  F VI IH W+FF +P +T+R FNS  PP + Y IKC Y  LSSYQ++SGYP RILGNF T+ ++  N+I FK+YM IPFLYELR ++DW+  DS++  + W+++EDIFS I++++C R  ET +P  R + +  + K  +G  I++    CIWGPL + +          P   S SI +G Y P++  ++  +++  +  + + +M   +     +  ++  ++  D   + +   S ++W I PP  ++L   L     +LK        R +      E +          + E +A L+H++           N   N T       V +P + P+F+       +   S+   ++  Y  + + M  DN    +WWE+ +      YC +   +    K+ +      + ++ FN++   + F  + ++ GI+G+Y  +  +  RF+++F    +  I  E+LP VDR+ +L  +IYLVRE  +  LEE L AKL+FLYRS ET+IKWT+
Sbjct: 1702 EENFAQRDHHIIVEVLISSWYALLANTDLICYIVVFINQVVNASLISLPLPIMVFLWGTLSLPRPTKTFWVTLIAYTQAIVLIKCIFQFKLIWSNYHQLPNQ---PLTPAKIFGVENKAHYAIYDLILLLVLFLHRYLLKSQGLWKSGYKDTDNQFTKPTASIDERDDSDNLSQPDSRQLNDDAAQKLSLQVSQASLPGSPEFSKTGINQLERTKYTSSLYKFFFSLVHKS-RLATDVYALMFLCDFVNFFVLLFGFTAFGTQQTESDEGVQTYLAENKVPIPFLIMLLVQFLLIVIDRALYLRKALVNKIIFHFFSVIGIHIWMFFVVPAVTERTFNSLAPPIIFYVIKCFYMLLSSYQIKSGYPKRILGNFFTKGFSMVNMIAFKVYMQIPFLYELRTILDWVCIDSTMTIFDWLKMEDIFSNIYLIRCTRQSETDFPAMRAQKKASLSKLIMGGTIVLLIVICIWGPLCLFALGNAVGTSNVPFHVSLSIRIGPYDPIYT-TNNYDSIFEINPEMYSQMTNAYIKEKQALTFIAGYDATDVAAVRLAGNSPSLWNIAPPDRQRLLNDLR-NNHTLKARFSYSLTRKAPAKGLKENVGDEHAISLDESFEGRAALIHMLSETHDVEPIYSNGTTNGTTPEVEEVVVIPGMIPKFIKVLNSGDAAVVSVLSPKHYDYRPLVIKMHRDNETNGLWWEIRD------YCNDTFYNETLSKFAYSNCTSGIVMYTFNDKKFPSTFSFL-TAGGIIGLYTTFVLLASRFMKSFIGGQNRKIMFEDLPYVDRVLQLCLDIYLVREALEFALEEDLFAKLLFLYRSPETLIKWTR 2518          

HSP 2 Score: 360.918 bits (925), Expect = 1.335e-99
Identity = 345/1237 (27.89%), Postives = 580/1237 (46.89%), Query Frame = 1
Query:  862 FAGIISPXXXXXXXXXXXXXXXTFWACGNNVMTSNFARMRLFLLLYSAAHVCLIFIVQLEFMQLYIPTGQRLSRLLGLYLMFDTNCKNRGEI-IFNNQRSID-YVSPFIILYVYYLSAIETRIWLEERKRINKERPAVDKETFIHTESYLSGEEINQEESQRISNSFNVEIGSNVSDGPYIDFTDVPHVLDAQNSRSTLFIEEDITKDMEKNQVKERPLLLSIINTMISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNL--PELPTIFRISSSEMQSSEIGLHK----SLIPTGPLAAMMSFLVVFWLTLRLFMTDEKINKSK------ICNEKISTQQKLEHYFGNVDNATYEKFVKCLKEKCEN----YWIFSCCFAMLFVSVNG-SIVLFRIXXXXXXXXXXXXXXXSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIIQVRYFHSRFLELTSMKQTQVCVESERERVKSS------------------KDEMDKNKFSVKNTVEFIRDVNNMVFTATEKLKS----LYTLTQPSIWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSASIVIL-KMIYQIKIFQTFNWLTNCSQYGNFANSSMEIIDNAKWLGLEKLENFQ---LHILKWTAILVGCAVWH-IVRYHQMQF-YKLNLDQKPKTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNVLWLPYMIFLGILLPVQYVICVGLPPGLCIEYPLNVIP---KLRQWLYLPN-YKVSPVPGKILADFVQYIFVVLQYQVFQMEKRKKSD------SHKLVKQRLLE----GFQKSIHKDFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCIN---------PMSWEIRGIHGKNADKQCSSVASG--LHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLXXXXXXXXXXXXXXXXLNRIERKIKKIEQRQA-------------QHGKP----------ELNEHYLVMRSGDYYLF 4287
            FA ++ PS+    Y L +L  GT+WA     +   FA +   +++    H   I   Q  +MQ ++      +RL+GL  + ++ C     + ++NN+ S+D Y++PF + + Y+  A+ T+  ++ R      R A   +         SG  +    +QR         G+++              L++   RS    E++ T     +Q+      +S+   +  NS+I T + MMAWS+ Y SW +F+ LL +  LW+IP+ R   + +SP IV YA  L++ QYIYG +L   ELPT   + ++ +   +IG  +     + P  PL    +F+++FW+T R F  +++  +        I   +I+       Y  N D     KF+K   +  +N     WI+     +   ++ G ++  FRI YM L ++FLLVF  S   W + M  FW  +I Y +  L+ IY +QF +      +   +S  + +DIGLKR+Q  DL   L  P I +++ +IQV YFH RF  + S++Q  +   S +++   +                  K +    + +   T +F   V ++V  +  K+K+    ++   +   WR  E H  K + I      + +V  ++II +   V+G    +   V+++ L     ++++L KMIYQI+      +L++ SQ+ N   S     +NA+W+GL K +      + +L+   I +     H ++   Q+Q   K+     P T ++F  +    + ++   L+KY LNFGF K G+E+S I  V     R D+ ++VY L L++ L+L+R  C  +W  +  F  I +  QY++ VGLPP  C+ +P +  P    +++W  LP     + VP K++ DF+  + +  Q  +F +E+R  S+      S++ V   + +     F    H DF S   +Y D LK+ V    YW TLA++F+ G     L  LGYL+ AFI+LW G    +    ++I     +L +N   IL K  FQ+ GC+FM  L TK  CW+V +  I C +         P   E+    G     +C  +     L WD +CF FII Q  IF +  F  +  D    N  +SRGA +I     K I  +   E++ L++I+RK+++I   Q              +HG P          E+  H    R+GDYY+F
Sbjct:  223 FAAVLRPSVPGGFYFLIFLLSGTYWATCQT-LQRGFALLLRCVMVVLVLHSLSIVSYQTPWMQSHLNHTTLTARLIGLEPLIESYCSPDIRVFLYNNKLSLDSYLNPFALFFAYFALALTTKHLIKPRLVRQSTRKARTPQPL------ESGSSVAPSVTQR---------GNDMQ-------------LESMEQRS----EQENTTTSILDQISYG--FVSVGGFIYQNSYIFTNILMMAWSIVYHSWLTFVLLLSANVLWMIPNQRKAMMRSSPFIVLYAEALLIAQYIYGMDLNNEELPT--SVPTAGINLQQIGFERPIENQMRPCVPLIVKTAFVLMFWVTSRQFFKEKRDRRRDSTLADFIAPLQITVGSAGSSYLIN-DGKKTSKFLKKAGDVIKNLLVRLWIWLLVLVIFLCAITGENMTGFRICYMALFLFFLLVFQSSSKAWVKIMYGFWLFLIFYAMSILILIYTYQFDKFDTYWSDYLNVSATLQKDIGLKRYQTKDLFLHLVSPTIIVILTVIQVHYFHKRF--IASLQQQPLAGGSAQQKPTETTALEPAPSKRRGSAGSLRKSQGPSAEAAPGATTDFETSVRDLVRISFRKIKNKSEYIFKNFKDVFWRFLELHIMKAVYIAAFVCSVSEVCVLHIIFVGFCVLGATSRKAVQVVISRLISFIVTVIVLSKMIYQIE------YLSH-SQH-NVVCSDNRTANNAEWIGLTKADKVTGGLMSLLRTYIIYMVIVTMHAVISLRQLQMRVKIGALNAPPTKLLFPNIIRADAEKDLVGLVKYLLNFGFYKFGIEISLIALVSTITYRQDIVAVVYALWLVVLLLLRRSQCAKIWGVFQAFFAISILTQYIVLVGLPPSSCLVFPWDEGPFGEGIQRWAMLPGALHFNHVP-KLIFDFIVLVILNRQKSIFCIEQRYASNDDYPGGSNRSVIADIAQLGRVPFDNPTH-DFCSYIRNYSDILKNGVLCGFYWFTLAVVFLAGTNIADLLALGYLIGAFIFLWQGSDFYLRPIHTIIFRWKWLLAFNVANILIKTSFQMAGCLFMTQL-TKDCCWLVHMLGITCTSNVLTEQIMLPEEAELALKPG-----ECPKITHQVVLLWDTICFAFIIFQLRIFKSHYFCHIITDTKANNILASRGADIIESLRHKQIAHRHDHEKQVLHKIKRKMERIRATQQKMLRPLDKQTHFDEHGYPLPAPTVRRRKEIKLHPHATRAGDYYMF 1403          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Fly
Match: Piezo (gene:FBgn0264953 transcript:FBtr0335177)

HSP 1 Score: 401.364 bits (1030), Expect = 7.089e-112
Identity = 265/830 (31.93%), Postives = 433/830 (52.17%), Query Frame = 1
Query: 5209 KQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLPVPEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLW--------------------RDHSEFYK--DIKISNEEEVNHIQPLKPQSAMRTGIKF-RNPIKQLK---------KFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPG-TDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPE-KANLLHLI-----------NTKFNSTN------VYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAM--MWWEVNEIIQGQSYCPNP--DSPAKKYLF------LTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQ 7515
            +++  +R       +LIS     +  ++  CY ++ +N +++ +L+SLP P +VF WG LS+PRP+K FW+ LI YT+ +++ K I QF LI  N   +P     PL    I G+E    YAI D+I LL LFLHR  LK  GLW                    RD S+     D +  N++    +     Q+++    +F +  I QL+         KF+  + + K     DVYA+MFLC+F    +++ G+ +FG   T+S      ++  NK P+PF+ M++ QF+ I+IDRAL+LRK +  K +F  F VI IH W+FF +P +T+R FNS  PP + Y IKC Y  LSSYQ++SGYP RILGNF T+ ++  N+I FK+YM IPFLYELR ++DW+  DS++  + W+++EDIFS I++++C R  ET +P  R + +  + K  +G  I++    CIWGPL + +          P   S SI +G Y P++  ++  +++  +  + + +M   +     +  ++  ++  D   + +   S ++W I PP  ++L   L     +LK        R +      E +          + E +A L+H++           N   N T       V +P + P+F+       +   S+   ++  Y  + + M  DN    +WWE+ +      YC +   +    K+ +      + ++ FN++   + F  + ++ GI+G+Y  +  +  RF+++F    +  I  E+LP VDR+ +L  +IYLVRE  +  LEE L AKL+FLYRS ET+IKWT+
Sbjct: 1837 EENFAQRDHHIIVEVLISSWYALLANTDLICYIVVFINQVVNASLISLPLPIMVFLWGTLSLPRPTKTFWVTLIAYTQAIVLIKCIFQFKLIWSNYHQLPNQ---PLTPAKIFGVENKAHYAIYDLILLLVLFLHRYLLKSQGLWKSGYKDTDNQFTKPTASIDERDDSDNLSQPDSRQLNDDAAQKLSLQVSQASLPGSPEFSKTGINQLERTKYTSSLYKFFFSLVH-KSRLATDVYALMFLCDFVNFFVLLFGFTAFGTQQTESDEGVQTYLAENKVPIPFLIMLLVQFLLIVIDRALYLRKALVNKIIFHFFSVIGIHIWMFFVVPAVTERTFNSLAPPIIFYVIKCFYMLLSSYQIKSGYPKRILGNFFTKGFSMVNMIAFKVYMQIPFLYELRTILDWVCIDSTMTIFDWLKMEDIFSNIYLIRCTRQSETDFPAMRAQKKASLSKLIMGGTIVLLIVICIWGPLCLFALGNAVGTSNVPFHVSLSIRIGPYDPIYT-TNNYDSIFEINPEMYSQMTNAYIKEKQALTFIAGYDATDVAAVRLAGNSPSLWNIAPPDRQRLLNDLR-NNHTLKARFSYSLTRKAPAKGLKENVGDEHAISLDESFEGRAALIHMLSETHDVEPIYSNGTTNGTTPEVEEVVVIPGMIPKFIKVLNSGDAAVVSVLSPKHYDYRPLVIKMHRDNETNGLWWEIRD------YCNDTFYNETLSKFAYSNCTSGIVMYTFNDKKFPSTFSFL-TAGGIIGLYTTFVLLASRFMKSFIGGQNRKIMFEDLPYVDRVLQLCLDIYLVREALEFALEEDLFAKLLFLYRSPETLIKWTR 2653          

HSP 2 Score: 361.688 bits (927), Expect = 8.599e-100
Identity = 345/1237 (27.89%), Postives = 580/1237 (46.89%), Query Frame = 1
Query:  862 FAGIISPXXXXXXXXXXXXXXXTFWACGNNVMTSNFARMRLFLLLYSAAHVCLIFIVQLEFMQLYIPTGQRLSRLLGLYLMFDTNCKNRGEI-IFNNQRSID-YVSPFIILYVYYLSAIETRIWLEERKRINKERPAVDKETFIHTESYLSGEEINQEESQRISNSFNVEIGSNVSDGPYIDFTDVPHVLDAQNSRSTLFIEEDITKDMEKNQVKERPLLLSIINTMISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNL--PELPTIFRISSSEMQSSEIGLHK----SLIPTGPLAAMMSFLVVFWLTLRLFMTDEKINKSK------ICNEKISTQQKLEHYFGNVDNATYEKFVKCLKEKCEN----YWIFSCCFAMLFVSVNG-SIVLFRIXXXXXXXXXXXXXXXSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIIQVRYFHSRFLELTSMKQTQVCVESERERVKSS------------------KDEMDKNKFSVKNTVEFIRDVNNMVFTATEKLKS----LYTLTQPSIWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSASIVIL-KMIYQIKIFQTFNWLTNCSQYGNFANSSMEIIDNAKWLGLEKLENFQ---LHILKWTAILVGCAVWH-IVRYHQMQF-YKLNLDQKPKTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNVLWLPYMIFLGILLPVQYVICVGLPPGLCIEYPLNVIP---KLRQWLYLPN-YKVSPVPGKILADFVQYIFVVLQYQVFQMEKRKKSD------SHKLVKQRLLE----GFQKSIHKDFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCIN---------PMSWEIRGIHGKNADKQCSSVASG--LHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLXXXXXXXXXXXXXXXXLNRIERKIKKIEQRQA-------------QHGKP----------ELNEHYLVMRSGDYYLF 4287
            FA ++ PS+    Y L +L  GT+WA     +   FA +   +++    H   I   Q  +MQ ++      +RL+GL  + ++ C     + ++NN+ S+D Y++PF + + Y+  A+ T+  ++ R      R A   +         SG  +    +QR         G+++              L++   RS    E++ T     +Q+      +S+   +  NS+I T + MMAWS+ Y SW +F+ LL +  LW+IP+ R   + +SP IV YA  L++ QYIYG +L   ELPT   + ++ +   +IG  +     + P  PL    +F+++FW+T R F  +++  +        I   +I+       Y  N D     KF+K   +  +N     WI+     +   ++ G ++  FRI YM L ++FLLVF  S   W + M  FW  +I Y +  L+ IY +QF +      +   +S  + +DIGLKR+Q  DL   L  P I +++ +IQV YFH RF  + S++Q  +   S +++   +                  K +    + +   T +F   V ++V  +  K+K+    ++   +   WR  E H  K + I      + +V  ++II +   V+G    +   V+++ L     ++++L KMIYQI+      +L++ SQ+ N   S     +NA+W+GL K +      + +L+   I +     H ++   Q+Q   K+     P T ++F  +    + ++   L+KY LNFGF K G+E+S I  V     R D+ ++VY L L++ L+L+R  C  +W  +  F  I +  QY++ VGLPP  C+ +P +  P    +++W  LP     + VP K++ DF+  + +  Q  +F +E+R  S+      S++ V   + +     F    H DF S   +Y D LK+ V    YW TLA++F+ G     L  LGYL+ AFI+LW G    +    ++I     +L +N   IL K  FQ+ GC+FM  L TK  CW+V +  I C +         P   E+    G     +C  +     L WD +CF FII Q  IF +  F  +  D    N  +SRGA +I     K I  +   E++ L++I+RK+++I   Q              +HG P          E+  H    R+GDYY+F
Sbjct:  223 FAAVLRPSVPGGFYFLIFLLSGTYWATCQT-LQRGFALLLRCVMVVLVLHSLSIVSYQTPWMQSHLNHTTLTARLIGLEPLIESYCSPDIRVFLYNNKLSLDSYLNPFALFFAYFALALTTKHLIKPRLVRQSTRKARTPQPL------ESGSSVAPSVTQR---------GNDMQ-------------LESMEQRS----EQENTTTSILDQISYG--FVSVGGFIYQNSYIFTNILMMAWSIVYHSWLTFVLLLSANVLWMIPNQRKAMMRSSPFIVLYAEALLIAQYIYGMDLNNEELPT--SVPTAGINLQQIGFERPIENQMRPCVPLIVKTAFVLMFWVTSRQFFKEKRDRRRDSTLADFIAPLQITVGSAGSSYLIN-DGKKTSKFLKKAGDVIKNLLVRLWIWLLVLVIFLCAITGENMTGFRICYMALFLFFLLVFQSSSKAWVKIMYGFWLFLIFYAMSILILIYTYQFDKFDTYWSDYLNVSATLQKDIGLKRYQTKDLFLHLVSPTIIVILTVIQVHYFHKRF--IASLQQQPLAGGSAQQKPTETTALEPAPSKRRGSAGSLRKSQGPSAEAAPGATTDFETSVRDLVRISFRKIKNKSEYIFKNFKDVFWRFLELHIMKAVYIAAFVCSVSEVCVLHIIFVGFCVLGATSRKAVQVVISRLISFIVTVIVLSKMIYQIE------YLSH-SQH-NVVCSDNRTANNAEWIGLTKADKVTGGLMSLLRTYIIYMVIVTMHAVISLRQLQMRVKIGALNAPPTKLLFPNIIRADAEKDLVGLVKYLLNFGFYKFGIEISLIALVSTITYRQDIVAVVYALWLVVLLLLRRSQCAKIWGVFQAFFAISILTQYIVLVGLPPSSCLVFPWDEGPFGEGIQRWAMLPGALHFNHVP-KLIFDFIVLVILNRQKSIFCIEQRYASNDDYPGGSNRSVIADIAQLGRVPFDNPTH-DFCSYIRNYSDILKNGVLCGFYWFTLAVVFLAGTNIADLLALGYLIGAFIFLWQGSDFYLRPIHTIIFRWKWLLAFNVANILIKTSFQMAGCLFMTQL-TKDCCWLVHMLGITCTSNVLTEQIMLPEEAELALKPG-----ECPKITHQVVLLWDTICFAFIIFQLRIFKSHYFCHIITDTKANNILASRGADIIESLRHKQIAHRHDHEKQVLHKIKRKMERIRATQQKMLRPLDKQTHFDEHGYPLPAPTVRRRKEIKLHPHATRAGDYYMF 1403          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Zebrafish
Match: LO018508.1 (pep chromosome:GRCz11:2:54327160:54353625:1 gene:ENSDARG00000112723.1 transcript:ENSDART00000182320.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:LO018508.1)

HSP 1 Score: 380.948 bits (977), Expect = 2.257e-115
Identity = 223/599 (37.23%), Postives = 347/599 (57.93%), Query Frame = 1
Query: 5743 IKFRNPIKQLKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTN-VYLPTIFPRFLTAYKRTLSEANSLHQNQ-NNTYLNISLSMKTDNA----MMWWEVNEIIQGQSYCPNPDSPAKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQH 7518
            ++F  PI+Q   F+  + + + +   DVY +MFL +    +II+ G+++FG     G      +  ++ P PF+ M++ QF  +++DRAL+LRK V GK +FQ+  V  IH W+FF LP IT+R+F+     QL YF+KC+YF LS+YQ+R GYP RILGNFLT++YNY NL  F+ +  IPFL ELR VMDW+WTD++++   W+ VEDI++ IF+LKCWR  E  +P  RG+ ++ VVKY +G +I++     +W PL+  S +  +  V   P+E S S+ +G   P+F  S+++N+++ +T                   +L+S+ P+D T   ++ +S+++W I+PP  + LK  L+  R    +      +R  +     E        ++    +      L +   NS+  V +  IFPR++    R  S++N+   +Q  N Y++I+L +   N+      WW VN+   G    P P         L I+I ++++S    G + + YGI+G+Y +   V+ +F+R F+S IS+ I  EELPNVDRI KL  +I+LVRE  +L LEE L AKLIFLYRS ETMIKWT+ 
Sbjct:   20 VEFYQPIRQ---FFYNLVHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFGK-HQGGADITSSLSEDQVPGPFLVMVLIQFGTMVVDRALYLRKTVVGKVIFQVILVFGIHFWMFFILPGITERRFSQNTIAQLWYFVKCIYFGLSAYQIRCGYPTRILGNFLTKSYNYANLFLFQGFRLIPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFILKCWRESEKRYPQPRGQKKKKVVKYGMGGMIVMLLICIVWFPLLFMSLVKSVAGVVNKPLEVSVSLTLGGLQPIFTMSAQQNHIKSVTGNAIM--------------FLESYFPEDLTIAHLEGSSNSLWTISPPSKENLKNMLNDTREPFPLTFTWSIQRNLSLGAKAET----AMGKYFIELDDETRKGLTDQLGNSSQRVTIKKIFPRYI----RAPSDSNAKPIDQLYNEYMDITLFLNKKNSSEGVQEWWIVNQTDSG----PLPGLNGSG---LQIYIISDQVSPPSLGFL-AGYGIMGLYMSVVLVIGKFVREFFSGISHTIMFEELPNVDRILKLCTDIFLVRETGELDLEEDLYAKLIFLYRSPETMIKWTRE 584          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Zebrafish
Match: piezo2a.2 (piezo-type mechanosensitive ion channel component 2a, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-131119-76])

HSP 1 Score: 381.719 bits (979), Expect = 1.675e-112
Identity = 216/604 (35.76%), Postives = 357/604 (59.11%), Query Frame = 1
Query: 5728 AMRTGIKFRNPIKQLKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQ-NQNNTYLNISLSMK-----TDNAMMWWEVNEIIQGQSYCPNPDSPAKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQH 7518
             ++T +    PI+Q   F+  + + + +   DVY +MFL +    +II+ G+++FG  + +       +  ++ P  F+ M++ QF  +++DRAL+LRK V GK +FQ+  V  IH W+FF LP +T+R+F+     QL YF+KC+YF LS+YQ+R GYP R+LGNFLT++YNY NL  F+ +  +PFL ELR VMDW+WTD++++   W+ VEDI++ IFVLKCWR  E  +P  RG+ ++ VVKY +G +I++     +W PL+  S +  +  V   P++ S +I +G + P+F  S+++N ++ LT+  F+     + +   +  +L+++  +D T   ++ +S+++W I+PP  K L + LS       + M    +R  +    +E  +      +L    +  L+ L+N   N T V +  +FP F+ A   + S A  + Q  ++  Y +I L ++     +++   WW V+E+   Q          ++   L +++F++++S    G + + YGI+G+YA+   V+ +F+R F+S IS+ I  EELP VDRI KL  +I+LVRE  +L LEE L AKLIFLYRS ETMIKWT+ 
Sbjct:  261 TVKTVLDVYIPIRQ---FFYSLIHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHS-AAADITSSLSEDQVPEAFLVMVLIQFGTMVVDRALYLRKTVMGKVIFQVILVFGIHFWMFFILPGVTERRFSQNTVAQLWYFVKCIYFGLSAYQIRCGYPTRVLGNFLTKSYNYLNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFVLKCWRESEKRYPQPRGQKKKKVVKYGMGGMIVMLLICIVWFPLLFMSLVKSVAGVVNKPLDVSVTITLGGFQPIFTMSAQQNQLKELTESDFKNFINSYNYVPSAMQFLEAYRAEDVTVAELEGSSNSLWTISPPSRKNLMDVLS-KEDQFPVTMTWSIQRNLSLGAKSEFAMD-KHVTYLDIKTRQELIALLNGTRN-TPVLIEQVFPCFIRA--PSDSNAKPIEQLYEDGVYKSIQLDLERSANSSEDLQEWWIVDELRSAQK--------QQREAGLQLYVFSDKVSPPSLGFL-AGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPCVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTRE 846          

HSP 2 Score: 116.701 bits (291), Expect = 1.666e-25
Identity = 61/149 (40.94%), Postives = 86/149 (57.72%), Query Frame = 1
Query: 5206 NKQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLPVPEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLWRDH 5652
             + + F RS+ +   L  S   V + +S+  CY ++I+NH++S ++ +L  P L+F W MLSVPRPSK FW+  I YTE+ IV KY  QF     N   +   +  P   P I+G+EK   Y   D++QLL LF HRS LK  GLW + 
Sbjct:    8 EQSERFYRSQPQLLQLCYSLYNVLVSHSQMVCYLVIILNHMISASVATLVLPVLIFLWAMLSVPRPSKRFWMTAIVYTEVTIVIKYFFQFGFFPFN-QSIEVDKSKPFHPPNIIGVEKKEGYVHYDLVQLLALFFHRSILKCYGLWDEE 155          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Zebrafish
Match: piezo1 (piezo-type mechanosensitive ion channel component 1 [Source:ZFIN;Acc:ZDB-GENE-041111-255])

HSP 1 Score: 392.119 bits (1006), Expect = 4.331e-109
Identity = 323/1208 (26.74%), Postives = 570/1208 (47.19%), Query Frame = 1
Query:  928 TFWACGNNVMTSNFARMRLFLLLYSAAHVCLIFIVQLEFMQLYIPTGQRLSRLLGLY-LMFDTNCKNRGEIIFNNQRSID-YVSPFIILYVYYLSAI------------ETRIWLEERKRINKERPAVDKETFIHT-ESYLSGEEINQEESQRISNSFNVEIGSNVSDGPYIDFTDVPHVLDAQNSRSTLFIEEDITKDMEKNQVKERPLLLSIINTMISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNL-PELPTIFRISSSEMQSSEIGLHKSLIPTGPLAAMMSFLVVFWLTLRLFMTDEKINKSKIC--------NEKISTQQKLEHYFGNVDNATYEKFVKCLKEKCENYWIFSCCFAMLFVSVNGSIVLFRIXXXXXXXXXXXXXXXSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIIQVRYFHSRFLELTSMKQTQVCVESERERVK---------SSKDEMDKNKFSVKNTVEFIRDVNNMVFTATEKLKSLYTLTQPSIWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVM--VTALFVCSASIVILKMIYQIKIFQTFNWLTNCS---------QYGNFANSSM--EIIDNAKWLGLEKLENFQLHILKWTAILVGCAVWHIVRYHQMQFYKLNLDQKPKTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNV--LWLPYMIFLGILLPVQYVICVGLPPGLCIEYP------LNVIPKLRQWLYLPNYKVSPVPGKILADFVQYIFVVLQYQVFQMEKRKK---SDSHKLVKQRLLEGFQKSIHKDFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCINPMSWEIRGIHGKNA--DKQCSSVA--SGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLXXXXXXXXXXXXXXXXLNRIERKIKKIEQRQAQHGKPELN---------------------------EHYLVMRSGDYYLF 4287
            T+WAC   +    F  + + +  ++  H+  +++ Q  F Q         +RL GL  L+   NC    E+  N Q     YV+P I+L +Y    I            E R+W E R++ +++     K+T + T +S LS   I +E                    P I+ +                 + DI    E     + PL L +   ++  S+I   +AMM WS+ Y SW +F+ LL SC +W++   +    Y SP I+ Y   L  +QY++  +L  ELP    I S  M   ++GL ++  P   L A++ F + FWL LR  + D    K  +          E     + +   FG +  + Y K           YWI+ C    + VS  G +V ++IVYM+L +  + ++ + YS WRR +K FWW V+ Y +  L++IY FQF+       N TG +E+ L D+GL+ F+ S+L  S+ IP  FL+  I+Q+ YFH  F+++T ++        E E  +         S  DE+  +K+ +         V + +   + K     T  Q  IWR+ E H  K +   +V+V +++  AMN++L+++     P+ R   +   ++ ++VC   I++ KM+YQ+ +     +  NC+         +     NS++    +D A W G+ K +    ++     +L+       V  HQ+  Y+      P   VIF +    +  +     +KY LN+ F K GLE+ F+ TV V   R++ + ++     L+ ++++R   N+  +W  Y +FL + +  QYV+CVG+PP LCI+YP      + +   L +W+YLP++   P    +++DF+  +    Q+ VF  EK+++              +E    +   +FI+ +S Y+D  K +VF + +W  L+++F+TG   I++FGLGYL+  F +L  G  +L    ++ +   + ++ YN  VI++K I  ++ CVF+  ++ K  CW++ LF++ C       ++G +   +  +K CS     +G+ WD +CFFF++LQR +F +  FL V  DL    + +SRG  L    I+K++   +++E K + +++  +K+I  +Q ++    +                            +H  V+ SG+YY+F
Sbjct:  235 TWWACHFPISHLGFNALCVMVAFFTGGHLVCLYLYQSSFAQAMFSPAGLWARLFGLKDLVTPGNCTTF-EVTLNTQYDWPVYVNPGILLLLYISVTIVLKINSNTGEEVELRLW-EARRQSSEDD---TKQTLLTTVDSTLSESHITKE--------------------PVINGSS----------------QHDIGPSGEAT--VDNPLRL-VGRMVLQQSYICALIAMMVWSITYHSWLTFVLLLWSCVIWMLRTRQRFAAYCSPFILLYGLALCCLQYVWAMDLETELPQ--HIGS--MSLHQLGLDRAQYPCLRLGALLLFTLTFWLLLRQSVKDTFSRKKSLTVPLQEVTTGESTGRNESILKVFGGLVMSLYAK-----------YWIYVCGGMFIMVSFAGKLVAYKIVYMLLFLLCMCLYQVYYSLWRRLLKAFWWMVVAYTMVVLIAIYTFQFEDFPGYWGNFTGFTEQQLADMGLETFKLSELFTSIVIPGFFLLACILQLHYFHKPFMKITDLENVSPIHRHEPEEEELIVDQDDYPSEADEVIPSKWGL---------VMDRLMVLSRKFSDTLTHVQSFIWRVLELHIVKIVAFFVVWVALLEPSAMNLVLVVLWSFAMPYGRFRAMASCLSTIWVCV--IIVCKMLYQLSVVNPAEYSNNCTAPMVNETSLEPDEVLNSTLYRASVDPASWFGVRKDDTVLGYVKDHLLVLMLLVFEATVYRHQIHHYRQQQRSPPPIPVIFPQATRDTLDQGLLHCIKYMLNYSFYKFGLEICFLMTVNVIGQRMN-FLVIIHGCWLVAIMVRRRRANIATIWSKYCLFLVVFMIYQYVLCVGIPPALCIDYPWRWRSTVTIHSALVKWMYLPDFYTVPNSKNLISDFLLLMCASQQWTVFDNEKKEEWMVMGGENRDNPDPMENMLFNPAPNFINCRS-YLDMAKILVFRYMFWFVLSVVFVTGATRISVFGLGYLMACFFFLLFGTKLLTKPSRTRLVMWDCLIIYNVAVIISKNILSILACVFVMEMQ-KNFCWVIQLFSLVCT------VKGYYDPESVCNKDCSLPVEEAGIIWDSICFFFLLLQRRVFLSFYFLHVSADLQASARQASRGFELFRASIIKNMHFHQQAERKSIQQLKESMKRIRGKQQKYKDGRITSDIEEQPSEQKKETKLSKSKSWQYPWVDHATVLHSGEYYMF 1363          

HSP 2 Score: 343.969 bits (881), Expect = 3.123e-94
Identity = 209/600 (34.83%), Postives = 345/600 (57.50%), Query Frame = 1
Query: 5752 RNPIKQLKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIV-RFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQ---NQNNTYLNISLSM------KTDNAMMWWEVNEIIQGQSYCPNPDSPAKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQH 7518
            +N  +    F+  + + +     DVYA+MFL +    +III G+++FG  + +   A   +  ++ P  F+ M++ QF  +IIDRAL+LRK + GK +FQ+  V  IH W+FF LP +T+R FN     QL YF KC+YF LS+YQ+R GYP RILGNFLT+ +N+ NL  F+ +  +PFL ELR VMDW+WTD++++  +WM VEDI++ IF++KC R  E  +P  +G+ ++ +VKY +G LI++F    IW PL+  S +  +  V   P++ + ++ +G Y PLF  S ++ +++P T+  + ++      +  +  ++  +  +D     I+ +S +VW I+PP  ++L ++L      + + +    +R      + E    + + S    NP +A+L  L+        V++P +FP ++ A   + +EA  + Q        + ++++S+       T  A  WW+++ I   +  C            L + IFN+++S    G + + YGI+G+Y +   V+ +F+R F+S IS+ I  EELP  DRI KL  +I+LVRE  +L LEE+L +KLIFLYRS ETMIKWT+ 
Sbjct: 1849 KNVYRPTWDFFQNILHAEYRASTDVYALMFLTDVVDFIIIIFGFWAFGKHSAAADIASS-LSEDQVPEAFLVMLLIQFSTMIIDRALYLRKSILGKLIFQVILVFGIHLWMFFILPAVTERMFNHNSVAQLWYFFKCIYFTLSAYQIRCGYPTRILGNFLTKKFNHLNLFLFQGFRLVPFLVELRAVMDWVWTDTTLSLSNWMCVEDIYANIFIIKCSRETEKKYPQPKGQKKKRIVKYGMGGLIILFLICIIWFPLLFISLVKSVVGVVNHPVDVTVTVKLGGYEPLFTMSVQQQSIQPFTESRYNQLNNQFSKNAVAMQFITMYSYEDIVTANIEGSSGSVWRISPPSRQELIKELLSSTGDMTLRLDWNFQRDLGKGGTVENTFDKHSISLAPKNPVRADLASLL-LGTRKDPVHVPHMFPNYIRA--PSGAEAKPVMQLFDGDEEGFQDVTVSLMREASVNTTGAQEWWDIS-IADCKESCN----------VLPMIIFNDKVSPPSLGFL-AGYGIMGLYVSVVLVIGKFVRGFFSEISHSIMFEELPCADRILKLCMDIFLVRETGELELEEELYSKLIFLYRSPETMIKWTRE 2432          

HSP 3 Score: 122.094 bits (305), Expect = 7.345e-27
Identity = 65/160 (40.62%), Postives = 94/160 (58.75%), Query Frame = 1
Query: 5221 FRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNV---LPVPEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLWRDHSEFYKDIKISNEE 5691
            F  S+++   LL +   V   +SE  CYF++++N+L++ +++SL  P LVF W MLSVPRPSK FW+  I YTE+++V KY+ QF     N    L + E +  P   P ILG+EK+  Y   D++QLL LF HRS L+  GLW       +   +S  E
Sbjct: 1604 FYSSQNRLLKLLFALYNVLAAHSELVCYFIIVLNNLVTASVISLVLPVLVFLWAMLSVPRPSKRFWMTAIIYTEVMVVVKYLFQFGFFPWNTEYELKLNEDK--PFFPPRILGLEKTDNYIRYDLLQLLVLFFHRSLLQRYGLWDQEGPLEEKSDLSPAE 1761          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Zebrafish
Match: piezo2a.2 (piezo-type mechanosensitive ion channel component 2a, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-131119-76])

HSP 1 Score: 380.178 bits (975), Expect = 2.485e-105
Identity = 216/604 (35.76%), Postives = 357/604 (59.11%), Query Frame = 1
Query: 5728 AMRTGIKFRNPIKQLKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQ-NQNNTYLNISLSMK-----TDNAMMWWEVNEIIQGQSYCPNPDSPAKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQH 7518
             ++T +    PI+Q   F+  + + + +   DVY +MFL +    +II+ G+++FG  + +       +  ++ P  F+ M++ QF  +++DRAL+LRK V GK +FQ+  V  IH W+FF LP +T+R+F+     QL YF+KC+YF LS+YQ+R GYP R+LGNFLT++YNY NL  F+ +  +PFL ELR VMDW+WTD++++   W+ VEDI++ IFVLKCWR  E  +P  RG+ ++ VVKY +G +I++     +W PL+  S +  +  V   P++ S +I +G + P+F  S+++N ++ LT+  F+     + +   +  +L+++  +D T   ++ +S+++W I+PP  K L + LS       + M    +R  +    +E  +      +L    +  L+ L+N   N T V +  +FP F+ A   + S A  + Q  ++  Y +I L ++     +++   WW V+E+   Q          ++   L +++F++++S    G + + YGI+G+YA+   V+ +F+R F+S IS+ I  EELP VDRI KL  +I+LVRE  +L LEE L AKLIFLYRS ETMIKWT+ 
Sbjct: 2034 TVKTVLDVYIPIRQ---FFYSLIHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHS-AAADITSSLSEDQVPEAFLVMVLIQFGTMVVDRALYLRKTVMGKVIFQVILVFGIHFWMFFILPGVTERRFSQNTVAQLWYFVKCIYFGLSAYQIRCGYPTRVLGNFLTKSYNYLNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFVLKCWRESEKRYPQPRGQKKKKVVKYGMGGMIVMLLICIVWFPLLFMSLVKSVAGVVNKPLDVSVTITLGGFQPIFTMSAQQNQLKELTESDFKNFINSYNYVPSAMQFLEAYRAEDVTVAELEGSSNSLWTISPPSRKNLMDVLS-KEDQFPVTMTWSIQRNLSLGAKSEFAMD-KHVTYLDIKTRQELIALLNGTRN-TPVLIEQVFPCFIRA--PSDSNAKPIEQLYEDGVYKSIQLDLERSANSSEDLQEWWIVDELRSAQK--------QQREAGLQLYVFSDKVSPPSLGFL-AGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPCVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTRE 2619          

HSP 2 Score: 212.231 bits (539), Expect = 3.550e-54
Identity = 166/588 (28.23%), Postives = 288/588 (48.98%), Query Frame = 1
Query: 2605 IWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSASIVILKMIYQIKIFQTFNWLTNCSQYGNFANSS-MEI---------IDNAKWLGLEKLENFQLHILKWTAILVGCAVWHIVRYHQMQFYKL-NLDQKPKTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNV-LWLPYMIFLGILLPVQYVICVGLPPGLCIEYPL---------NVIPKLRQWLYLPNYKVSPVPGKILADFVQYIFVVLQYQVFQME-----KRKKSDSHKLVKQRLLEGF-QKSIHKDFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCINPMSWEIRGIHG--KNADKQCS--SVASGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLXXXXXXXXXXXXXXXXLNRIERKIKKIEQRQAQHGKPELNEHYLVMRSGD 4275
            IW + E H  K +   I++V + +V   N + ++      PF +   +  +   V +  I++ KM+YQ+       +  NCS   N+  +  M++         +D A W+GL K     L  L+   +++    + +  Y    FY++ N    P T  IF  +      +   +  KY +N+ F K GLE  F+  V V   R+D +++++   L+  +  +R      +W  Y  FL  LL  QY++C+G+PP  C +YP          NVI    +WLY P++   P    +L DF+  +   LQ +VF+ E     +    D+ ++ +      F Q +   DFI  +S Y+D LK +VF + +W  L IIFITG   I++F +GYL+  F +L  G  +L+   KS++   + ++ YN  VI  K I  +  C ++  L     CW++ LF++ C       I+G     + A+KQC   S  +G+ WD +CF F++LQR +F +  FL V  D+      +SRGA L    I+K+++ + + E+K ++ ++R++ +I+ RQ +  + +     L   SG+
Sbjct:  811 IWWILELHIIKIVSSYIIWVSVKEVSLFNYVFVVSWAFALPFCQFRPLASSVCTVWTCIIIVCKMLYQLTSISPAAYARNCSMPDNYTEAQRMDMAKSLLYIGPVDPANWIGLRKFSPL-LEYLRNNLLMLALLAFEVTIYRHQDFYRMKNNITPPVTRTIFHNITRQHLDDGIVNCAKYFINYFFYKFGLETCFLLAVNVIGQRMDFFAMLHAFGLIAVMYQRRRKAIAHVWSKYCCFLACLLSFQYLMCIGIPPAACTDYPWRRSSSSMDSNVI----KWLYFPDFHTKPNSLFLLYDFMLLLCASLQGRVFEEECVSPVQLLAGDNVEICRDLDAATFSQHNPVPDFIHCRS-YLDMLKVMVFSYLFWFVLTIIFITGTTRISIFCMGYLVACFYFLIFGGELLLKPIKSILHYWDFLIAYNVFVITMKNILSIAACGYIKAL-VANHCWLIQLFSLACT------IKGYSKPEQQANKQCELPSDEAGIIWDSICFAFLLLQRRVFMSYYFLHVVADIRSSQLLASRGAELFQATIVKAVKARIEEEKKSMDLLKRQMDRIKSRQQKFKRGKERMLSLAQESGE 1385          

HSP 3 Score: 199.134 bits (505), Expect = 3.594e-50
Identity = 165/578 (28.55%), Postives = 281/578 (48.62%), Query Frame = 1
Query:  850 VITGFAGIISPXXXXXXXXXXXXXXXTFWACGNNVMTSNFARMRLFLLLYSAAHVCLIFIVQLEFMQLYIPTGQRLSRLLGLYLMFDTNCKNRGEIIFNNQRSID---YVSPFIILYVYYLSAIETRIWLEERKRINKERPAVDKETFIHTE------------------SYLSGEEINQEESQRISNSFNVEIGSNVSDGPYIDFTDV----------------PHVLDAQNSRSTLFIEEDITK-DMEKNQVKERPLLLSIINT-------MISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFN-LPELPTIFRISSSEMQSSEIGLHKSLIPTGPLAAMMSFLVVFWLTLRLFMTDEKINKSKICNEKISTQQKLEHYFGNVDNAT-----YEKFVKCLKEKCENYWIFSCCFAMLFVSVNGSIVLFRIXXXXXXXXXXXXXXXSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIIQVRYFHSRFLELTSMK 2430
            V+ G  G++ PSL + VY  ++LG+ T+W+   +     F+ + + + ++SA H+  +++ Q +F Q  +P G   + L G+  +  T+C +    +F    +++   +V+P ++L +YY  A   R+WL+E +   ++  A  K+     E                  ++   +E N   +Q   NS  V I +  S+G  +DFT V                PH    Q    T  ++  + + D    ++ E P+ +  +N+       ++  S+I   +AMMAWS+ Y SW +F+FL+ SC LW++   R   +  SP +V Y  LLI++QYI+ F  L  +P +F               K  +P   L +    L+ FWL LR F+T+ +   +   + ++S      H  G  D A       E     L      YWI+ C     FVS  G IV+++I+YM++ ++ + ++ L Y  WR  +K FW +V+ Y +  L+ +Y FQF+       N+TG+S E L D+GL++F    L   +FIP  FL++ I+ + YFH RFLELT +K
Sbjct:  129 VLLGLTGMMLPSLTSSVYFFTFLGLCTWWSFCRSFDPLLFSCLCVLMAIFSAGHLVFLYLYQFQFFQEAVPPGNTYASLFGISPVVQTDCSHTW--MFKVNPALEWHHFVNPIMLLVLYYTLATLIRLWLQESEDTVRDAEAEGKDDAASPENTDINVYTADQRRQLWRMAHYHTDERNLLTAQEAYNSPEVLIVT--SNGASLDFTSVSHEKRPKCVERNLYSTPHYKADQPESDTQSLDCGVYRIDSAYVELSELPVAVVRVNSVVKVFRFIMKQSYICALIAMMAWSITYVSWLTFVFLIWSCTLWMVRDRRKYSMVTSPFMVFYGNLLIILQYIWSFECLQPVPGLFL--------------KKEVPFRELGSKTLCLLSFWLLLRQFLTERREKHTD--DPQLSDVTVDGHKLGLQDEAAGHREMMEVLGSSLMAMLNKYWIYICGGMFFFVSFEGRIVMYKIIYMMMFLFCVALYQLHYERWRWMLKYFWMSVVVYTMLVLILVYTFQFESSINVWSNMTGMSREKLEDLGLEKFSVPALFTRIFIPTWFLLVCILHLHYFHERFLELTDIK 686          

HSP 4 Score: 117.087 bits (292), Expect = 2.641e-25
Identity = 70/206 (33.98%), Postives = 104/206 (50.49%), Query Frame = 1
Query: 5206 NKQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLPVPEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLWRDHSEFYKDIKISNEEEVNHIQPLKPQSAMRTGIKF--RNPIKQLKKFYGKMTNRKLNKR 5817
             + + F RS+ +   L  S   V + +S+  CY ++I+NH++S ++ +L  P L+F W MLSVPRPSK FW+  I YTE+ IV KY  QF     N   +   +  P   P I+G+EK   Y   D++QLL LF HRS LK  GLW             +EEE   + P     A      F  ++P++         T+ +L ++
Sbjct: 1781 EQSERFYRSQPQLLQLCYSLYNVLVSHSQMVCYLVIILNHMISASVATLVLPVLIFLWAMLSVPRPSKRFWMTAIVYTEVTIVIKYFFQFGFFPFNQ-SIEVDKSKPFHPPNIIGVEKKEGYVHYDLVQLLALFFHRSILKCYGLW-------------DEEEPRSVSPHTHSGAEEKAECFSEKSPVEDTYTHALSHTHLRLARK 1972          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Zebrafish
Match: CU179656.1 (pep chromosome:GRCz11:2:54086436:54270366:1 gene:ENSDARG00000107086.2 transcript:ENSDART00000174581.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CU179656.1)

HSP 1 Score: 317.005 bits (811), Expect = 2.540e-87
Identity = 287/1189 (24.14%), Postives = 532/1189 (44.74%), Query Frame = 1
Query:  850 VITGFAGIISPXXXXXXXXXXXXXXXTFWACGNNVMTSNFARMRLFLLLYSAAHVCLIFIVQLEFMQLYIPTGQRLSRLLGLYLMFDTNCKNRGEI-IFNNQRSIDYVSPFIILYVYYLSAIETRIWLEE-RKRINKERPAVDKETFIHTESYLSGEEINQEESQRI----SNSFNVEIGSNVSDGPY-IDFTDVPHVLDAQNSR------STLFIEEDITKDMEKNQVKERPLLLSIINTMISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNLPELPTIFRISSSEMQSSEIGLHKSLIPTGPLAAMMSFLVVFWLTLRLFMTDEKINK---SKICNEKISTQQKLEHYFGNVD------------NATYEKFVKCLKEKCENYWIFSCCFAMLFVSVNGSIVLFRIXXXXXXXXXXXXXXXSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIIQVRYFHSRFLELTSMKQTQVCVESERERVKSS-----------------------------KDEMDKNKFS------------------------VKNTVEFIRDVNNMVFTATEKLKSLYTL-------TQPSIWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSASIVILKMIYQIKIFQTFNWLTNCSQYGNFANSSMEIIDNAKWLGLEKLENFQLHILKWTAILVGCAVWHIVRYHQMQFYKL-NLDQKPKTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNV-LWLPYMIFLGILLPVQYVICVGLPPGLCIEYPL-----NVIPKLRQWLYLPNYKVSPVPGKILADFVQYIFVVLQYQVFQMEKRKK-----SDSHKLVKQRLLEGFQKSIHK---DFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCINPMSWEIRGIHGKNADKQCSSVASGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRG 4107
            ++ G  G+  PSL + VY   +LG+ T+W+         F+ + + + ++SA H+ +++I Q +F+Q  I      + + G+  +  T+C +  ++ + +  +   +V+P +IL +YY  A   R+WL++    ++     +     +   S L   +  +E +  +      SF+      + +GP  +D    P     Q+              ++  +  E+ Q      L+ +   ++  S+I   +AMMAWS+ Y SW +F+FL+ SC LW++   R   +  SP +V Y   L+++QYI+ F              +++       K  +P   L+  +   + FWL LR  + + +  K   + + + K+  Q+K + +    +            N   +   K +      YWI+ C     FVS  G +  ++I+YM++L+  + ++ + Y +WRR +K FW +V+ Y +  L+ IY  QF+        +TGL +++L+DIGL++F  S+L   +FIP  FL++ I+ + YFH  FLELT +K      ES    V S+                             KDE +K   +                        +++ V  + ++ N      ++L  L+          +  +W L E H  K +   I+ + + +V  +N + ++      P+ +   +  +   V +  I++ K+ YQ+K     N+ ++C                                +    +++    + +  Y   +F++L N    P +  IF ++          +  KY +N+ F K GLE+ F+  + V   R+D YS+V+ L L + +  +R      +W  Y  FL  ++  QY IC+G+PP  C +YP      ++   + +WLYLP++   P    +  DF+  +   LQ QVF  E +        D+ ++ +   L+    S+H    DFI  +S Y+D LK ++F + +W  L IIFITG   I++F +GYL+  F +L  G  +L+   K ++R  + ++ YN  VI  K +F ++ C ++N L  K  CW++ L ++ C       I+    K  D +     +G+ WD +CF F++LQR +F +  FL V  D+      +SR 
Sbjct:  208 IMLGMTGVTLPSLSSAVYFFVFLGLCTWWSLCKTFDKLLFSCLCVLMAIFSAGHLIVLYINQFQFLQEAISPTDGYTSVFGISSIIYTDCSSTWKLAVRSGLKWHHFVNPIMILVLYYTLATLIRLWLQDPMMMVSLYTIDLAFWEILFQISILKTHQKTEERNVLVVTSNGTSFDYVSAVPIENGPVSLDIYSTPQYKVDQSVEYDGELEEEEEKTDEEEEAEEEEQGGPPAALVKVFKFIMKQSYICALIAMMAWSITYVSWLTFVFLIWSCTLWMVRDRRKYAMLTSPFMVAYGNFLLVLQYIWCFE-------------KLKPVSGFFVKMEVPFTELSTKVLCQLSFWLLLRQTLMERQERKEEEAALSDIKVDEQKKGDLFIRVYNRLEEKSEEEVDENDLMQVLGKLVMALLVKYWIYVCGGMFFFVSFEGDMATYKIIYMMMLLSCVALYQVHYEYWRRILKYFWMSVVVYTMLVLILIYTSQFEDGIPTWTRMTGLDKDVLKDIGLEKFSLSNLFTRIFIPTSFLLVCILHLHYFHDHFLELTDLKAVVSKQESTIYSVLSNALFPFSRLAHPDGSLADLTIVSSSPEPLLKDEKEKESLNEVLVVDCVGEEKKKDSLSIYSAQMIESLVVCVSEMKNKWHLVVDRLTVLFLKFLEYFHKLKLFVWWLLEMHIIKIVATYIILLSVKEVSLLNFVFLISWAFALPYKQFRVLSSSVCTVWTCVIIVCKLFYQLKTINPANYSSDC--------------------------------IMNNLLMLALLAFEVTIYRHQEFFRLRNKLSPPPSRTIFHDITRQHLDNGIIECAKYFINYFFYKFGLEVCFLLAINVMGQRMDFYSMVHGLALAVVMFRRRRKAIAEIWPKYCCFLACMITFQYFICIGIPPAACADYPWRFPNSSMTSNVIKWLYLPDFHTPPSSMFLGYDFMLLLCASLQRQVFDEENKAAVRLMAGDNVEICRD--LDAASFSVHNPVPDFIHCRS-YLDMLKVIMFSYLFWFVLTIIFITGTTRISIFCMGYLVACFYFLLFGGQLLLKPIKEILRYWDFLIAYNVFVITMKNVFAILACGYINSL-VKNSCWLIQLLSLAC------TIKDYQPKTVDCELPKDEAGIIWDSICFTFLLLQRRVFMSYYFLHVIADIRAGQILASRA 1341          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Xenopus
Match: PIEZO2 (piezo-type mechanosensitive ion channel component 2 [Source:NCBI gene;Acc:100492729])

HSP 1 Score: 464.537 bits (1194), Expect = 3.542e-132
Identity = 282/820 (34.39%), Postives = 441/820 (53.78%), Query Frame = 1
Query: 5197 EEKNKQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLPVPEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLW-------------------------RDHSEFYKDIKISNEEEVNHIQPLKPQSAMR-----------------TGIKFRNPIKQLKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNA----MMWWEVNEIIQGQSYCPNPDSPAKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQ 7515
            EE    + F  ++ +   L+ +     +  SE  CYF++I+NH++S ++++L  P L+F W MLSVPRPSK FW+  I YTE+ IV KY  QF     N   V   +  P   P I+GIEK   Y   D++QLL LF HRS LK +GLW                         RD     K + ++   E  H+   + ++A+R                 + ++   PI+Q   F+  + + + +   DVY +MFL +    +II+ G+++FG  + +       +  ++ P  F+ M++ QF  +++DRAL+LRK V GK +FQ+  V  IH W+FF LP +T+RKF+     QL YF+KC+YF LS+YQ+R GYP R+LGNFLT++YNY NL  F+ +  +PFL ELR VMDW+WTD++++   W+ VEDI++ IF+LKCWR  E  +P  RG+ ++ VVKY +G +I++     +W PL+  S I  +  V   P++ S +I +G Y P+F  S+++N ++ L    F+ +   +K + P+  +L+S+  +D T   ++  S+++W I+PP    + E+L               + P   +  +  I R   ++     EK                         ++   +T  E   +  NQ   ++NIS+ ++ +N       WW VN   Q        D        L +++F++++S    G + + YGI+G+YA+   V+ +F+R F+S IS+ I  EELPNVDRI KL  +I+LVRE  +L LEE L AKLIFLYRS ETMIKWT+
Sbjct: 1228 EELEDSEKFYTTQPRPLQLIYALYNTLVARSEMVCYFVIILNHMISASMITLVLPILIFLWAMLSVPRPSKRFWMTAIVYTEVTIVIKYFFQFGFFPWNK-NVDYTKDKPYFPPNIMGIEKKEGYVHYDLVQLLALFFHRSILKCHGLWDEDDVTEKATDKDDTDGEISEASGRRDSVGSLKSVNLAASVESVHVHFPEEKTAIRRKSTSSGSQISRRSSYSSILQIYVPIRQ---FFYNLIHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHS-AAADITSSLSEDQVPEAFLVMVLIQFGTMVVDRALYLRKTVMGKVIFQVILVFGIHFWMFFILPGVTERKFSQNTVAQLWYFVKCIYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFILKCWRESEKRYPQPRGQKKKKVVKYGMGGMIIVLLICIVWFPLLFMSLIKSVAGVTNKPLDVSITITLGGYQPIFTMSAQQNQLQGLNDNEFKHLHNIYKGNTPAMQFLESYMQEDITIAGLEGNSNSLWTISPPSRTMMIERL--------------IQEPDFTAVISWSI-RSLGAKAEVTGEKYT-----------------------ISLAGQTRRELADMMNNQE--FVNISVLLRKENTSEGVREWWVVN---QSHKEFIKKDG-------LELWVFSDKVSPPSLGFL-AGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPNVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTR 1991          

HSP 2 Score: 313.538 bits (802), Expect = 4.864e-85
Identity = 256/887 (28.86%), Postives = 428/887 (48.25%), Query Frame = 1
Query: 1570 MMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNL--PELPTIFRISSSEMQSSEIGLHKSLIPTGPLAAMMSFLVVFWLTLRLFMTDEKINKSK-ICNEKISTQQKLEHYFGNVDNATYEKFVKCLKEKCENYWIFSCCFAMLFVSVNGSIVLFRIXXXXXXXXXXXXXXXSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIIQVRYFHSRFLELTSMKQTQVCVESERERVKSSKDEMDKNKFSV----------KNTVEFIRDVNNMVFTATEKLKSLYTLTQPSIWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSASIVILKMIYQIKIFQTFNWLTNC---------SQYGNFANSSM---EIIDNAKWLGLEKLENFQLHILKWTAILVGCAVWHIVRYHQMQFYKL-NLDQKPKTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNV-LWLPYMIFLGILLPVQYVICVGLPPGLCIEYP-----LNVIPKLRQWLYLPNYKVSPVPGKILADFVQYIFVVLQYQVFQMEKRK-----KSDSHKLVKQRLLEGF-QKSIHKDFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGL--CWMVSLFAIQCINPMSWEIRG--IHGKNADKQCSSVASGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSR 4104
            + AWS+ Y SW +F+ L+ SC LW++ + R   + +SP +V Y  LL+ +QYI+   L   ELP +            +GL +   P   L + + F V FWL LR  +T++K  K K +   +I  +  +    G +  A + K           YWI+ C     FVS  G IV+++I+YM+L ++ + ++ + Y +WRR +K FW +V+ Y +  L+ IY +QF+       N+TGL +E L D+GL+ F  +DL   +FIP  FL++ I+ + YFH RFL+LT +K     V   ++   S +D      FS           +N    + D   ++F    K    +   Q  +W L E H  K +   I+++ I +V  +N +  +      P+ +   +  +   V +  I+I KM+YQ+       + +NC         ++     NSS+     +D + W+GL+K     L  L+   +++    + +  Y   ++Y+L N    P T  IF ++      +   +  KY +N+ F K GLE  F+ +V V   R+D +++V+ L L   L  +R       W  Y  FL  ++  QY IC+G+PP  C +YP      N    + +WLY P++ V P P  ++ DF+  +   LQ +VF+ E +        D+ ++        F Q +   DFI  + SY+D  K ++F + +W  L IIFITG   I++F +GYL+  F +L  G  +L+   + ++R  + ++ YN  VI  K           N+L    L  CW++  F++ C       ++G  I     D Q  S  +G+ WD +CF F++LQR +F +  FL V  D+      +SR
Sbjct:  231 LQAWSITYHSWLTFVLLIWSCALWMVRNRRKYAMLSSPFMVMYGNLLLTLQYIWSIALQSDELPEV------------MGLLERKKPE-ELVSKIIFTVTFWLLLRQHLTEQKALKQKELALSEIKDENDIMKVLGKLVQAMFVK-----------YWIYVCGGMFFFVSFEGKIVMYKIIYMMLFLFCVALYQVHYEWWRRILKYFWMSVVVYTMLVLVFIYTYQFKSFPGLWMNMTGLDKEKLADLGLETFNLTDLFTRIFIPTSFLLVCILHLHYFHDRFLQLTDLK----AVTRMQQIQDSVRDSAKIQHFSAGFGQIHGLESRNKWHLVIDRLTVLFL---KFLEYFHKFQVFVWWLLELHMIKIVSSYIIWLTIKEVSLLNYVFFIAWAFALPYSQFRPLASSVCTVWTCVIIICKMLYQLASIDPATFSSNCLMPQLNETTARNQTELNSSVLYNSSVDPSNWVGLKKSTPL-LAYLRNNLLMLAMLAFEVTIYRHQEYYRLRNNLTTPATKTIFHDITRLHLDDGLINSAKYFVNYFFYKFGLETCFLLSVNVIGQRMDFFAMVHALWLFGVLYRRRRKAIAETWHRYCCFLACIMAFQYFICIGIPPAACKDYPWRQPGANFNSNIIKWLYFPDFIVRPSPLFLVYDFLLLLCASLQREVFEEENKAAVRIMAGDNVEICMNLDAASFSQHNPVPDFIYCR-SYLDMGKVIMFSYLFWFVLTIIFITGTTRISIFCMGYLVACFYFLLFGGDLLLKPIRIILRYWDWLIAYNVFVITMK-----------NVLSVSVLFHCWLIQAFSLSC------TVKGYFIPQNTPDCQLPSGEAGIIWDSICFAFLLLQRRVFMSYYFLHVVADIKSSQILASR 1067          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Xenopus
Match: PIEZO2 (piezo-type mechanosensitive ion channel component 2 [Source:NCBI gene;Acc:100492729])

HSP 1 Score: 464.922 bits (1195), Expect = 4.504e-132
Identity = 282/821 (34.35%), Postives = 441/821 (53.71%), Query Frame = 1
Query: 5197 EEKNKQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLPVPEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLW-------------------------RDHSEFYKDIKISNEEEVNHIQPLKPQSAMR-----------------TGIKFRNPIKQLKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNA----MMWWEVNEIIQGQSYCPNPDSPAKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQH 7518
            EE    + F  ++ +   L+ +     +  SE  CYF++I+NH++S ++++L  P L+F W MLSVPRPSK FW+  I YTE+ IV KY  QF     N   V   +  P   P I+GIEK   Y   D++QLL LF HRS LK +GLW                         RD     K + ++   E  H+   + ++A+R                 + ++   PI+Q   F+  + + + +   DVY +MFL +    +II+ G+++FG  + +       +  ++ P  F+ M++ QF  +++DRAL+LRK V GK +FQ+  V  IH W+FF LP +T+RKF+     QL YF+KC+YF LS+YQ+R GYP R+LGNFLT++YNY NL  F+ +  +PFL ELR VMDW+WTD++++   W+ VEDI++ IF+LKCWR  E  +P  RG+ ++ VVKY +G +I++     +W PL+  S I  +  V   P++ S +I +G Y P+F  S+++N ++ L    F+ +   +K + P+  +L+S+  +D T   ++  S+++W I+PP    + E+L               + P   +  +  I R   ++     EK                         ++   +T  E   +  NQ   ++NIS+ ++ +N       WW VN   Q        D        L +++F++++S    G + + YGI+G+YA+   V+ +F+R F+S IS+ I  EELPNVDRI KL  +I+LVRE  +L LEE L AKLIFLYRS ETMIKWT+ 
Sbjct: 1302 EELEDSEKFYTTQPRPLQLIYALYNTLVARSEMVCYFVIILNHMISASMITLVLPILIFLWAMLSVPRPSKRFWMTAIVYTEVTIVIKYFFQFGFFPWNK-NVDYTKDKPYFPPNIMGIEKKEGYVHYDLVQLLALFFHRSILKCHGLWDEDDVTEKATDKDDTDGEISEASGRRDSVGSLKSVNLAASVESVHVHFPEEKTAIRRKSTSSGSQISRRSSYSSILQIYVPIRQ---FFYNLIHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHS-AAADITSSLSEDQVPEAFLVMVLIQFGTMVVDRALYLRKTVMGKVIFQVILVFGIHFWMFFILPGVTERKFSQNTVAQLWYFVKCIYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFILKCWRESEKRYPQPRGQKKKKVVKYGMGGMIIVLLICIVWFPLLFMSLIKSVAGVTNKPLDVSITITLGGYQPIFTMSAQQNQLQGLNDNEFKHLHNIYKGNTPAMQFLESYMQEDITIAGLEGNSNSLWTISPPSRTMMIERL--------------IQEPDFTAVISWSI-RSLGAKAEVTGEKYT-----------------------ISLAGQTRRELADMMNNQE--FVNISVLLRKENTSEGVREWWVVN---QSHKEFIKKDG-------LELWVFSDKVSPPSLGFL-AGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPNVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTRE 2066          

HSP 2 Score: 315.464 bits (807), Expect = 1.561e-85
Identity = 255/880 (28.98%), Postives = 432/880 (49.09%), Query Frame = 1
Query: 1570 MMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNL--PELPTIFRISSSEMQSSEIGLHKSLIPTGPLAAMMSFLVVFWLTLRLFMTDEKINKSK---ICNEKISTQQK-LEHYFGNVDNATYEKFVKCLKEKCENYWIFSCCFAMLFVSVNGSIVLFRIXXXXXXXXXXXXXXXSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIIQVRYFHSRFLELTSMKQTQVCVESERERVKSSKDEMDKNKFSVKNTVEFIRDVNNMVFTATEKLKSLYTLTQPSIWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSASIVILKMIYQIKIFQTFNWLTNC---------SQYGNFANSSM---EIIDNAKWLGLEKLENFQLHILKWTAILVGCAVWHIVRYHQMQFYKL-NLDQKPKTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNV-LWLPYMIFLGILLPVQYVICVGLPPGLCIEYP-----LNVIPKLRQWLYLPNYKVSPVPGKILADFVQYIFVVLQYQVFQMEKRK-----KSDSHKLVKQRLLEGF-QKSIHKDFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGL--CWMVSLFAIQCINPMSWEIRG--IHGKNADKQCSSVASGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSR 4104
            + AWS+ Y SW +F+ L+ SC LW++ + R   + +SP +V Y  LL+ +QYI+   L   ELP +            +GL +   P   L + + F V FWL LR  +T++K  K K   +   K+ ++ K +E      +N   +   K ++     YWI+ C     FVS  G IV+++I+YM+L ++ + ++ + Y +WRR +K FW +V+ Y +  L+ IY +QF+       N+TGL +E L D+GL+ F  +DL   +FIP  FL++ I+ + YFH RFL+LT +K     V S+++          K + + +N    + D   ++F    K    +   Q  +W L E H  K +   I+++ I +V  +N +  +      P+ +   +  +   V +  I+I KM+YQ+       + +NC         ++     NSS+     +D + W+GL+K     L  L+   +++    + +  Y   ++Y+L N    P T  IF ++      +   +  KY +N+ F K GLE  F+ +V V   R+D +++V+ L L   L  +R       W  Y  FL  ++  QY IC+G+PP  C +YP      N    + +WLY P++ V P P  ++ DF+  +   LQ +VF+ E +        D+ ++        F Q +   DFI  + SY+D  K ++F + +W  L IIFITG   I++F +GYL+  F +L  G  +L+   + ++R  + ++ YN  VI  K           N+L    L  CW++  F++ C       ++G  I     D Q  S  +G+ WD +CF F++LQR +F +  FL V  D+      +SR
Sbjct:  245 LQAWSITYHSWLTFVLLIWSCALWMVRNRRKYAMLSSPFMVMYGNLLLTLQYIWSIALQSDELPEV------------MGLLERKKPE-ELVSKIIFTVTFWLLLRQHLTEQKALKQKELALSEIKVGSEDKEVED-----ENDIMKVLGKLVQAMFVKYWIYVCGGMFFFVSFEGKIVMYKIIYMMLFLFCVALYQVHYEWWRRILKYFWMSVVVYTMLVLVFIYTYQFKSFPGLWMNMTGLDKEKLADLGLETFNLTDLFTRIFIPTSFLLVCILHLHYFHDRFLQLTDLK----AVTSKQDIPPLDHQFKTKYRSAPQNKWHLVIDRLTVLFL---KFLEYFHKFQVFVWWLLELHMIKIVSSYIIWLTIKEVSLLNYVFFIAWAFALPYSQFRPLASSVCTVWTCVIIICKMLYQLASIDPATFSSNCLMPQLNETTARNQTELNSSVLYNSSVDPSNWVGLKKSTPL-LAYLRNNLLMLAMLAFEVTIYRHQEYYRLRNNLTTPATKTIFHDITRLHLDDGLINSAKYFVNYFFYKFGLETCFLLSVNVIGQRMDFFAMVHALWLFGVLYRRRRKAIAETWHRYCCFLACIMAFQYFICIGIPPAACKDYPWRQPGANFNSNIIKWLYFPDFIVRPSPLFLVYDFLLLLCASLQREVFEEENKAAVRIMAGDNVEICMNLDAASFSQHNPVPDFIYCR-SYLDMGKVIMFSYLFWFVLTIIFITGTTRISIFCMGYLVACFYFLLFGGDLLLKPIRIILRYWDWLIAYNVFVITMK-----------NVLSVSVLFHCWLIQAFSLSC------TVKGYFIPQNTPDCQLPSGEAGIIWDSICFAFLLLQRRVFMSYYFLHVVADIKSSQILASR 1080          

HSP 3 Score: 59.6918 bits (143), Expect = 1.039e-7
Identity = 39/130 (30.00%), Postives = 70/130 (53.85%), Query Frame = 1
Query:  850 VITGFAGIISPXXXXXXXXXXXXXXXTFWACGNNVMTSNFARMRLFLLLYSAAHVCLIFIVQLEFMQLYIPTGQRLSRLLGLYLMFDTNCKNRGEIIFNNQRSID-YVSPFIILYVYYLSAIETRIWLEE 1236
            ++ G  G++ PSL + VY   +LG+ T+W+C        F+ + + + ++SA H+  +++ QL+F    IP     +RL G+  +  T+C N      NN    + Y +P ++L +YY  A   R+WL+E
Sbjct:   53 ILLGLTGMMLPSLTSAVYFFVFLGLCTWWSCCRVFDPLIFSCLCVLMAIFSAGHLIGLYLYQLQFFHEIIPPNDFYARLFGVTSLVQTDCCNTWRFFANNSLPWNQYTNPVMLLVLYYTLATLIRLWLQE 182          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Xenopus
Match: PIEZO2 (piezo-type mechanosensitive ion channel component 2 [Source:NCBI gene;Acc:100492729])

HSP 1 Score: 462.611 bits (1189), Expect = 9.662e-132
Identity = 284/801 (35.46%), Postives = 444/801 (55.43%), Query Frame = 1
Query: 5167 DGRKSVSEDKEEKNKQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLPVPEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLW--RDHSEFYKDIKISNEEEVN------------HIQPLKPQSAMRTGIKFRNPIKQLKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLH--QNQNNTYLNISLSMKTDNAMMWWEVNEIIQGQSYCPNPDSPAKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQH 7518
            D    +S D++ ++ +  F  ++ +   L+ +     +  SE  CYF++I+NH++S ++++L  P L+F W MLSVPRPSK FW+  I YTE+ IV KY  QF     N   V   +  P   P I+GIEK   Y   D++QLL LF HRS LK +GLW   D +E   D K   + E++            +I    P   ++  +    PI+Q   F+  + + + +   DVY +MFL +    +II+ G+++FG  + +       +  ++ P  F+ M++ QF  +++DRAL+LRK V GK +FQ+  V  IH W+FF LP +T+RKF+     QL YF+KC+YF LS+YQ+R GYP R+LGNFLT++YNY NL  F+ +  +PFL ELR VMDW+WTD++++   W+ VEDI++ IF+LKCWR  E  +P  RG+ ++ VVKY +G +I++     +W PL+  S I  +  V   P++ S +I +G Y P+F  S+++N ++ L    F+ +   +K + P+  +L+S+  +D T   ++  S+++W I+PP    + E+L               + P   +  +  I R+  S    N         +   F+   ++   I+P  L A    ++    LH    + NT         ++    WW VN   Q        D        L +++F++++S    G + + YGI+G+YA+   V+ +F+R F+S IS+ I  EELPNVDRI KL  +I+LVRE  +L LEE L AKLIFLYRS ETMIKWT+ 
Sbjct: 1187 DNLMVLSPDEKLEDSEK-FYTTQPRPLQLIYALYNTLVARSEMVCYFVIILNHMISASMITLVLPILIFLWAMLSVPRPSKRFWMTAIVYTEVTIVIKYFFQFGFFPWNK-NVDYTKDKPYFPPNIMGIEKKEGYVHYDLVQLLALFFHRSILKCHGLWDEDDVTEKATD-KDDTDGEISEASGRRDSFFILYILCFFPSRILQIYV----PIRQ---FFYNLIHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHS-AAADITSSLSEDQVPEAFLVMVLIQFGTMVVDRALYLRKTVMGKVIFQVILVFGIHFWMFFILPGVTERKFSQNTVAQLWYFVKCIYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFILKCWRESEKRYPQPRGQKKKKVVKYGMGGMIIVLLICIVWFPLLFMSLIKSVAGVTNKPLDVSITITLGGYQPIFTMSAQQNQLQGLNDNEFKHLHNIYKGNTPAMQFLESYMQEDITIAGLEGNSNSLWTISPPSRTMMIERL--------------IQEPDFTAVISWSIRRYIISSLFYN---------LPNSFSYRPIF--HIYPLCLKA-PSDVTAKPILHVLLRKENT---------SEGVREWWVVN---QSHKEFIKKDG-------LELWVFSDKVSPPSLGFL-AGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPNVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTRE 1930          

HSP 2 Score: 329.331 bits (843), Expect = 5.965e-90
Identity = 258/890 (28.99%), Postives = 438/890 (49.21%), Query Frame = 1
Query: 1534 MISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNL--PELPTIFRISSS-EMQSSEIGLHKSLIPTGPLAAMMSFLVVFWLTLRLFMTDEKINKSK---ICNEKISTQQKLEHYFGNVDNATYEKFVKCLKEKCENYWIFSCCFAMLFVSVNGSIVLFRIXXXXXXXXXXXXXXXSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIIQVRYFHSRFLELTSMKQTQVCVESERERVKSSKDEMDKNKFSVKNTVEFIRDVNNMVFTATEKLKSLYTLTQPSIWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSASIVILKMIYQIKIFQTFNWLTNC---------SQYGNFANSSM---EIIDNAKWLGLEKLENFQLHILKWTAILVGCAVWHIVRYHQMQFYKL-NLDQKPKTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNV-LWLPYMIFLGILLPVQYVICVGLPPGLCIEYP-----LNVIPKLRQWLYLPNYKVSPVPGKILADFVQYIFVVLQYQVFQMEKRK-----KSDSHKLVKQRLLEGF-QKSIHKDFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCINPMSWEIRG--IHGKNADKQCSSVASGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSR 4104
            ++  S+I   ++MMAWS+ Y SW +F+ L+ SC LW++ + R   + +SP +V Y  LL+ +QYI+   L   ELP +    S+ +M  + I L   +I          F V FWL LR  +T++K  K K   +   K+  +          +N   +   K ++     YWI+ C     FVS  G IV+++I+YM+L ++ + ++ + Y +WRR +K FW +V+ Y +  L+ IY +QF+       N+TGL +E L D+GL+ F  +DL   +FIP  FL++ I+ + YFH RFL+LT +K             + SK+   +NK+        + D   ++F    K    +   Q  +W L E H  K +   I+++ I +V  +N +  +      P+ +   +  +   V +  I+I KM+YQ+       + +NC         ++     NSS+     +D + W+GL+K     L  L+   +++    + +  Y   ++Y+L N    P T  IF ++      +   +  KY +N+ F K GLE  F+ +V V   R+D +++V+ L L   L  +R       W  Y  FL  ++  QY IC+G+PP  C +YP      N    + +WLY P++ V P P  ++ DF+  +   LQ +VF+ E +        D+ ++        F Q +   DFI  + SY+D  K ++F + +W  L IIFITG   I++F +GYL+  F +L  G  +L+   + ++R  + ++ YN  VI  K +  +  C ++  L  K  CW++  F++ C       ++G  I     D Q  S  +G+ WD +CF F++LQR +F +  FL V  D+      +SR
Sbjct:  161 IMKQSYICALISMMAWSITYHSWLTFVLLIWSCALWMVRNRRKYAMLSSPFMVMYGNLLLTLQYIWSIALQSDELPEVMEFESNYKMYGNYILLVFQII----------FTVTFWLLLRQHLTEQKALKQKELALSEIKVGMED---------ENDIMKVLGKLVQAMFVKYWIYVCGGMFFFVSFEGKIVMYKIIYMMLFLFCVALYQVHYEWWRRILKYFWMSVVVYTMLVLVFIYTYQFKSFPGLWMNMTGLDKEKLADLGLETFNLTDLFTRIFIPTSFLLVCILHLHYFHDRFLQLTDLKAV----------TRDSKEPESRNKW------HLVIDRLTVLFL---KFLEYFHKFQVFVWWLLELHMIKIVSSYIIWLTIKEVSLLNYVFFIAWAFALPYSQFRPLASSVCTVWTCVIIICKMLYQLASIDPATFSSNCLMPQLNETTARNQTELNSSVLYNSSVDPSNWVGLKKSTPL-LAYLRNNLLMLAMLAFEVTIYRHQEYYRLRNNLTTPATKTIFHDITRLHLDDGLINSAKYFVNYFFYKFGLETCFLLSVNVIGQRMDFFAMVHALWLFGVLYRRRRKAIAETWHRYCCFLACIMAFQYFICIGIPPAACKDYPWRQPGANFNSNIIKWLYFPDFIVRPSPLFLVYDFLLLLCASLQREVFEEENKAAVRIMAGDNVEICMNLDAASFSQHNPVPDFIYCR-SYLDMGKVIMFSYLFWFVLTIIFITGTTRISIFCMGYLVACFYFLLFGGDLLLKPIRIILRYWDWLIAYNVFVITMKNVLSIGACGYIEYL-IKDSCWLIQAFSLSC------TVKGYFIPQNTPDCQLPSGEAGIIWDSICFAFLLLQRRVFMSYYFLHVVADIKSSQILASR 1003          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Xenopus
Match: chordc1 (cysteine and histidine rich domain containing 1 [Source:Xenbase;Acc:XB-GENE-962949])

HSP 1 Score: 443.736 bits (1140), Expect = 4.333e-125
Identity = 285/824 (34.59%), Postives = 456/824 (55.34%), Query Frame = 1
Query: 5191 DKEEKNKQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLPV-PEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLWR----DHSEFYKDIKISNEEEVNHIQPLKPQSAMRTGIK----------------------------FRNPIKQLKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKI----NMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQ---NQNNTYLNISLSM---------KTDNAMMWWEVNEIIQGQSYCPNPDSPAKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWT 7512
            D  E ++   F +S+S+   LL++       +SE  CYF++I+N+++S +L+SL  P L+F WGMLS+ +PSK FW+  I +TE+++V KY+ QF     N   +   +   P   P +LG+EKS +Y   D+IQLL LF HRS L   GLW     D  E        ++ E+   Q L+P     + ++                             RN  + +K F+  + + K     DVYA MFL +    +II+ G+++FG  + +   A   +  ++ P  F+ M++ QF  ++IDRAL+LRK V GK +FQ+  VI IH W+FF LP +T+R FN     QL YF+KC+YFALS+YQ+R GYP RILGNFLT+ YN+ NL  F+ +  +PFL ELR VMDW+WTD++++  +WM VEDI++ IF++KC R  E  +P  +G+ ++ +VKY +G LI++F    IW PL+  S +  +  V   PI+ + +  +G Y PLF  S+++ +++P T + +E +    +    +  ++  +  +D     I+ +S +VW I+PP  ++++++L    + + +    + Q    +  T   ++EK  +  +       E A+LL  +      T V +  +FP+++ A      EAN + Q   ++  +YL++ + +          T + + WW +             D   +    L + IFN+++S    G + + YGI+G+Y +   V+ +F+R F+S IS+ I  EELP VDRI KL  +IY+VRE  +L LEE+L AKLIFLYRS ETMIKWT
Sbjct: 1400 DFPELSESQHFFQSQSRILRLLLALYNFVAAHSELLCYFIIILNNMVSASLISLFLPILIFLWGMLSIHKPSKRFWMTAIIFTEVMVVIKYLFQFGFFPWNNYTILVRNEGKPFFPPRVLGLEKSDSYIKYDLIQLLMLFFHRSLLMSYGLWDRKDLDLEERTPGKDKGSKTEIQASQDLEPAGGSSSSLRQRKRKESQGSVQERGAESNWTCAVQFTSLRNIYQPVKAFFHDILHTKNRAATDVYAFMFLADVVDFVIIVFGFWAFGKHSAAADIASS-LSDDQVPEAFLVMVLIQFSTMVIDRALYLRKTVLGKLIFQVILVIGIHVWMFFILPAVTERMFNQNTVAQLWYFVKCIYFALSAYQIRCGYPTRILGNFLTKKYNHLNLFLFQGFRLVPFLVELRAVMDWVWTDTTLSLSNWMCVEDIYANIFIIKCSRETEKKYPQPKGQKKKKIVKYGMGGLIIVFLICIIWFPLLFMSLVRSVVGVVNHPIDVTVTFKLGGYEPLFTMSAQQQSIQPFTPQQYEALTYEFERQPTAMQFITLYSYEDIVTARIEGSSGSVWGISPPSREQMRKELQNGSSDITLRFTWDFQRDLAKGGTVEHTSEKHTKDLEPGSQERMELADLLQGV----RDTPVSIQHLFPKYIRAPNG--PEANPVKQLQPDEEESYLDVEVQLNRMRVAEGNSTSSFVEWWVITL----------KDCEGEDCNILPMVIFNDKVSPPSLGFL-AGYGIMGLYVSIVLVIGKFVRGFFSEISHSIMFEELPCVDRILKLCQDIYVVRERGELELEEELYAKLIFLYRSPETMIKWT 2205          

HSP 2 Score: 335.109 bits (858), Expect = 1.818e-91
Identity = 251/893 (28.11%), Postives = 445/893 (49.83%), Query Frame = 1
Query: 1576 AWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNL-PELPTIFRISSSEMQSSEIGLHKSLIPTGPLAAMMSFLVVFWLTLRLFMTDEKINKSKICNEKI--------STQQKLEHYFGNVDNATYEKFVKCLKEKCENYWIFSCCFAMLFVSVNGSIVLFRIXXXXXXXXXXXXXXXSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIIQVRYFHSRFLELTSMKQ--TQVCVESERERVKSSKDEMDKNKFSVKNTVEFIR--DVNNMVFTATEKLKSLYTLTQPSIWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSASIVILKMIYQIKIFQTFNWLTNCSQ---------YGNFANSSM--EIIDNAKWLGLEKLENFQLHILKWTAILVGCAVWHIVRYHQMQFYKLNLDQKPKTSVIFQEV-------------EIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNVLWLPYMIFLGILLPVQYVICVGLPPGLCIEYP------LNVIPKLRQWLYLPNYKVSPVPGKILADFVQYIFVVLQYQVFQMEKRKK--SDSHKLVKQRLLEGFQKSIHKDFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCINPMSWEIRGIHGK---NADKQCSSVA--SGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSR 4104
             WS+ Y SW +F+ LL +C +W++ + R   +  SP I+ Y   L  +QY++  +L  ELPT        M+ S++GL ++  P   + A++ + + FWL L  F+T++ + + K  +  +        + ++ L   FG    + Y K           YWI+ C    + VS  G +V+++IVYM+L +  L++F + YS WR+ +  FWW V+ Y +  L++IY FQF+      +N+T L++E L DIGL+RF  S+L  S+ IP  FL+  I+Q+ YFH  F+ +T++    +Q    S     + +   +++++    +  +  +   V   +   + K   L    Q  +WRL E H  K + +  V+V + +V  MN + +++     PF R   +      + ++ I++ KM+YQ+ +     + +NC+Q              NS++  E ID A W G+ K      +I     IL+      IV  HQ  + K    +KP    +F +V             ++  S  ++  L+ +S+      +   ++F+  +   C  I + +    + +             LW  Y +FL   L  QY+IC+G+PP LCI+YP      + V   L +WLYLP++  +P    +++DFV  I V  Q++VF  EK+++  + + + V++      + +   +FI+ + SY+D +K  VF + +W  L ++FITG   I++FGLGYL+  F  L  G  +L    K+ +   + ++ YN  VIL+K +  L+ CVF+  ++T   CW++ LF++ C       ++G +     + D+ CS     +G+ WD +CF F++LQR +F +  F  V LDL   +  +SR
Sbjct:  293 VWSITYHSWLTFVLLLWACLIWMVRNRRQFAMLCSPFILMYGVTLCSLQYVWSMDLREELPTQLGF----MKLSQLGLVRAPYPCLNMGALLLYTLTFWLLLHQFVTEKFLKRKKFMSPLLEVTVAGGPTCEKNLLKRFGEQVKSFYAK-----------YWIYVCGGMFIVVSFAGRLVVYKIVYMLLFLLCLVLFQVYYSLWRKLLTFFWWLVVAYTMLVLITIYTFQFEEFPEYWKNLTNLTDEQLGDIGLERFSVSELFTSILIPGFFLLACILQLHYFHRPFMHMTNLAHASSQGSFHSHERYAQLNLTLLEEDEEESAHGADLSKWDLVTQRLSVLSFKFSELLHRLQVFLWRLLELHVLKLVALYSVWVALQEVSVMNFLFVVLWAFAMPFSRFQHMASCLCTIWTSIIIVCKMLYQLTVVNPLEYSSNCTQPLLNNTSLLEDEILNSTLYREPIDPANWFGIRKGYPNLGYIQNHLQILLLLVFEAIVYRHQEFYRKQYQLEKPHIQAVFPDVYREHLDQDSLVLNDVFISCNSYIHLMHFSI------LCFRMNFM-VIFHGCWLIVILTRRQRVNIAK-----------LWPKYCVFLIFFLLWQYMICLGIPPVLCIDYPWRWDTFVPVNSALIKWLYLPDFYTTPKSVNLISDFVLLIGVAQQWKVFINEKKEEWYTMAGENVEEYEAPKDRPNPVPNFINCQ-SYLDMVKVAVFRYLFWFVLTVVFITGATRISVFGLGYLMSCFYLLLSGTTLLQKPMKAKLVLWDCLILYNITVILSKNMLSLLSCVFVQQMQTN-FCWVIQLFSLVC------TVKGYYNPQDMDKDRDCSLPVEEAGIIWDSICFLFLLLQRRVFLSCYFRHVVLDLRASSLQTSR 1144          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Xenopus
Match: chordc1 (cysteine and histidine rich domain containing 1 [Source:Xenbase;Acc:XB-GENE-962949])

HSP 1 Score: 443.351 bits (1139), Expect = 5.243e-125
Identity = 285/824 (34.59%), Postives = 456/824 (55.34%), Query Frame = 1
Query: 5191 DKEEKNKQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLPV-PEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLWR----DHSEFYKDIKISNEEEVNHIQPLKPQSAMRTGIK----------------------------FRNPIKQLKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKI----NMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQ---NQNNTYLNISLSM---------KTDNAMMWWEVNEIIQGQSYCPNPDSPAKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWT 7512
            D  E ++   F +S+S+   LL++       +SE  CYF++I+N+++S +L+SL  P L+F WGMLS+ +PSK FW+  I +TE+++V KY+ QF     N   +   +   P   P +LG+EKS +Y   D+IQLL LF HRS L   GLW     D  E        ++ E+   Q L+P     + ++                             RN  + +K F+  + + K     DVYA MFL +    +II+ G+++FG  + +   A   +  ++ P  F+ M++ QF  ++IDRAL+LRK V GK +FQ+  VI IH W+FF LP +T+R FN     QL YF+KC+YFALS+YQ+R GYP RILGNFLT+ YN+ NL  F+ +  +PFL ELR VMDW+WTD++++  +WM VEDI++ IF++KC R  E  +P  +G+ ++ +VKY +G LI++F    IW PL+  S +  +  V   PI+ + +  +G Y PLF  S+++ +++P T + +E +    +    +  ++  +  +D     I+ +S +VW I+PP  ++++++L    + + +    + Q    +  T   ++EK  +  +       E A+LL  +      T V +  +FP+++ A      EAN + Q   ++  +YL++ + +          T + + WW +             D   +    L + IFN+++S    G + + YGI+G+Y +   V+ +F+R F+S IS+ I  EELP VDRI KL  +IY+VRE  +L LEE+L AKLIFLYRS ETMIKWT
Sbjct: 1348 DFPELSESQHFFQSQSRILRLLLALYNFVAAHSELLCYFIIILNNMVSASLISLFLPILIFLWGMLSIHKPSKRFWMTAIIFTEVMVVIKYLFQFGFFPWNNYTILVRNEGKPFFPPRVLGLEKSDSYIKYDLIQLLMLFFHRSLLMSYGLWDRKDLDLEERTPGKDKGSKTEIQASQDLEPAGGSSSSLRQRKRKESQGSVQERGAESNWTCAVQFTSLRNIYQPVKAFFHDILHTKNRAATDVYAFMFLADVVDFVIIVFGFWAFGKHSAAADIASS-LSDDQVPEAFLVMVLIQFSTMVIDRALYLRKTVLGKLIFQVILVIGIHVWMFFILPAVTERMFNQNTVAQLWYFVKCIYFALSAYQIRCGYPTRILGNFLTKKYNHLNLFLFQGFRLVPFLVELRAVMDWVWTDTTLSLSNWMCVEDIYANIFIIKCSRETEKKYPQPKGQKKKKIVKYGMGGLIIVFLICIIWFPLLFMSLVRSVVGVVNHPIDVTVTFKLGGYEPLFTMSAQQQSIQPFTPQQYEALTYEFERQPTAMQFITLYSYEDIVTARIEGSSGSVWGISPPSREQMRKELQNGSSDITLRFTWDFQRDLAKGGTVEHTSEKHTKDLEPGSQERMELADLLQGV----RDTPVSIQHLFPKYIRAPNG--PEANPVKQLQPDEEESYLDVEVQLNRMRVAEGNSTSSFVEWWVITL----------KDCEGEDCNILPMVIFNDKVSPPSLGFL-AGYGIMGLYVSIVLVIGKFVRGFFSEISHSIMFEELPCVDRILKLCQDIYVVRERGELELEEELYAKLIFLYRSPETMIKWT 2153          

HSP 2 Score: 353.214 bits (905), Expect = 3.838e-97
Identity = 264/888 (29.73%), Postives = 457/888 (51.46%), Query Frame = 1
Query: 1546 SFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNL-PELPTIFRISSSEMQSSEIGLHKSLIPTGPLAAMMSFLVVFWLTLRLFMTDEKINKSKICN---EKISTQQKLEHYFGNVDNATYEKFVKCLKEKCENYWIFSCCFAMLFVSVNGSIVLFRIXXXXXXXXXXXXXXXSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIIQVRYFHSRFLELTSMKQ--TQVCVESERERVKSSKDEMDKNKFSVKNTVEFIR--DVNNMVFTATEKLKSLYTLTQPSIWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSASIVILKMIYQIKIFQTFNWLTNCSQ---------YGNFANSSM--EIIDNAKWLGLEKLENFQLHILKWTAILVGCAVWHIVRYHQMQFYKLNLDQKPKTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFI-CTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNV--LWLPYMIFLGILLPVQYVICVGLPPGLCIEYP------LNVIPKLRQWLYLPNYKVSPVPGKILADFVQYIFVVLQYQVFQMEKRKK--SDSHKLVKQRLLEGFQKSIHKDFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCINPMSWEIRGIHGK---NADKQCSSVA--SGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSR 4104
            SFILT        + Y SW +F+ LL +C +W++ + R   +  SP I+ Y   L  +QY++  +L  ELPT        M+ S++GL ++  P   + A++ + + FWL L  F+T++ + + K  +   E    ++ L   FG    + Y K           YWI+ C    + VS  G +V+++IVYM+L +  L++F + YS WR+ +  FWW V+ Y +  L++IY FQF+      +N+T L++E L DIGL+RF  S+L  S+ IP  FL+  I+Q+ YFH  F+ +T++    +Q    S       +  + ++++    +  +  +   V   +   + K   L    Q  +WRL E H  K + +  V+V + +V  MN + +++     PF R   +      + ++ I++ KM+YQ+ +     + +NC+Q              NS++  E ID A W G+ K      +I     IL+      IV  HQ  + K    +KP    +F +V      +     +KY +N+ F K GLE+S   C ++  C R++ + +++    L+ ++ +R   N+  LW  Y +FL   L  QY+IC+G+PP LCI+YP      + V   L +WLYLP++  +P    +++DFV  I V  Q++VF  EK+++  + + + V++      + +   +FI+ + SY+D +K  VF + +W  L ++FITG   I++FGLGYL+  F  L  G  +L    K+ +   + ++ YN  VIL+K +  L+ CVF+  ++T   CW++ LF++ C       ++G +     + D+ CS     +G+ WD +CF F++LQR +F +  F  V LDL   +  +SR
Sbjct:  238 SFILTITC----GITYHSWLTFVLLLWACLIWMVRNRRQFAMLCSPFILMYGVTLCSLQYVWSMDLREELPTQLGF----MKLSQLGLVRAPYPCLNMGALLLYTLTFWLLLHQFVTEKFLKRKKFMSPLLEVTVAEKNLLKRFGEQVKSFYAK-----------YWIYVCGGMFIVVSFAGRLVVYKIVYMLLFLLCLVLFQVYYSLWRKLLTFFWWLVVAYTMLVLITIYTFQFEEFPEYWKNLTNLTDEQLGDIGLERFSVSELFTSILIPGFFLLACILQLHYFHRPFMHMTNLAHASSQGSFHSHERYAHDAAADEEEDEEESAHGADLSKWDLVTQRLSVLSFKFSELLHRLQVFLWRLLELHVLKLVALYSVWVALQEVSVMNFLFVVLWAFAMPFSRFQHMASCLCTIWTSIIIVCKMLYQLTVVNPLEYSSNCTQPLLNNTSLLEDEILNSTLYREPIDPANWFGIRKGYPNLGYIQNHLQILLLLVFEAIVYRHQEFYRKQYQLEKPHIQAVFPDVYREHLDQGLFSCIKYFINYSFYKFGLEVSSQECDIL--CFRMN-FMVIFHGCWLIVILTRRQRVNIAKLWPKYCVFLIFFLLWQYMICLGIPPVLCIDYPWRWDTFVPVNSALIKWLYLPDFYTTPKSVNLISDFVLLIGVAQQWKVFINEKKEEWYTMAGENVEEYEAPKDRPNPVPNFINCQ-SYLDMVKVAVFRYLFWFVLTVVFITGATRISVFGLGYLMSCFYLLLSGTTLLQKPMKAKLVLWDCLILYNITVILSKNMLSLLSCVFVQQMQTN-FCWVIQLFSLVC------TVKGYYNPQDMDKDRDCSLPVEEAGIIWDSICFLFLLLQRRVFLSCYFRHVVLDLRASSLQTSR 1095          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Mouse
Match: Piezo1 (piezo-type mechanosensitive ion channel component 1 [Source:MGI Symbol;Acc:MGI:3603204])

HSP 1 Score: 400.979 bits (1029), Expect = 1.003e-111
Identity = 344/1246 (27.61%), Postives = 593/1246 (47.59%), Query Frame = 1
Query:  811 HWATQSLFAFFNIVITGFAGIISPXXXXXXXXXXXXXXXTFWACGNNVMTSNFARMRLFLLLYSAAHVCLIFIVQLEFMQLYIPTGQRLSRLLGLYLMFD-TNCKNRGEIIFNNQRSID-YVSPFIILYVYYLSAIETRIWLEERKRINKERPAVDKETFIHTESYLSGEEINQEESQRISNSFNVEIGSNVSDGPYIDFTDVPHVLDAQNSRSTLFIEEDITKDMEKNQVKERPLLLSIINTMISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNLPELPTIFRISSSEMQSSEIGLHKSLIPTGPLAAMMSFLVVFWLTLRLFMTDEKINKSKICNEKISTQQKLEHYFGNVDNATYEKFVKCLKEKCEN----YWIFSCCFAMLFVSVNGSIVLFRIXXXXXXXXXXXXXXXSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIIQVRYFHSRFLELTSMKQT-------------QVCV--------ESERERVKSSKDEMDKNKFSVK---NTVEFIRDVNNMVFTATEKLKSLYTLTQPSIWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSASIVILKMIYQIKIFQTFNWLTNCSQ-YGNFAN-SSMEI---------IDNAKWLGLEKLENFQLHILKWTAILVGCAVWHIVRYHQMQFYKLNLDQKP-KTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNV-LWLPYMIFLGILLPVQYVICVGLPPGLCIEYPL---NVIP---KLRQWLYLPNYKVSPVPGKILADFVQYIFVVLQYQVFQMEKRKKSDSHKLVKQRLLEGFQKSIH--KDFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCINPMSWEIRGIHGKNADKQCSSVASGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLXXXXXXXXXXXXXXXXLNRIERKIKKIEQ-----RQAQHGKPELN-------------------------------EHYLVMRSGDYYLF 4287
            HW   +      IV+   AGI  PS  + VYL+ +L + T+W+C   +    F  + + +  + A H+  ++  Q  F+Q  +P G   +RL GL    D  N  +   ++ N + +   YVSP I+L +YY +    ++       + KE P  D+E  +  +          E   R +    + + +     P +D   V HVL +Q+      +   +       ++KE   L  + + ++  S++   +AMM WS+ Y SW +F+ LL +C +W +     + +  SP I+ Y   L  ++Y++   LPELPT        +   ++GL  +  P   L AM+ +L+ FWL LR F+ ++ + K K+          LE    + +    +  ++ L E        YWI+ C    + VS  G +V+++IVYM L +  L +F + Y+ WR+ ++VFWW V+ Y +  L+++Y FQFQ      +N+TG ++E L D+GL++F  S+L  S+ IP  FL+  I+Q+ YFH  F++LT ++               Q  V        + E E  +     MD    + +    T      V + +        ++ T  Q  + RL E H  K + +  V+V + +V  MN++L+++     P+PR   +      V +  I++ KM+YQ+KI     + +NC++ + N  N   +EI         +D A W G+ K      +I     IL+   V+  V Y + + Y+    Q P     +  +       ++    LKY +NF F K GLE+ F+  V V   R++   +++   L+  L  +R      LW  Y +FL + L  QY++C+G+PP LCI+YP      IP    L +WLYLP++  +P    +++DF+  +    Q+QVF  E+ ++      +    LE  +   +   +FI  + SY+D LK  VF + +WL L ++F+ G   I++FGLGYLL  F  L  G  +L    ++ +   + ++ YN  VI++K +  L+ CVF+  +++   CW++ LF++ C     ++ + +  ++ D       +G+ WD +CFFF++LQR IF +  FL V  DL      +SRG  L N   +KSI   ++ EEK L +++R++K+I       RQ+Q  + +L                                +H  V+ SGDY+LF
Sbjct:  200 HWLLMTSGRTLVIVLLALAGIAHPSAFSSVYLVVFLAICTWWSCHFPLSPLGFNTLCVMVSCFGAGHLICLYCYQTPFIQDMLPPGNIWARLFGLKNFVDLPNYSSPNALVLNTKHAWPIYVSPGILLLLYYTATSLLKLHKSCPSELRKETPREDEEHELELDHLEP------EPQARDATQGEMPMTTE----PDLDNCTV-HVLTSQSPVRQRPVRPRLA------ELKEMSPLHGLGHLIMDQSYVCALIAMMVWSIMYHSWLTFVLLLWACLIWTVRSRHQLAMLCSPCILLYGLTLCCLRYVWAMELPELPTTL----GPVSLHQLGLEHTRYPCLDLGAMLLYLLTFWLLLRQFVKEKLLKKQKV------PAALLEVTVADTEPTQTQTLLRSLGELVTGIYVKYWIYVCAGMFIVVSFAGRLVVYKIVYMFLFLLCLTLFQVYYTLWRKLLRVFWWLVVAYTMLVLIAVYTFQFQDFPTYWRNLTGFTDEQLGDLGLEQFSVSELFSSILIPGFFLLACILQLHYFHRPFMQLTDLEHVPPPGTRHPRWAHRQDAVSEAPLLEHQEEEEVFREDGQSMDGPHQATQVPEGTASKWGLVADRLLDLAASFSAVLTRIQVFVRRLLELHVFKLVALYTVWVALKEVSVMNLLLVVLWAFALPYPRFRPMASCLSTVWTCIIIVCKMLYQLKIVNPHEYSSNCTEPFPNNTNLQPLEINQSLLYRGPVDPANWFGVRKGYPNLGYIQNHLQILL-LLVFEAVVYRRQEHYRRQHQQAPLPAQAVCADGTRQRLDQDLLSCLKYFINFFFYKFGLEICFLMAVNVIGQRMNFMVILHGCWLVAILTRRRREAIARLWPNYCLFLTLFLLYQYLLCLGMPPALCIDYPWRWSKAIPMNSALIKWLYLPDFFRAPNSTNLISDFLLLLCASQQWQVFSAERTEEWQRMAGINTDHLEPLRGEPNPIPNFIHCR-SYLDMLKVAVFRYLFWLVLVVVFVAGATRISIFGLGYLLACFYLLLFGTTLLQKDTRAQLVLWDCLILYNVTVIISKNMLSLLSCVFVEQMQSN-FCWVIQLFSLVCTVKGYYDPKEMMTRDRDCLLPVEEAGIIWDSICFFFLLLQRRIFLSHYFLHVSADLKATALQASRGFALYNAANLKSINFHRQIEEKSLAQLKRQMKRIRAKQEKYRQSQASRGQLQSKDPQDPSQEPGPDSPGGSSPPRRQWWRPWLDHATVIHSGDYFLF 1415          

HSP 2 Score: 334.724 bits (857), Expect = 2.194e-91
Identity = 220/608 (36.18%), Postives = 353/608 (58.06%), Query Frame = 1
Query: 5764 KQLKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKI----NMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQ---NQNNTYLNISLSM----------------KTDNAMMWWEVNEIIQGQSYCPNPDSPAKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQ 7515
            + L++F+  + + K     DVYA+MFL +   ++III G+++FG  + +   A   +  ++ P  F+ M++ QF  ++IDRAL+LRK V GK  FQ+  V+ IH W+FF LP +T+R F+     QL YF+KC+YFALS+YQ+R GYP RILGNFLT+ YN+ NL  F+ +  +PFL ELR VMDW+WTD++++  +WM VEDI++ IF++KC R  E  +P  +G+ ++ +VKY +G LI++F    IW PL+  S I  +  V   PI+ + ++ +G Y PLF  S+++ ++ P T + +EE+ +    +  +  ++  + P+D     I+ +S  +W I+PP   ++K++L    A + +    N Q    +  T   + EK    T      +  +  L  L+  + + + V +P +FP+++ A      EAN + Q   ++   YL + + +                K  + + WW V E+   ++ C            L + IF++++S    G   + YGI+G+Y +   VV +F+R F+S IS+ I  EELP VDRI KL  +I+LVRE ++L LEE+L AKLIFLYRS ETMIKWT+
Sbjct: 1956 QPLQRFFHDILHTKYRAATDVYALMFLADIVDIIIIIFGFWAFGKHSAATDIASS-LSDDQVPQAFLFMLLVQFGTMVIDRALYLRKTVLGKLAFQVVLVVAIHIWMFFILPAVTERMFSQNAVAQLWYFVKCIYFALSAYQIRCGYPTRILGNFLTKKYNHLNLFLFQGFRLVPFLVELRAVMDWVWTDTTLSLSNWMCVEDIYANIFIIKCSRETEKKYPQPKGQKKKKIVKYGMGGLIILFLIAIIWFPLLFMSLIRSVVGVVNQPIDVTVTLKLGGYEPLFTMSAQQPSIVPFTPQAYEELSQQFDPYPLAMQFISQYSPEDIVTAQIEGSSGALWRISPPSRAQMKQELYNGTADITLRFTWNFQRDLAKGGTVEYTNEK---HTLELAPNSTARRQLAQLLEGRPDQS-VVIPHLFPKYIRAPNG--PEANPVKQLQPDEEEDYLGVRIQLRREQVGTGASGEQAGTKASDFLEWW-VIELQDCKADCN----------LLPMVIFSDKVSPPSLG-FLAGYGIVGLYVSIVLVVGKFVRGFFSEISHSIMFEELPCVDRILKLCQDIFLVRETRELELEEELYAKLIFLYRSPETMIKWTR 2544          

HSP 3 Score: 116.316 bits (290), Expect = 5.180e-25
Identity = 71/202 (35.15%), Postives = 104/202 (51.49%), Query Frame = 1
Query: 5167 DGRKSVSEDKEEKNKQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLPV-PEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLWRDHSEFY---------KDIKISNEEEVNHIQPLKPQSAMRTG 5742
            D R  + E +E +     F   + +   LL +  +    +SE  CYF++I+NH+++ +  SL  P LVF W ML++PRPSK FW+  I +TE+++V KY+ QF     N   V   +   P   P ILG+EK+ +Y   D++QL+ LF HRS L   GLW    + Y         KD +   E E      L+ QS   TG
Sbjct: 1651 DRRLHIPELEEAER----FEAQQGRTLRLLRAGYQCVAAHSELLCYFIIILNHMVTASAASLVLPVLVFLWAMLTIPRPSKRFWMTAIVFTEVMVVTKYLFQFGFFPWNSYVVLRRYENKPYFPPRILGLEKTDSYIKYDLVQLMALFFHRSQLLCYGLWDHEEDRYPKDHCRSSVKDREAKEEPEAK----LESQSETGTG 1844          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Mouse
Match: Piezo1 (piezo-type mechanosensitive ion channel component 1 [Source:MGI Symbol;Acc:MGI:3603204])

HSP 1 Score: 400.979 bits (1029), Expect = 1.054e-111
Identity = 344/1246 (27.61%), Postives = 593/1246 (47.59%), Query Frame = 1
Query:  811 HWATQSLFAFFNIVITGFAGIISPXXXXXXXXXXXXXXXTFWACGNNVMTSNFARMRLFLLLYSAAHVCLIFIVQLEFMQLYIPTGQRLSRLLGLYLMFD-TNCKNRGEIIFNNQRSID-YVSPFIILYVYYLSAIETRIWLEERKRINKERPAVDKETFIHTESYLSGEEINQEESQRISNSFNVEIGSNVSDGPYIDFTDVPHVLDAQNSRSTLFIEEDITKDMEKNQVKERPLLLSIINTMISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNLPELPTIFRISSSEMQSSEIGLHKSLIPTGPLAAMMSFLVVFWLTLRLFMTDEKINKSKICNEKISTQQKLEHYFGNVDNATYEKFVKCLKEKCEN----YWIFSCCFAMLFVSVNGSIVLFRIXXXXXXXXXXXXXXXSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIIQVRYFHSRFLELTSMKQT-------------QVCV--------ESERERVKSSKDEMDKNKFSVK---NTVEFIRDVNNMVFTATEKLKSLYTLTQPSIWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSASIVILKMIYQIKIFQTFNWLTNCSQ-YGNFAN-SSMEI---------IDNAKWLGLEKLENFQLHILKWTAILVGCAVWHIVRYHQMQFYKLNLDQKP-KTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNV-LWLPYMIFLGILLPVQYVICVGLPPGLCIEYPL---NVIP---KLRQWLYLPNYKVSPVPGKILADFVQYIFVVLQYQVFQMEKRKKSDSHKLVKQRLLEGFQKSIH--KDFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCINPMSWEIRGIHGKNADKQCSSVASGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLXXXXXXXXXXXXXXXXLNRIERKIKKIEQ-----RQAQHGKPELN-------------------------------EHYLVMRSGDYYLF 4287
            HW   +      IV+   AGI  PS  + VYL+ +L + T+W+C   +    F  + + +  + A H+  ++  Q  F+Q  +P G   +RL GL    D  N  +   ++ N + +   YVSP I+L +YY +    ++       + KE P  D+E  +  +          E   R +    + + +     P +D   V HVL +Q+      +   +       ++KE   L  + + ++  S++   +AMM WS+ Y SW +F+ LL +C +W +     + +  SP I+ Y   L  ++Y++   LPELPT        +   ++GL  +  P   L AM+ +L+ FWL LR F+ ++ + K K+          LE    + +    +  ++ L E        YWI+ C    + VS  G +V+++IVYM L +  L +F + Y+ WR+ ++VFWW V+ Y +  L+++Y FQFQ      +N+TG ++E L D+GL++F  S+L  S+ IP  FL+  I+Q+ YFH  F++LT ++               Q  V        + E E  +     MD    + +    T      V + +        ++ T  Q  + RL E H  K + +  V+V + +V  MN++L+++     P+PR   +      V +  I++ KM+YQ+KI     + +NC++ + N  N   +EI         +D A W G+ K      +I     IL+   V+  V Y + + Y+    Q P     +  +       ++    LKY +NF F K GLE+ F+  V V   R++   +++   L+  L  +R      LW  Y +FL + L  QY++C+G+PP LCI+YP      IP    L +WLYLP++  +P    +++DF+  +    Q+QVF  E+ ++      +    LE  +   +   +FI  + SY+D LK  VF + +WL L ++F+ G   I++FGLGYLL  F  L  G  +L    ++ +   + ++ YN  VI++K +  L+ CVF+  +++   CW++ LF++ C     ++ + +  ++ D       +G+ WD +CFFF++LQR IF +  FL V  DL      +SRG  L N   +KSI   ++ EEK L +++R++K+I       RQ+Q  + +L                                +H  V+ SGDY+LF
Sbjct:  199 HWLLMTSGRTLVIVLLALAGIAHPSAFSSVYLVVFLAICTWWSCHFPLSPLGFNTLCVMVSCFGAGHLICLYCYQTPFIQDMLPPGNIWARLFGLKNFVDLPNYSSPNALVLNTKHAWPIYVSPGILLLLYYTATSLLKLHKSCPSELRKETPREDEEHELELDHLEP------EPQARDATQGEMPMTTE----PDLDNCTV-HVLTSQSPVRQRPVRPRLA------ELKEMSPLHGLGHLIMDQSYVCALIAMMVWSIMYHSWLTFVLLLWACLIWTVRSRHQLAMLCSPCILLYGLTLCCLRYVWAMELPELPTTL----GPVSLHQLGLEHTRYPCLDLGAMLLYLLTFWLLLRQFVKEKLLKKQKV------PAALLEVTVADTEPTQTQTLLRSLGELVTGIYVKYWIYVCAGMFIVVSFAGRLVVYKIVYMFLFLLCLTLFQVYYTLWRKLLRVFWWLVVAYTMLVLIAVYTFQFQDFPTYWRNLTGFTDEQLGDLGLEQFSVSELFSSILIPGFFLLACILQLHYFHRPFMQLTDLEHVPPPGTRHPRWAHRQDAVSEAPLLEHQEEEEVFREDGQSMDGPHQATQVPEGTASKWGLVADRLLDLAASFSAVLTRIQVFVRRLLELHVFKLVALYTVWVALKEVSVMNLLLVVLWAFALPYPRFRPMASCLSTVWTCIIIVCKMLYQLKIVNPHEYSSNCTEPFPNNTNLQPLEINQSLLYRGPVDPANWFGVRKGYPNLGYIQNHLQILL-LLVFEAVVYRRQEHYRRQHQQAPLPAQAVCADGTRQRLDQDLLSCLKYFINFFFYKFGLEICFLMAVNVIGQRMNFMVILHGCWLVAILTRRRREAIARLWPNYCLFLTLFLLYQYLLCLGMPPALCIDYPWRWSKAIPMNSALIKWLYLPDFFRAPNSTNLISDFLLLLCASQQWQVFSAERTEEWQRMAGINTDHLEPLRGEPNPIPNFIHCR-SYLDMLKVAVFRYLFWLVLVVVFVAGATRISIFGLGYLLACFYLLLFGTTLLQKDTRAQLVLWDCLILYNVTVIISKNMLSLLSCVFVEQMQSN-FCWVIQLFSLVCTVKGYYDPKEMMTRDRDCLLPVEEAGIIWDSICFFFLLLQRRIFLSHYFLHVSADLKATALQASRGFALYNAANLKSINFHRQIEEKSLAQLKRQMKRIRAKQEKYRQSQASRGQLQSKDPQDPSQEPGPDSPGGSSPPRRQWWRPWLDHATVIHSGDYFLF 1414          

HSP 2 Score: 334.724 bits (857), Expect = 2.307e-91
Identity = 220/608 (36.18%), Postives = 354/608 (58.22%), Query Frame = 1
Query: 5764 KQLKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKI----NMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQ---NQNNTYLNISLSM----------------KTDNAMMWWEVNEIIQGQSYCPNPDSPAKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQ 7515
            + L++F+  + + K     DVYA+MFL +   ++III G+++FG  + +   A   +  ++ P  F+ M++ QF  ++IDRAL+LRK V GK  FQ+  V+ IH W+FF LP +T+R F+     QL YF+KC+YFALS+YQ+R GYP RILGNFLT+ YN+ NL  F+ +  +PFL ELR VMDW+WTD++++  +WM VEDI++ IF++KC R  E  +P  +G+ ++ +VKY +G LI++F    IW PL+  S I  +  V   PI+ + ++ +G Y PLF  S+++ ++ P T + +EE+ +    +  +  ++  + P+D     I+ +S  +W I+PP   ++K++L    A + +    N Q    +  T   + EK    T      +  +  L  L+  + + + V +P +FP+++ A      EAN + Q   ++   YL + + +                K  + + WW V E+   ++ C            L + IF++++S    G + + YGI+G+Y +   VV +F+R F+S IS+ I  EELP VDRI KL  +I+LVRE ++L LEE+L AKLIFLYRS ETMIKWT+
Sbjct: 1955 QPLQRFFHDILHTKYRAATDVYALMFLADIVDIIIIIFGFWAFGKHSAATDIASS-LSDDQVPQAFLFMLLVQFGTMVIDRALYLRKTVLGKLAFQVVLVVAIHIWMFFILPAVTERMFSQNAVAQLWYFVKCIYFALSAYQIRCGYPTRILGNFLTKKYNHLNLFLFQGFRLVPFLVELRAVMDWVWTDTTLSLSNWMCVEDIYANIFIIKCSRETEKKYPQPKGQKKKKIVKYGMGGLIILFLIAIIWFPLLFMSLIRSVVGVVNQPIDVTVTLKLGGYEPLFTMSAQQPSIVPFTPQAYEELSQQFDPYPLAMQFISQYSPEDIVTAQIEGSSGALWRISPPSRAQMKQELYNGTADITLRFTWNFQRDLAKGGTVEYTNEK---HTLELAPNSTARRQLAQLLEGRPDQS-VVIPHLFPKYIRAPNG--PEANPVKQLQPDEEEDYLGVRIQLRREQVGTGASGEQAGTKASDFLEWW-VIELQDCKADCN----------LLPMVIFSDKVSPPSLGFL-AGYGIVGLYVSIVLVVGKFVRGFFSEISHSIMFEELPCVDRILKLCQDIFLVRETRELELEEELYAKLIFLYRSPETMIKWTR 2543          

HSP 3 Score: 116.316 bits (290), Expect = 5.402e-25
Identity = 71/202 (35.15%), Postives = 104/202 (51.49%), Query Frame = 1
Query: 5167 DGRKSVSEDKEEKNKQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLPV-PEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLWRDHSEFY---------KDIKISNEEEVNHIQPLKPQSAMRTG 5742
            D R  + E +E +     F   + +   LL +  +    +SE  CYF++I+NH+++ +  SL  P LVF W ML++PRPSK FW+  I +TE+++V KY+ QF     N   V   +   P   P ILG+EK+ +Y   D++QL+ LF HRS L   GLW    + Y         KD +   E E      L+ QS   TG
Sbjct: 1650 DRRLHIPELEEAER----FEAQQGRTLRLLRAGYQCVAAHSELLCYFIIILNHMVTASAASLVLPVLVFLWAMLTIPRPSKRFWMTAIVFTEVMVVTKYLFQFGFFPWNSYVVLRRYENKPYFPPRILGLEKTDSYIKYDLVQLMALFFHRSQLLCYGLWDHEEDRYPKDHCRSSVKDREAKEEPEAK----LESQSETGTG 1843          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Mouse
Match: Piezo2 (piezo-type mechanosensitive ion channel component 2 [Source:MGI Symbol;Acc:MGI:1918781])

HSP 1 Score: 380.178 bits (975), Expect = 3.180e-105
Identity = 220/595 (36.97%), Postives = 356/595 (59.83%), Query Frame = 1
Query: 5758 PIKQLKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLI---NTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAMM----WWEVNEIIQGQSYCPNPDSPAKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQH 7518
            PI+Q   F+  + +   +   DVY +MFL +    +II+ G+++FG  + +       +  ++ P PF+ M++ QF  +++DRAL+LRK V GK +FQ+  V  IH W+FF LP +T+RKF+     QL YF+KCVYF LS+YQ+R GYP R+LGNFLT++YNY NL  F+ +  +PFL ELR VMDW+WTD++++   W+ VEDI++ IF+LKCWR  E  +P  RG+ ++  VKY +G +I++     +W PL+  S I  +  V   P++ S +I +G Y P+F  S++++ ++ +    + E  +    +  +  +L+++E +D T   ++  S+++W I+PP  +K+ ++L+ P +   +      +R  T     E I     S  L    + ++  +I   +T+ ++T V +  I+P ++ A   + S+      ++NN ++NI++ +  DN       WW +N  + G S   N  S A     L + +FN+++S    G + + YGI+G+YA+   V+ +F+R F+S IS+ I  EELPNVDRI KL  +I+LVRE  +L LEE L AKLIFLYRS ETMIKWT+ 
Sbjct: 2196 PIRQ---FFYDLIHPDYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHS-AAADITSSLSEDQVPGPFLVMVLIQFGTMVVDRALYLRKTVLGKVIFQVILVFGIHFWMFFILPGVTERKFSQNLVAQLWYFVKCVYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFILKCWRESEKRYPQPRGQKKKKAVKYGMGGMIIVLLICIVWFPLLFMSLIKSVAGVINQPLDVSVTITLGGYQPIFTMSAQQSQLKVMDNSKYNEFLKSFGPNSGAMQFLENYEREDVTVAELEGNSNSLWTISPPSKQKMIQELTDPNSCFSVVFSWSIQRNMTLGAKAE-IATDKLSFPLAVATRNSIAKMIAGNDTESSNTPVTIEKIYPYYVKAPSDSNSKPIKQLLSENN-FMNITIILFRDNVTKSNSEWWVLN--LTG-SRIFNQGSQA-----LELVVFNDKVSPPSLGFL-AGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPNVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTRE 2775          

HSP 2 Score: 203.756 bits (517), Expect = 1.529e-51
Identity = 169/628 (26.91%), Postives = 285/628 (45.38%), Query Frame = 1
Query:  850 VITGFAGIISPXXXXXXXXXXXXXXXTFWACGNNVMTSNFARMRLFLLLYSAAHVCLIFIVQLEFMQLYIPTGQRLSRLLGLYLMFDTNCKNRGEIIFNNQRS-IDYVSPFIILYVYYLSAIETRIWLEERKRINKERPAVDKETFIHTESYLSGEEINQEESQRISNSFNVEIGSN-------------VSDGPYIDFTDVPHVLDAQNSRSTLFIEEDITK-DM------------------------------EKNQVKERPL----LLSIINTMISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNLPELPTIFRISSSEMQSSEIGLHKSLIPTGPLAAMMSFLVVFWLTLRLFMTDEKINKSK---ICNEKISTQ-------------------------------------------------QKLEHYFGNVDNATYEKFVKCLKEKCENYWIFSCCFAMLFVSVNGSIVLFRIXXXXXXXXXXXXXXXSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIIQVRYFHSRFLELTSMK 2430
            ++ G +G++ PSL + VY   +LG+ T+W+         F  + + L +++A H+  +++ Q +F Q  +P     +RL G+  +  T+C +  +II N   S   + +P ++L +YY  A   RIWL+E        P V +E     E  L          +R S  +  +  ++              SDG  +     P  +D      +L IE    K D+                              E +Q ++R +    ++++   ++  S+I   +AMMAWS+ Y SW +F+ L+ SC LW+I + R   + +SP +V YA LL+++QYI+ F LPE+  +             G  +   P G LA+ + F + FWL LR  +T++K  + K   +   KI +Q                                                 Q +    GN+  A + K+           WI+ C     FVS  G IV+++I+YMVL ++ + ++ + Y +WR+ +K FW +V+ Y +  L+ IY +QF+      QN+TGL +E L D+GLK+F  ++L   +FIP  FL++ I+ + YFH RFLELT +K
Sbjct:  229 ILLGSSGMMLPSLTSAVYFFVFLGLCTWWSWCRTFDPLLFGCLCVLLAIFTAGHLIGLYLYQFQFFQEAVPPNDYYARLFGIKSVIQTDCASTWKIIVNPDLSWYHHANPILLLVMYYTLATLIRIWLQE--------PLVQEEMAKEDEGALDCSSNQNTAERRRSLWYATQYPTDERKLLSMTQDDYKPSDGLLVTVNGNP--VDYHTIHPSLPIENGPAKTDLYTTPQYRWEPSEESSEKKEEEEDKREDSEGEGSQEEKRSVRMHAMVAVFQFIMKQSYICALIAMMAWSITYHSWLTFVLLIWSCTLWMIRNRRKYAMISSPFMVVYANLLLVLQYIWSFELPEIKKV------------PGFLEKKEP-GELASKILFTITFWLLLRQHLTEQKALREKEALLSEVKIGSQELEEKDEELQDVQVEGEPTEKEEEEEEEIKEERHEVKKEEEEEVEEDDDQDIMKVLGNLVVALFIKY-----------WIYVCGGMFFFVSFEGKIVMYKIIYMVLFLFCVALYQVHYEWWRKILKYFWMSVVIYTMLVLIFIYTYQFENFPGLWQNMTGLKKEKLEDLGLKQFTVAELFTRIFIPTSFLLVCILHLHYFHDRFLELTDLK 822          

HSP 3 Score: 202.986 bits (515), Expect = 3.125e-51
Identity = 158/591 (26.73%), Postives = 293/591 (49.58%), Query Frame = 1
Query: 2596 QPSIWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSASIVILKMIYQIKIFQTFNWLTNCSQYGNFANSSMEI------------IDNAKWLGLEKLENFQLHILKWTAILVGCAVWHIVRYHQMQFYK-LNLDQKPKTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNV-LWLPYMIFLGILLPVQYVICVGLPPGLCIEYPL---------NVIPKLRQWLYLPNYKVSPVPGKILADFVQYIFVVLQYQVFQMEKRKK-----SDSHKLVKQRLLEGF-QKSIHKDFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCINPMSWEIRGIHGKNADKQCS--SVASGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLXXXXXXXXXXXXXXXXLNRIERKIKKIEQRQAQHGKPELNEHYLVMRSGD 4275
            Q  +W + E H  K +   I++V + +V   N + ++      P+ +L     +   V +  I++ KM+YQ++  +  N+  NCS   N   +++ +            +D  +W+GL K     ++ L+   +++    + +  Y   ++Y+  N    P +  IF ++      +   +  KY +N+ F K GLE  F+ +V V   R+D Y++++   L+  L  +R      +W  Y  FL  ++  QY +C+G+PP  C +YP          N+I    +WLY P++ V P P  ++ DF+  +   LQ Q+F+ E +        D+ ++        F Q +   DFI  +S Y+D  K ++F + +W  L IIFITG   I++F +GYL+  F +L  G  +L+   KS++R  + ++ YN  VI  K I  +  C ++  L  +  CW++  F++ C       ++G      D +C   S  +G+ WD +CF F++LQR +F +  FL V  D+      +SRGA L    I+K+++ + + E+K +++++R++ +I+ RQ ++ K +     L   SG+
Sbjct:  958 QVFMWWILELHIIKIVSSYIIWVTVKEVSLFNYVFLISWAFALPYAKLRRAASSVCTVWTCVIIVCKMLYQLQTIKPENFSVNCS-LPNENQTNIPLHELNKSLLYSAPVDPTEWVGLRKSSPLLVY-LRNNLLMLAILAFEVTVYRHQEYYRGRNNLTAPVSKTIFHDITRLHLDDGLINCAKYFVNYFFYKFGLETCFLMSVNVIGQRMDFYAMIHACWLIGVLYRRRRKAIAEVWPKYCCFLACIITFQYFVCIGIPPAPCRDYPWRFKGAYFNDNII----KWLYFPDFIVRPNPVFLVYDFMLLLCASLQRQIFEDENKAAVRIMAGDNVEICMNLDAASFSQHNPVPDFIHCRS-YLDMSKVIIFSYLFWFVLTIIFITGTTRISIFCMGYLVACFYFLLFGGDLLLKPIKSILRYWDWLIAYNVFVITMKNILSIGACGYIGAL-VRNSCWLIQAFSLACT------VKGYQMPEDDSRCKLPSGEAGIIWDSICFAFLLLQRRVFMSYYFLHVVADIKASQILASRGAELFQATIVKAVKARIEEEKKSMDQLKRQMDRIKARQQKYKKGKERMLSLTQESGE 1534          

HSP 4 Score: 108.612 bits (270), Expect = 1.123e-22
Identity = 67/167 (40.12%), Postives = 97/167 (58.08%), Query Frame = 1
Query: 5197 EEKNKQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNV-LPVPEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLWRDHSEFYKDIKISNEEE 5694
            +E  + + F   + +F  L  +     +  SE  CYF++I+NH+ S ++++L  P L+F W MLSVPRPS+ FW++ I YTE+ IV KY  QF     N  L + + R  P   P I+G+EK   Y + D+IQLL LF HRS LK +GLW +      DI  SN ++
Sbjct: 1918 DELEESEKFYVDQPRFLLLFYAMYNTLVARSEMVCYFVIILNHMTSASIITLLLPILIFLWAMLSVPRPSRRFWMMAIVYTEVAIVVKYFFQFGFFPWNKDLEIYKER--PYFPPNIIGVEKKEGYVLYDLIQLLALFFHRSILKCHGLWDE-----DDIVDSNTDK 2077          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Mouse
Match: Piezo2 (piezo-type mechanosensitive ion channel component 2 [Source:MGI Symbol;Acc:MGI:1918781])

HSP 1 Score: 380.178 bits (975), Expect = 3.182e-105
Identity = 222/598 (37.12%), Postives = 356/598 (59.53%), Query Frame = 1
Query: 5758 PIKQLKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLI---NTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQNQ---NNTYLNISLSMKTDNAMM----WWEVNEIIQGQSYCPNPDSPAKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQH 7518
            PI+Q   F+  + +   +   DVY +MFL +    +II+ G+++FG  + +       +  ++ P PF+ M++ QF  +++DRAL+LRK V GK +FQ+  V  IH W+FF LP +T+RKF+     QL YF+KCVYF LS+YQ+R GYP R+LGNFLT++YNY NL  F+ +  +PFL ELR VMDW+WTD++++   W+ VEDI++ IF+LKCWR  E  +P  RG+ ++  VKY +G +I++     +W PL+  S I  +  V   P++ S +I +G Y P+F  S++++ ++ +    + E  +    +  +  +L+++E +D T   ++  S+++W I+PP  +K+ ++L+ P +   +      +R  T     E I     S  L    + ++  +I   +T+ ++T V +  I+P ++ A     S++NS    Q    N ++NI++ +  DN       WW +N  + G S   N  S A     L + +FN+++S    G + + YGI+G+YA+   V+ +F+R F+S IS+ I  EELPNVDRI KL  +I+LVRE  +L LEE L AKLIFLYRS ETMIKWT+ 
Sbjct: 2171 PIRQ---FFYDLIHPDYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHS-AAADITSSLSEDQVPGPFLVMVLIQFGTMVVDRALYLRKTVLGKVIFQVILVFGIHFWMFFILPGVTERKFSQNLVAQLWYFVKCVYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFILKCWRESEKRYPQPRGQKKKKAVKYGMGGMIIVLLICIVWFPLLFMSLIKSVAGVINQPLDVSVTITLGGYQPIFTMSAQQSQLKVMDNSKYNEFLKSFGPNSGAMQFLENYEREDVTVAELEGNSNSLWTISPPSKQKMIQELTDPNSCFSVVFSWSIQRNMTLGAKAE-IATDKLSFPLAVATRNSIAKMIAGNDTESSNTPVTIEKIYPYYVKA----PSDSNSKPIKQLLSENNFMNITIILFRDNVTKSNSEWWVLN--LTG-SRIFNQGSQA-----LELVVFNDKVSPPSLGFL-AGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPNVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTRE 2750          

HSP 2 Score: 377.867 bits (969), Expect = 1.675e-104
Identity = 340/1332 (25.53%), Postives = 599/1332 (44.97%), Query Frame = 1
Query:  850 VITGFAGIISPXXXXXXXXXXXXXXXTFWACGNNVMTSNFARMRLFLLLYSAAHVCLIFIVQLEFMQLYIPTGQRLSRLLGLYLMFDTNCKNRGEIIFNNQRS-IDYVSPFIILYVYYLSAIETRIWLEERKRINKERPAVDKETFIHTESYLSGEEINQEESQRISNSFNVEIGSN-------------VSDGPYIDFTDVPHVLDAQNSRSTLFIEEDITK-DM------------------------------EKNQVKERPL----LLSIINTMISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNLPELPTIFRISSSEMQSSEIGLHKSLIPTGPLAAMMSFLVVFWLTLRLFMTDEKINKSK---ICNEKISTQ-------------------------------------------------QKLEHYFGNVDNATYEKFVKCLKEKCENYWIFSCCFAMLFVSVNGSIVLFRIXXXXXXXXXXXXXXXSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIIQVRYFHSRFLELTSMK-----------------------------------QTQVCVESERERV-----KSSKDEMDK------------------NKFSVKNTVEFIRDVNNMVFTATEKLKSLYTLTQPSIWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSASIVILKMIYQIKIFQTFNWLTNCSQYGNFANSSMEI------------IDNAKWLGLEKLENFQLHILKWTAILVGCAVWHIVRYHQMQFYK-LNLDQKPKTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNV-LWLPYMIFLGILLPVQYVICVGLPPGLCIEYPL---------NVIPKLRQWLYLPNYKVSPVPGKILADFVQYIFVVLQYQVFQMEKRK-----KSDSHKLVKQRLLEGF-QKSIHKDFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCINPMSWEIRGIHGKNADKQCS--SVASGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLXXXXXXXXXXXXXXXXLNRIERKIKKIEQRQAQHGKPELNEHYLVMRSGD 4275
            ++ G +G++ PSL + VY   +LG+ T+W+         F  + + L +++A H+  +++ Q +F Q  +P     +RL G+  +  T+C +  +II N   S   + +P ++L +YY  A   RIWL+E        P V +E     E  L          +R S  +  +  ++              SDG  +     P  +D      +L IE    K D+                              E +Q ++R +    ++++   ++  S+I   +AMMAWS+ Y SW +F+ L+ SC LW+I + R   + +SP +V YA LL+++QYI+ F LPE+  +             G  +   P G LA+ + F + FWL LR  +T++K  + K   +   KI +Q                                                 Q +    GN+  A + K+           WI+ C     FVS  G IV+++I+YMVL ++ + ++ + Y +WR+ +K FW +V+ Y +  L+ IY +QF+      QN+TGL +E L D+GLK+F  ++L   +FIP  FL++ I+ + YFH RFLELT +K                                   + Q   ES  ER      K+ K E  K                      ++N    + D   ++F    K    +   Q  +W + E H  K +   I++V + +V   N + ++      P+ +L     +   V +  I++ KM+YQ++  +  N+  NCS   N   +++ +            +D  +W+GL K     ++ L+   +++    + +  Y   ++Y+  N    P +  IF ++      +   +  KY +N+ F K GLE  F+ +V V   R+D Y++++   L+  L  +R      +W  Y  FL  ++  QY +C+G+PP  C +YP          N+I    +WLY P++ V P P  ++ DF+  +   LQ Q+F+ E +        D+ ++        F Q +   DFI  + SY+D  K ++F + +W  L IIFITG   I++F +GYL+  F +L  G  +L+   KS++R  + ++ YN  VI  K I  +  C ++  L  +  CW++  F++ C       ++G      D +C   S  +G+ WD +CF F++LQR +F +  FL V  D+      +SRGA L    I+K+++ + + E+K +++++R++ +I+ RQ ++ K +     L   SG+
Sbjct:  229 ILLGSSGMMLPSLTSAVYFFVFLGLCTWWSWCRTFDPLLFGCLCVLLAIFTAGHLIGLYLYQFQFFQEAVPPNDYYARLFGIKSVIQTDCASTWKIIVNPDLSWYHHANPILLLVMYYTLATLIRIWLQE--------PLVQEEMAKEDEGALDCSSNQNTAERRRSLWYATQYPTDERKLLSMTQDDYKPSDGLLVTVNGNP--VDYHTIHPSLPIENGPAKTDLYTTPQYRWEPSEESSEKKEEEEDKREDSEGEGSQEEKRSVRMHAMVAVFQFIMKQSYICALIAMMAWSITYHSWLTFVLLIWSCTLWMIRNRRKYAMISSPFMVVYANLLLVLQYIWSFELPEIKKV------------PGFLEKKEP-GELASKILFTITFWLLLRQHLTEQKALREKEALLSEVKIGSQELEEKDEELQDVQVEGEPTEKEEEEEEEIKEERHEVKKEEEEEVEEDDDQDIMKVLGNLVVALFIKY-----------WIYVCGGMFFFVSFEGKIVMYKIIYMVLFLFCVALYQVHYEWWRKILKYFWMSVVIYTMLVLIFIYTYQFENFPGLWQNMTGLKKEKLEDLGLKQFTVAELFTRIFIPTSFLLVCILHLHYFHDRFLELTDLKSIPSKEDNTIYRLAHPEGSLPDLAIMNMTASLDKPEVQKLAESGEERPEECVKKTEKGEAGKDSDESEEEEDEEEESEEEESSDLRNKWHLVIDRLTVLFL---KFLEYFHKLQVFMWWILELHIIKIVSSYIIWVTVKEVSLFNYVFLISWAFALPYAKLRRAASSVCTVWTCVIIVCKMLYQLQTIKPENFSVNCS-LPNENQTNIPLHELNKSLLYSAPVDPTEWVGLRKSSPLLVY-LRNNLLMLAILAFEVTVYRHQEYYRGRNNLTAPVSKTIFHDITRLHLDDGLINCAKYFVNYFFYKFGLETCFLMSVNVIGQRMDFYAMIHACWLIGVLYRRRRKAIAEVWPKYCCFLACIITFQYFVCIGIPPAPCRDYPWRFKGAYFNDNII----KWLYFPDFIVRPNPVFLVYDFMLLLCASLQRQIFEDENKAAVRIMAGDNVEICMNLDAASFSQHNPVPDFIHCR-SYLDMSKVIIFSYLFWFVLTIIFITGTTRISIFCMGYLVACFYFLLFGGDLLLKPIKSILRYWDWLIAYNVFVITMKNILSIGACGYIGAL-VRNSCWLIQAFSLACT------VKGYQMPEDDSRCKLPSGEAGIIWDSICFAFLLLQRRVFMSYYFLHVVADIKASQILASRGAELFQATIVKAVKARIEEEKKSMDQLKRQMDRIKARQQKYKKGKERMLSLTQESGE 1509          

HSP 3 Score: 108.612 bits (270), Expect = 1.130e-22
Identity = 67/167 (40.12%), Postives = 97/167 (58.08%), Query Frame = 1
Query: 5197 EEKNKQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNV-LPVPEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLWRDHSEFYKDIKISNEEE 5694
            +E  + + F   + +F  L  +     +  SE  CYF++I+NH+ S ++++L  P L+F W MLSVPRPS+ FW++ I YTE+ IV KY  QF     N  L + + R  P   P I+G+EK   Y + D+IQLL LF HRS LK +GLW +      DI  SN ++
Sbjct: 1893 DELEESEKFYVDQPRFLLLFYAMYNTLVARSEMVCYFVIILNHMTSASIITLLLPILIFLWAMLSVPRPSRRFWMMAIVYTEVAIVVKYFFQFGFFPWNKDLEIYKER--PYFPPNIIGVEKKEGYVLYDLIQLLALFFHRSILKCHGLWDE-----DDIVDSNTDK 2052          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Mouse
Match: Piezo2 (piezo-type mechanosensitive ion channel component 2 [Source:MGI Symbol;Acc:MGI:1918781])

HSP 1 Score: 380.178 bits (975), Expect = 3.778e-105
Identity = 222/598 (37.12%), Postives = 356/598 (59.53%), Query Frame = 1
Query: 5758 PIKQLKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLI---NTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQNQ---NNTYLNISLSMKTDNAMM----WWEVNEIIQGQSYCPNPDSPAKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQH 7518
            PI+Q   F+  + +   +   DVY +MFL +    +II+ G+++FG  + +       +  ++ P PF+ M++ QF  +++DRAL+LRK V GK +FQ+  V  IH W+FF LP +T+RKF+     QL YF+KCVYF LS+YQ+R GYP R+LGNFLT++YNY NL  F+ +  +PFL ELR VMDW+WTD++++   W+ VEDI++ IF+LKCWR  E  +P  RG+ ++  VKY +G +I++     +W PL+  S I  +  V   P++ S +I +G Y P+F  S++++ ++ +    + E  +    +  +  +L+++E +D T   ++  S+++W I+PP  +K+ ++L+ P +   +      +R  T     E I     S  L    + ++  +I   +T+ ++T V +  I+P ++ A     S++NS    Q    N ++NI++ +  DN       WW +N  + G S   N  S A     L + +FN+++S    G + + YGI+G+YA+   V+ +F+R F+S IS+ I  EELPNVDRI KL  +I+LVRE  +L LEE L AKLIFLYRS ETMIKWT+ 
Sbjct: 2242 PIRQ---FFYDLIHPDYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHS-AAADITSSLSEDQVPGPFLVMVLIQFGTMVVDRALYLRKTVLGKVIFQVILVFGIHFWMFFILPGVTERKFSQNLVAQLWYFVKCVYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFILKCWRESEKRYPQPRGQKKKKAVKYGMGGMIIVLLICIVWFPLLFMSLIKSVAGVINQPLDVSVTITLGGYQPIFTMSAQQSQLKVMDNSKYNEFLKSFGPNSGAMQFLENYEREDVTVAELEGNSNSLWTISPPSKQKMIQELTDPNSCFSVVFSWSIQRNMTLGAKAE-IATDKLSFPLAVATRNSIAKMIAGNDTESSNTPVTIEKIYPYYVKA----PSDSNSKPIKQLLSENNFMNITIILFRDNVTKSNSEWWVLN--LTG-SRIFNQGSQA-----LELVVFNDKVSPPSLGFL-AGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPNVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTRE 2821          

HSP 2 Score: 202.601 bits (514), Expect = 3.456e-51
Identity = 158/591 (26.73%), Postives = 293/591 (49.58%), Query Frame = 1
Query: 2596 QPSIWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSASIVILKMIYQIKIFQTFNWLTNCSQYGNFANSSMEI------------IDNAKWLGLEKLENFQLHILKWTAILVGCAVWHIVRYHQMQFYK-LNLDQKPKTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNV-LWLPYMIFLGILLPVQYVICVGLPPGLCIEYPL---------NVIPKLRQWLYLPNYKVSPVPGKILADFVQYIFVVLQYQVFQMEKRKK-----SDSHKLVKQRLLEGF-QKSIHKDFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCINPMSWEIRGIHGKNADKQCS--SVASGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLXXXXXXXXXXXXXXXXLNRIERKIKKIEQRQAQHGKPELNEHYLVMRSGD 4275
            Q  +W + E H  K +   I++V + +V   N + ++      P+ +L     +   V +  I++ KM+YQ++  +  N+  NCS   N   +++ +            +D  +W+GL K     ++ L+   +++    + +  Y   ++Y+  N    P +  IF ++      +   +  KY +N+ F K GLE  F+ +V V   R+D Y++++   L+  L  +R      +W  Y  FL  ++  QY +C+G+PP  C +YP          N+I    +WLY P++ V P P  ++ DF+  +   LQ Q+F+ E +        D+ ++        F Q +   DFI  +S Y+D  K ++F + +W  L IIFITG   I++F +GYL+  F +L  G  +L+   KS++R  + ++ YN  VI  K I  +  C ++  L  +  CW++  F++ C       ++G      D +C   S  +G+ WD +CF F++LQR +F +  FL V  D+      +SRGA L    I+K+++ + + E+K +++++R++ +I+ RQ ++ K +     L   SG+
Sbjct:  948 QVFMWWILELHIIKIVSSYIIWVTVKEVSLFNYVFLISWAFALPYAKLRRAASSVCTVWTCVIIVCKMLYQLQTIKPENFSVNCS-LPNENQTNIPLHELNKSLLYSAPVDPTEWVGLRKSSPLLVY-LRNNLLMLAILAFEVTVYRHQEYYRGRNNLTAPVSKTIFHDITRLHLDDGLINCAKYFVNYFFYKFGLETCFLMSVNVIGQRMDFYAMIHACWLIGVLYRRRRKAIAEVWPKYCCFLACIITFQYFVCIGIPPAPCRDYPWRFKGAYFNDNII----KWLYFPDFIVRPNPVFLVYDFMLLLCASLQRQIFEDENKAAVRIMAGDNVEICMNLDAASFSQHNPVPDFIHCRS-YLDMSKVIIFSYLFWFVLTIIFITGTTRISIFCMGYLVACFYFLLFGGDLLLKPIKSILRYWDWLIAYNVFVITMKNILSIGACGYIGAL-VRNSCWLIQAFSLACT------VKGYQMPEDDSRCKLPSGEAGIIWDSICFAFLLLQRRVFMSYYFLHVVADIKASQILASRGAELFQATIVKAVKARIEEEKKSMDQLKRQMDRIKARQQKYKKGKERMLSLTQESGE 1524          

HSP 3 Score: 123.25 bits (308), Expect = 4.427e-27
Identity = 105/405 (25.93%), Postives = 183/405 (45.19%), Query Frame = 1
Query:  850 VITGFAGIISPXXXXXXXXXXXXXXXTFWACGNNVMTSNFARMRLFLLLYSAAHVCLIFIVQLEFMQLYIPTGQRLSRLLGLYLMFDTNCKNRGEIIFNNQRS-IDYVSPFIILYVYYLSAIETRIWLEERKRINKERPAVDKETFIHTESYLSGEEINQEESQRISNSFNVEIGSN-------------VSDGPYIDFTDVPHVLDAQNSRSTLFIEEDITK-DM------------------------------EKNQVKERPL----LLSIINTMISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNLPELPTIFRISSSEMQSSEIGLHKSLIPTGPLAAMMSFLVVFWLTLRLFMTDEKINKSK 1917
            ++ G +G++ PSL + VY   +LG+ T+W+         F  + + L +++A H+  +++ Q +F Q  +P     +RL G+  +  T+C +  +II N   S   + +P ++L +YY  A   RIWL+E        P V +E     E  L          +R S  +  +  ++              SDG  +     P  +D      +L IE    K D+                              E +Q ++R +    ++++   ++  S+I   +AMMAWS+ Y SW +F+ L+ SC LW+I + R   + +SP +V YA LL+++QYI+ F LPE+  +             G  +   P G LA+ + F + FWL LR  +T++K  + K
Sbjct:  229 ILLGSSGMMLPSLTSAVYFFVFLGLCTWWSWCRTFDPLLFGCLCVLLAIFTAGHLIGLYLYQFQFFQEAVPPNDYYARLFGIKSVIQTDCASTWKIIVNPDLSWYHHANPILLLVMYYTLATLIRIWLQE--------PLVQEEMAKEDEGALDCSSNQNTAERRRSLWYATQYPTDERKLLSMTQDDYKPSDGLLVTVNGNP--VDYHTIHPSLPIENGPAKTDLYTTPQYRWEPSEESSEKKEEEEDKREDSEGEGSQEEKRSVRMHAMVAVFQFIMKQSYICALIAMMAWSITYHSWLTFVLLIWSCTLWMIRNRRKYAMISSPFMVVYANLLLVLQYIWSFELPEIKKV------------PGFLEKKEP-GELASKILFTITFWLLLRQHLTEQKALREK 610          

HSP 4 Score: 111.309 bits (277), Expect = 1.661e-23
Identity = 57/135 (42.22%), Postives = 89/135 (65.93%), Query Frame = 1
Query: 2026 NYWIFSCCFAMLFVSVNGSIVLFRIXXXXXXXXXXXXXXXSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIIQVRYFHSRFLELTSMK 2430
             YWI+ C     FVS  G IV+++I+YMVL ++ + ++ + Y +WR+ +K FW +V+ Y +  L+ IY +QF+      QN+TGL +E L D+GLK+F  ++L   +FIP  FL++ I+ + YFH RFLELT +K
Sbjct:  689 KYWIYVCGGMFFFVSFEGKIVMYKIIYMVLFLFCVALYQVHYEWWRKILKYFWMSVVIYTMLVLIFIYTYQFENFPGLWQNMTGLKKEKLEDLGLKQFTVAELFTRIFIPTSFLLVCILHLHYFHDRFLELTDLK 823          

HSP 5 Score: 108.612 bits (270), Expect = 1.155e-22
Identity = 67/167 (40.12%), Postives = 97/167 (58.08%), Query Frame = 1
Query: 5197 EEKNKQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNV-LPVPEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLWRDHSEFYKDIKISNEEE 5694
            +E  + + F   + +F  L  +     +  SE  CYF++I+NH+ S ++++L  P L+F W MLSVPRPS+ FW++ I YTE+ IV KY  QF     N  L + + R  P   P I+G+EK   Y + D+IQLL LF HRS LK +GLW +      DI  SN ++
Sbjct: 1964 DELEESEKFYVDQPRFLLLFYAMYNTLVARSEMVCYFVIILNHMTSASIITLLLPILIFLWAMLSVPRPSRRFWMMAIVYTEVAIVVKYFFQFGFFPWNKDLEIYKER--PYFPPNIIGVEKKEGYVLYDLIQLLALFFHRSILKCHGLWDE-----DDIVDSNTDK 2123          
BLAST of Piezo-type mechanosensitive ion channel component vs. UniProt/SwissProt
Match: sp|Q92508|PIEZ1_HUMAN (Piezo-type mechanosensitive ion channel component 1 OS=Homo sapiens OX=9606 GN=PIEZO1 PE=1 SV=4)

HSP 1 Score: 415.231 bits (1066), Expect = 3.015e-115
Identity = 331/1217 (27.20%), Postives = 584/1217 (47.99%), Query Frame = 1
Query:  811 HWATQSLFAFFNIVITGFAGIISPXXXXXXXXXXXXXXXTFWACGNNVMTSNFARMRLFLLLYSAAHVCLIFIVQLEFMQLYIPTGQRLSRLLGLY-LMFDTNCKNRGEIIFNNQRSID---YVSPFIILYVYYLSAIETRIWLEERKRINKERPAVDKETFI--HTESYLSGEEINQEESQRISNSFNVEIGSNVSDGPYIDFTDVPHVLDAQNSRSTLFIEEDITKDMEKNQVKERPLLLSIINTMISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNL-PELPTIFRISSSEMQSSEIGLHKSLIPTGPLAAMMSFLVVFWLTLRLFMTDE---------KINKSKICNEKISTQQKLEHYFGNVDNATYEKFVKCLKEKCENYWIFSCCFAMLFVSVNGSIVLFRIXXXXXXXXXXXXXXXSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIIQVRYFHSRFLELTSMKQ-----TQVCVESERERVKS-------------------------SKDE-----MDKNKFSVKNTVEFIRDVNNMVFTATEKLKSLYTLTQPSIWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSASIVILKMIYQIKIFQTFNWLTNCSQYGNFANSS----MEI---------IDNAKWLGLEK----LENFQLHILKWTAILVGCAVWHIVRYHQMQFYKLNLDQKP-KTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRID-VYSXXXXXXXXXXXXXXXXXCNVLWLPYMIFLGILLPVQYVICVGLPPGLCIEYPLN---VIP---KLRQWLYLPNYKVSPVPGKILADFVQYIFVVLQYQVFQMEKRKKSDSHKLVKQRLLEGFQKSIHK--DFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCINPMSWEIRGIHGKNADKQCSSVASGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLXXXXXXXXXXXXXXXXLNRIERKIKKIEQRQAQH 4227
            HW   +      + +   AGI  PS L+ VYLL +L + T+WAC   + T  F+R+ + +  + A H+  ++  Q+   Q  +P     +R+LGL   +  TNC +   ++ N    +D   Y SP ++L + Y +A          +++   RP+  ++     +    L   E++Q   +R S+   V    +           + H L  Q+S     +   +    ++ + +E   L S+ + ++  S++   +AMM WS+ Y SW +F+ LL +C +W +     + +  SP I+ Y   L  ++Y++  +L PELPT        +   ++GL  +  P   L AM+ + + FWL LR F+ ++          + +  + + + +  Q L    G +    Y K           YWI+ C    + VS  G +V+++IVYM L +  L +F + YS WR+ +K FWW V+ Y +  L+++Y FQFQ      +N+TG ++E L D+GL++F  S+L  S+ +P  FL+  I+Q+ YFH  F++LT M+      T++   + R+   S                         S+DE            V         V   +         + +  Q  + RL E H  K + +  V+V + +V  MN++L+++     P+PR   +      V +  I++ KM+YQ+K+     + +NC++   F NS+     EI         +D A W G+ K    L   Q H+     +L+   V+  + Y + + Y+      P     +F         ++    LKY +NF F K GLE+ F+  V V   R++ + +L    ++ +     R     LW  Y +FL + L  QY++C+G+PP LCI+YP      +P    L +WLYLP++  +P    +++DF+  +    Q+QVF  E+ ++      V    LE  +   +   +FI  +S Y+D LK  VF + +WL L ++F+TG   I++FGLGYLL  F  L  G  +L    ++ +   + ++ YN  VI++K +  L+ CVF+  ++T G CW++ LF++ C     ++ + +  ++ D       +G+ WD VCFFF++LQR +F +  +L V+ DL      +SRG  L N   +KSI+  ++ EEK L +++R++++I  +Q +H
Sbjct:  193 HWLLVAAGRVLAVTLLALAGIAHPSALSSVYLLLFLALCTWWACHFPISTRGFSRLCVAVGCFGAGHLICLYCYQMPLAQALLPPAGIWARVLGLKDFVGPTNCSSPHALVLNT--GLDWPVYASPGVLLLLCYATA--------SLRKLRAYRPSGQRKEAAKGYEARELELAELDQWPQERESDQHVVPTAPDTEAD-----NCIVHELTGQSS----VLRRPVRP--KRAEPREASPLHSLGHLIMDQSYVCALIAMMVWSITYHSWLTFVLLLWACLIWTVRSRHQLAMLCSPCILLYGMTLCCLRYVWAMDLRPELPTTL----GPVSLRQLGLEHTRYPCLDLGAMLLYTLTFWLLLRQFVKEKLLKWAESPAALTEVTVADTEPTRTQTLLQSLGELVKGVYAK-----------YWIYVCAGMFIVVSFAGRLVVYKIVYMFLFLLCLTLFQVYYSLWRKLLKAFWWLVVAYTMLVLIAVYTFQFQDFPAYWRNLTGFTDEQLGDLGLEQFSVSELFSSILVPGFFLLACILQLHYFHRPFMQLTDMEHVSLPGTRLPRWAHRQDAVSGTPLLREEQQEHQQQQQEEEEEEEDSRDEGLGVATPHQATQVPEGAAKWGLVAERLLELAAGFSDVLSRVQVFLRRLLELHVFKLVALYTVWVALKEVSVMNLLLVVLWAFALPYPRFRPMASCLSTVWTCVIIVCKMLYQLKVVNPQEYSSNCTE--PFPNSTNLLPTEISQSLLYRGPVDPANWFGVRKGFPNLGYIQNHL---QVLLL--LVFEAIVYRRQEHYRRQHQLAPLPAQAVFASGTRQQLDQDLLGCLKYFINFFFYKFGLEICFLMAVNVIGQRMNFLVTLHGCWLVAILTRRHRQAIARLWPNYCLFLALFLLYQYLLCLGMPPALCIDYPWRWSRAVPMNSALIKWLYLPDFFRAPNSTNLISDFLLLLCASQQWQVFSAERTEEWQRMAGVNTDRLEPLRGEPNPVPNFIHCRS-YLDMLKVAVFRYLFWLVLVVVFVTGATRISIFGLGYLLACFYLLLFGTALLQRDTRARLVLWDCLILYNVTVIISKNMLSLLACVFVEQMQT-GFCWVIQLFSLVCTVKGYYDPKEMMDRDQDCLLPVEEAGIIWDSVCFFFLLLQRRVFLSHYYLHVRADLQATALLASRGFALYNAANLKSIDFHRRIEEKSLAQLKRQMERIRAKQEKH 1364          

HSP 2 Score: 348.977 bits (894), Expect = 7.227e-95
Identity = 217/599 (36.23%), Postives = 349/599 (58.26%), Query Frame = 1
Query: 5764 KQLKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKI----NMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQ---NQNNTYLNISLSMKTDNA------MMWWEVNEIIQGQSYCPNPDSPAKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQH 7518
            + L++F+  + + K     DVYA+MFL +    +III G+++FG  + +       +  ++ P  F+ M++ QF  +++DRAL+LRK V GK  FQ+  V+ IH W+FF LP +T+R FN     QL YF+KC+YFALS+YQ+R GYP RILGNFLT+ YN+ NL  F+ +  +PFL ELR VMDW+WTD++++   WM VEDI++ IF++KC R  E  +P  +G+ ++ +VKY +G LI++F    IW PL+  S +  +  V   PI+ + ++ +G Y PLF  S+++ ++ P T + +EE+         +  ++  + P+D     I+ +S  +W I+PP   ++K +L    A + +    N Q    +  T   + EK +           + A+LL   + +    +V +P +FP+++ A      EAN + Q   N+   YL + + ++ +        + WW V E+ + ++ C            L + IF++++S    G + + YGI+G+Y +   V+ +F+R F+S IS+ I  EELP VDRI KL  +I+LVRE ++L LEE+L AKLIFLYRS ETMIKWT+ 
Sbjct: 1940 RPLRRFFHDILHTKYRAATDVYALMFLADVVDFIIIIFGFWAFGKHS-AATDITSSLSDDQVPEAFLVMLLIQFSTMVVDRALYLRKTVLGKLAFQVALVLAIHLWMFFILPAVTERMFNQNVVAQLWYFVKCIYFALSAYQIRCGYPTRILGNFLTKKYNHLNLFLFQGFRLVPFLVELRAVMDWVWTDTTLSLSSWMCVEDIYANIFIIKCSRETEKKYPQPKGQKKKKIVKYGMGGLIILFLIAIIWFPLLFMSLVRSVVGVVNQPIDVTVTLKLGGYEPLFTMSAQQPSIIPFTAQAYEELSRQFDPQPLAMQFISQYSPEDIVTAQIEGSSGALWRISPPSRAQMKRELYNGTADITLRFTWNFQRDLAKGGTVEYANEKHMLALAPNSTARRQLASLLEGTSDQ----SVVIPNLFPKYIRAPNG--PEANPVKQLQPNEEADYLGVRIQLRREQGAGATGFLEWW-VIELQECRTDCN----------LLPMVIFSDKVSPPSLGFL-AGYGIMGLYVSIVLVIGKFVRGFFSEISHSIMFEELPCVDRILKLCQDIFLVRETRELELEEELYAKLIFLYRSPETMIKWTRE 2519          

HSP 3 Score: 113.62 bits (283), Expect = 2.581e-23
Identity = 62/146 (42.47%), Postives = 87/146 (59.59%), Query Frame = 1
Query: 5230 SRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLN---VLPVPEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLWRDHSE 5658
             + +   LL +  +    +SE  CYF++I+NH+++ +  SL  P LVF W MLS+PRPSK FW+  I +TE+ +V KY+ QF     N   VL   E++  P   P ILG+EK+  Y   D++QL+ LF HRS L   GLW DH E
Sbjct: 1668 GQGRALRLLRAVYQCVAAHSELLCYFIIILNHMVTASAGSLVLPVLVFLWAMLSIPRPSKRFWMTAIVFTEIAVVVKYLFQFGFFPWNSHVVLRRYENK--PYFPPRILGLEKTDGYIKYDLVQLMALFFHRSQLLCYGLW-DHEE 1810          
BLAST of Piezo-type mechanosensitive ion channel component vs. UniProt/SwissProt
Match: sp|M9MSG8|PIEZO_DROME (Piezo-type mechanosensitive ion channel component OS=Drosophila melanogaster OX=7227 GN=Piezo PE=2 SV=1)

HSP 1 Score: 401.749 bits (1031), Expect = 5.229e-111
Identity = 264/830 (31.81%), Postives = 433/830 (52.17%), Query Frame = 1
Query: 5209 KQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLPVPEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLW--------------------RDHSEFYK--DIKISNEEEVNHIQPLKPQSAMRTGIKF-RNPIKQLK---------KFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPG-TDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPE-KANLLHLI-----------NTKFNSTN------VYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAM--MWWEVNEIIQGQSYCPNP--DSPAKKYLF------LTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQ 7515
            +++  +R       +LIS     +  ++  CY ++ +N +++ +L+SLP P +VF WG LS+PRP+K FW+ LI YT+ +++ K I QF LI  N   +P     PL    I G+E    YAI D+I LL LFLHR  LK  GLW                    RD S+     D +  N++    +     Q+++    +F +  I QL+         KF+  + ++      DVYA+MFLC+F    +++ G+ +FG   T+S      ++  NK P+PF+ M++ QF+ I+IDRAL+LRK +  K +F  F VI IH W+FF +P +T+R FNS  PP + Y IKC Y  LSSYQ++SGYP RILGNF T+ ++  N+I FK+YM IPFLYELR ++DW+  DS++  + W+++EDIFS I++++C R  ET +P  R + +  + K  +G  I++    CIWGPL + +          P   S SI +G Y P++  ++  +++  +  + + +M   +     +  ++  ++  D   + +   S ++W I PP  ++L   L     +LK        R +      E +          + E +A L+H++           N   N T       V +P + P+F+       +   S+   ++  Y  + + M  DN    +WWE+ +      YC +   +    K+ +      + ++ FN++   + F  + ++ GI+G+Y  +  +  RF+++F    +  I  E+LP VDR+ +L  +IYLVRE  +  LEE L AKL+FLYRS ET+IKWT+
Sbjct: 1702 EENFAQRDHHIIVEVLISSWYALLANTDLICYIVVFINQVVNASLISLPLPIMVFLWGTLSLPRPTKTFWVTLIAYTQAIVLIKCIFQFKLIWSNYHQLPNQ---PLTPAKIFGVENKAHYAIYDLILLLVLFLHRYLLKSQGLWKSGYKDTDNQFTKPTASIDERDDSDNLSQPDSRQLNDDAAQKLSLQVSQASLPGSPEFSKTGINQLERTKYTSSLYKFFFSLVHKS-RLATDVYALMFLCDFVNFFVLLFGFTAFGTQQTESDEGVQTYLAENKVPIPFLIMLLVQFLLIVIDRALYLRKALVNKIIFHFFSVIGIHIWMFFVVPAVTERTFNSLAPPIIFYVIKCFYMLLSSYQIKSGYPKRILGNFFTKGFSMVNMIAFKVYMQIPFLYELRTILDWVCIDSTMTIFDWLKMEDIFSNIYLIRCTRQSETDFPAMRAQKKASLSKLIMGGTIVLLIVICIWGPLCLFALGNAVGTSNVPFHVSLSIRIGPYDPIYT-TNNYDSIFEINPEMYSQMTNAYIKEKQALTFIAGYDATDVAAVRLAGNSPSLWNIAPPDRQRLLNDLR-NNHTLKARFSYSLTRKAPAKGLKENVGDEHAISLDESFEGRAALIHMLSETHDVEPIYSNGTTNGTTPEVEEVVVIPGMIPKFIKVLNSGDAAVVSVLSPKHYDYRPLVIKMHRDNETNGLWWEIRD------YCNDTFYNETLSKFAYSNCTSGIVMYTFNDKKFPSTFSFL-TAGGIIGLYTTFVLLASRFMKSFIGGQNRKIMFEDLPYVDRVLQLCLDIYLVREALEFALEEDLFAKLLFLYRSPETLIKWTR 2518          

HSP 2 Score: 360.918 bits (925), Expect = 1.338e-98
Identity = 345/1237 (27.89%), Postives = 580/1237 (46.89%), Query Frame = 1
Query:  862 FAGIISPXXXXXXXXXXXXXXXTFWACGNNVMTSNFARMRLFLLLYSAAHVCLIFIVQLEFMQLYIPTGQRLSRLLGLYLMFDTNCKNRGEI-IFNNQRSID-YVSPFIILYVYYLSAIETRIWLEERKRINKERPAVDKETFIHTESYLSGEEINQEESQRISNSFNVEIGSNVSDGPYIDFTDVPHVLDAQNSRSTLFIEEDITKDMEKNQVKERPLLLSIINTMISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNL--PELPTIFRISSSEMQSSEIGLHK----SLIPTGPLAAMMSFLVVFWLTLRLFMTDEKINKSK------ICNEKISTQQKLEHYFGNVDNATYEKFVKCLKEKCEN----YWIFSCCFAMLFVSVNG-SIVLFRIXXXXXXXXXXXXXXXSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIIQVRYFHSRFLELTSMKQTQVCVESERERVKSS------------------KDEMDKNKFSVKNTVEFIRDVNNMVFTATEKLKS----LYTLTQPSIWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSASIVIL-KMIYQIKIFQTFNWLTNCSQYGNFANSSMEIIDNAKWLGLEKLENFQ---LHILKWTAILVGCAVWH-IVRYHQMQF-YKLNLDQKPKTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNVLWLPYMIFLGILLPVQYVICVGLPPGLCIEYPLNVIP---KLRQWLYLPN-YKVSPVPGKILADFVQYIFVVLQYQVFQMEKRKKSD------SHKLVKQRLLE----GFQKSIHKDFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCIN---------PMSWEIRGIHGKNADKQCSSVASG--LHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLXXXXXXXXXXXXXXXXLNRIERKIKKIEQRQA-------------QHGKP----------ELNEHYLVMRSGDYYLF 4287
            FA ++ PS+    Y L +L  GT+WA     +   FA +   +++    H   I   Q  +MQ ++      +RL+GL  + ++ C     + ++NN+ S+D Y++PF + + Y+  A+ T+  ++ R      R A   +         SG  +    +QR         G+++              L++   RS    E++ T     +Q+      +S+   +  NS+I T + MMAWS+ Y SW +F+ LL +  LW+IP+ R   + +SP IV YA  L++ QYIYG +L   ELPT   + ++ +   +IG  +     + P  PL    +F+++FW+T R F  +++  +        I   +I+       Y  N D     KF+K   +  +N     WI+     +   ++ G ++  FRI YM L ++FLLVF  S   W + M  FW  +I Y +  L+ IY +QF +      +   +S  + +DIGLKR+Q  DL   L  P I +++ +IQV YFH RF  + S++Q  +   S +++   +                  K +    + +   T +F   V ++V  +  K+K+    ++   +   WR  E H  K + I      + +V  ++II +   V+G    +   V+++ L     ++++L KMIYQI+      +L++ SQ+ N   S     +NA+W+GL K +      + +L+   I +     H ++   Q+Q   K+     P T ++F  +    + ++   L+KY LNFGF K G+E+S I  V     R D+ ++VY L L++ L+L+R  C  +W  +  F  I +  QY++ VGLPP  C+ +P +  P    +++W  LP     + VP K++ DF+  + +  Q  +F +E+R  S+      S++ V   + +     F    H DF S   +Y D LK+ V    YW TLA++F+ G     L  LGYL+ AFI+LW G    +    ++I     +L +N   IL K  FQ+ GC+FM  L TK  CW+V +  I C +         P   E+    G     +C  +     L WD +CF FII Q  IF +  F  +  D    N  +SRGA +I     K I  +   E++ L++I+RK+++I   Q              +HG P          E+  H    R+GDYY+F
Sbjct:  223 FAAVLRPSVPGGFYFLIFLLSGTYWATCQT-LQRGFALLLRCVMVVLVLHSLSIVSYQTPWMQSHLNHTTLTARLIGLEPLIESYCSPDIRVFLYNNKLSLDSYLNPFALFFAYFALALTTKHLIKPRLVRQSTRKARTPQPL------ESGSSVAPSVTQR---------GNDMQ-------------LESMEQRS----EQENTTTSILDQISYG--FVSVGGFIYQNSYIFTNILMMAWSIVYHSWLTFVLLLSANVLWMIPNQRKAMMRSSPFIVLYAEALLIAQYIYGMDLNNEELPT--SVPTAGINLQQIGFERPIENQMRPCVPLIVKTAFVLMFWVTSRQFFKEKRDRRRDSTLADFIAPLQITVGSAGSSYLIN-DGKKTSKFLKKAGDVIKNLLVRLWIWLLVLVIFLCAITGENMTGFRICYMALFLFFLLVFQSSSKAWVKIMYGFWLFLIFYAMSILILIYTYQFDKFDTYWSDYLNVSATLQKDIGLKRYQTKDLFLHLVSPTIIVILTVIQVHYFHKRF--IASLQQQPLAGGSAQQKPTETTALEPAPSKRRGSAGSLRKSQGPSAEAAPGATTDFETSVRDLVRISFRKIKNKSEYIFKNFKDVFWRFLELHIMKAVYIAAFVCSVSEVCVLHIIFVGFCVLGATSRKAVQVVISRLISFIVTVIVLSKMIYQIE------YLSH-SQH-NVVCSDNRTANNAEWIGLTKADKVTGGLMSLLRTYIIYMVIVTMHAVISLRQLQMRVKIGALNAPPTKLLFPNIIRADAEKDLVGLVKYLLNFGFYKFGIEISLIALVSTITYRQDIVAVVYALWLVVLLLLRRSQCAKIWGVFQAFFAISILTQYIVLVGLPPSSCLVFPWDEGPFGEGIQRWAMLPGALHFNHVP-KLIFDFIVLVILNRQKSIFCIEQRYASNDDYPGGSNRSVIADIAQLGRVPFDNPTH-DFCSYIRNYSDILKNGVLCGFYWFTLAVVFLAGTNIADLLALGYLIGAFIFLWQGSDFYLRPIHTIIFRWKWLLAFNVANILIKTSFQMAGCLFMTQL-TKDCCWLVHMLGITCTSNVLTEQIMLPEEAELALKPG-----ECPKITHQVVLLWDTICFAFIIFQLRIFKSHYFCHIITDTKANNILASRGADIIESLRHKQIAHRHDHEKQVLHKIKRKMERIRATQQKMLRPLDKQTHFDEHGYPLPAPTVRRRKEIKLHPHATRAGDYYMF 1403          
BLAST of Piezo-type mechanosensitive ion channel component vs. UniProt/SwissProt
Match: sp|E2JF22|PIEZ1_MOUSE (Piezo-type mechanosensitive ion channel component 1 OS=Mus musculus OX=10090 GN=Piezo1 PE=1 SV=1)

HSP 1 Score: 400.979 bits (1029), Expect = 8.314e-111
Identity = 343/1246 (27.53%), Postives = 593/1246 (47.59%), Query Frame = 1
Query:  811 HWATQSLFAFFNIVITGFAGIISPXXXXXXXXXXXXXXXTFWACGNNVMTSNFARMRLFLLLYSAAHVCLIFIVQLEFMQLYIPTGQRLSRLLGLYLMFD-TNCKNRGEIIFNNQRSID-YVSPFIILYVYYLSAIETRIWLEERKRINKERPAVDKETFIHTESYLSGEEINQEESQRISNSFNVEIGSNVSDGPYIDFTDVPHVLDAQNSRSTLFIEEDITKDMEKNQVKERPLLLSIINTMISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNLPELPTIFRISSSEMQSSEIGLHKSLIPTGPLAAMMSFLVVFWLTLRLFMTDEKINKSKICNEKISTQQKLEHYFGNVDNATYEKFVKCLKEKCEN----YWIFSCCFAMLFVSVNGSIVLFRIXXXXXXXXXXXXXXXSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIIQVRYFHSRFLELTSMKQT-------------QVCV--------ESERERVKSSKDEMDKNKFSVK---NTVEFIRDVNNMVFTATEKLKSLYTLTQPSIWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSASIVILKMIYQIKIFQTFNWLTNCSQ-YGNFAN-SSMEI---------IDNAKWLGLEKLENFQLHILKWTAILVGCAVWHIVRYHQMQFYKLNLDQKP-KTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNV-LWLPYMIFLGILLPVQYVICVGLPPGLCIEYPL---NVIP---KLRQWLYLPNYKVSPVPGKILADFVQYIFVVLQYQVFQMEKRKKSDSHKLVKQRLLEGFQKSIH--KDFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCINPMSWEIRGIHGKNADKQCSSVASGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLXXXXXXXXXXXXXXXXLNRIERKIKKIEQ-----RQAQHGKPELN-------------------------------EHYLVMRSGDYYLF 4287
            HW   +      IV+   AGI  PS  + +YL+ +L + T+W+C   +    F  + + +  + A H+  ++  Q  F+Q  +P G   +RL GL    D  N  +   ++ N + +   YVSP I+L +YY +    ++       + KE P  D+E  +  +          E   R +    + + +     P +D   V HVL +Q+      +   +       ++KE   L  + + ++  S++   +AMM WS+ Y SW +F+ LL +C +W +     + +  SP I+ Y   L  ++Y++   LPELPT        +   ++GL  +  P   L AM+ +L+ FWL LR F+ ++ + K K+          LE    + +    +  ++ L E        YWI+ C    + VS  G +V+++IVYM L +  L +F + Y+ WR+ ++VFWW V+ Y +  L+++Y FQFQ      +N+TG ++E L D+GL++F  S+L  S+ IP  FL+  I+Q+ YFH  F++LT ++               Q  V        + E E  +     MD    + +    T      V + +        ++ T  Q  + RL E H  K + +  V+V + +V  MN++L+++     P+PR   +      V +  I++ KM+YQ+KI     + +NC++ + N  N   +EI         +D A W G+ K      +I     IL+   V+  V Y + + Y+    Q P     +  +       ++    LKY +NF F K GLE+ F+  V V   R++   +++   L+  L  +R      LW  Y +FL + L  QY++C+G+PP LCI+YP      IP    L +WLYLP++  +P    +++DF+  +    Q+QVF  E+ ++      +    LE  +   +   +FI  + SY+D LK  VF + +WL L ++F+ G   I++FGLGYLL  F  L  G  +L    ++ +   + ++ YN  VI++K +  L+ CVF+  +++   CW++ LF++ C     ++ + +  ++ D       +G+ WD +CFFF++LQR IF +  FL V  DL      +SRG  L N   +KSI   ++ EEK L +++R++K+I       RQ+Q  + +L                                +H  V+ SGDY+LF
Sbjct:  200 HWLLMTSGRTLVIVLLALAGIAHPSAFSSIYLVVFLAICTWWSCHFPLSPLGFNTLCVMVSCFGAGHLICLYCYQTPFIQDMLPPGNIWARLFGLKNFVDLPNYSSPNALVLNTKHAWPIYVSPGILLLLYYTATSLLKLHKSCPSELRKETPREDEEHELELDHLEP------EPQARDATQGEMPMTTE----PDLDNCTV-HVLTSQSPVRQRPVRPRLA------ELKEMSPLHGLGHLIMDQSYVCALIAMMVWSIMYHSWLTFVLLLWACLIWTVRSRHQLAMLCSPCILLYGLTLCCLRYVWAMELPELPTTL----GPVSLHQLGLEHTRYPCLDLGAMLLYLLTFWLLLRQFVKEKLLKKQKV------PAALLEVTVADTEPTQTQTLLRSLGELVTGIYVKYWIYVCAGMFIVVSFAGRLVVYKIVYMFLFLLCLTLFQVYYTLWRKLLRVFWWLVVAYTMLVLIAVYTFQFQDFPTYWRNLTGFTDEQLGDLGLEQFSVSELFSSILIPGFFLLACILQLHYFHRPFMQLTDLEHVPPPGTRHPRWAHRQDAVSEAPLLEHQEEEEVFREDGQSMDGPHQATQVPEGTASKWGLVADRLLDLAASFSAVLTRIQVFVRRLLELHVFKLVALYTVWVALKEVSVMNLLLVVLWAFALPYPRFRPMASCLSTVWTCIIIVCKMLYQLKIVNPHEYSSNCTEPFPNNTNLQPLEINQSLLYRGPVDPANWFGVRKGYPNLGYIQNHLQILL-LLVFEAVVYRRQEHYRRQHQQAPLPAQAVCADGTRQRLDQDLLSCLKYFINFFFYKFGLEICFLMAVNVIGQRMNFMVILHGCWLVAILTRRRREAIARLWPNYCLFLTLFLLYQYLLCLGMPPALCIDYPWRWSKAIPMNSALIKWLYLPDFFRAPNSTNLISDFLLLLCASQQWQVFSAERTEEWQRMAGINTDHLEPLRGEPNPIPNFIHCR-SYLDMLKVAVFRYLFWLVLVVVFVAGATRISIFGLGYLLACFYLLLFGTTLLQKDTRAQLVLWDCLILYNVTVIISKNMLSLLSCVFVEQMQSN-FCWVIQLFSLVCTVKGYYDPKEMMTRDRDCLLPVEEAGIIWDSICFFFLLLQRRIFLSHYFLHVSADLKATALQASRGFALYNAANLKSINFHRQIEEKSLAQLKRQMKRIRAKQEKYRQSQASRGQLQSKDPQDPSQEPGPDSPGGSSPPRRQWWRPWLDHATVIHSGDYFLF 1415          

HSP 2 Score: 334.724 bits (857), Expect = 1.642e-90
Identity = 220/608 (36.18%), Postives = 354/608 (58.22%), Query Frame = 1
Query: 5764 KQLKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKI----NMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQ---NQNNTYLNISLSM----------------KTDNAMMWWEVNEIIQGQSYCPNPDSPAKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQ 7515
            + L++F+  + + K     DVYA+MFL +   ++III G+++FG  + +   A   +  ++ P  F+ M++ QF  ++IDRAL+LRK V GK  FQ+  V+ IH W+FF LP +T+R F+     QL YF+KC+YFALS+YQ+R GYP RILGNFLT+ YN+ NL  F+ +  +PFL ELR VMDW+WTD++++  +WM VEDI++ IF++KC R  E  +P  +G+ ++ +VKY +G LI++F    IW PL+  S I  +  V   PI+ + ++ +G Y PLF  S+++ ++ P T + +EE+ +    +  +  ++  + P+D     I+ +S  +W I+PP   ++K++L    A + +    N Q    +  T   + EK    T      +  +  L  L+  + + + V +P +FP+++ A      EAN + Q   ++   YL + + +                K  + + WW V E+   ++ C            L + IF++++S    G + + YGI+G+Y +   VV +F+R F+S IS+ I  EELP VDRI KL  +I+LVRE ++L LEE+L AKLIFLYRS ETMIKWT+
Sbjct: 1956 QPLQRFFHDILHTKYRAATDVYALMFLADIVDIIIIIFGFWAFGKHSAATDIASS-LSDDQVPQAFLFMLLVQFGTMVIDRALYLRKTVLGKLAFQVVLVVAIHIWMFFILPAVTERMFSQNAVAQLWYFVKCIYFALSAYQIRCGYPTRILGNFLTKKYNHLNLFLFQGFRLVPFLVELRAVMDWVWTDTTLSLSNWMCVEDIYANIFIIKCSRETEKKYPQPKGQKKKKIVKYGMGGLIILFLIAIIWFPLLFMSLIRSVVGVVNQPIDVTVTLKLGGYEPLFTMSAQQPSIVPFTPQAYEELSQQFDPYPLAMQFISQYSPEDIVTAQIEGSSGALWRISPPSRAQMKQELYNGTADITLRFTWNFQRDLAKGGTVEYTNEK---HTLELAPNSTARRQLAQLLEGRPDQS-VVIPHLFPKYIRAPNG--PEANPVKQLQPDEEEDYLGVRIQLRREQVGTGASGEQAGTKASDFLEWW-VIELQDCKADCN----------LLPMVIFSDKVSPPSLGFL-AGYGIVGLYVSIVLVVGKFVRGFFSEISHSIMFEELPCVDRILKLCQDIFLVRETRELELEEELYAKLIFLYRSPETMIKWTR 2544          

HSP 3 Score: 116.316 bits (290), Expect = 3.974e-24
Identity = 68/191 (35.60%), Postives = 100/191 (52.36%), Query Frame = 1
Query: 5200 EKNKQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLPV-PEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLWRDHSEFY---------KDIKISNEEEVNHIQPLKPQSAMRTG 5742
            E  + + F   + +   LL +  +    +SE  CYF++I+NH+++ +  SL  P LVF W ML++PRPSK FW+  I +TE+++V KY+ QF     N   V   +   P   P ILG+EK+ +Y   D++QL+ LF HRS L   GLW    + Y         KD +   E E      L+ QS   TG
Sbjct: 1658 ELEEAERFEAQQGRTLRLLRAGYQCVAAHSELLCYFIIILNHMVTASAASLVLPVLVFLWAMLTIPRPSKRFWMTAIVFTEVMVVTKYLFQFGFFPWNSYVVLRRYENKPYFPPRILGLEKTDSYIKYDLVQLMALFFHRSQLLCYGLWDHEEDRYPKDHCRSSVKDREAKEEPEAK----LESQSETGTG 1844          
BLAST of Piezo-type mechanosensitive ion channel component vs. UniProt/SwissProt
Match: sp|Q0KL00|PIEZ1_RAT (Piezo-type mechanosensitive ion channel component 1 OS=Rattus norvegicus OX=10116 GN=Piezo1 PE=1 SV=3)

HSP 1 Score: 399.823 bits (1026), Expect = 1.621e-110
Identity = 343/1242 (27.62%), Postives = 595/1242 (47.91%), Query Frame = 1
Query:  811 HWATQSLFAFFNIVITGFAGIISPXXXXXXXXXXXXXXXTFWACGNNVMTSNFARMRLFLLLYSAAHVCLIFIVQLEFMQLYIPTGQRLSRLLGLYLMFD-TNCKNRGEIIFNNQRSID-YVSPFIILYVYYLSAIETRIWLEERKRINKERPAVDKETFIHTESYLSGEEINQEESQRISNSFNVEIGSNVSDGPYIDFTDVPHVLDAQNSRSTLFIEEDITKDMEKNQVKERPLLLSIINTMISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNLPELPTIFRISSSEMQSSEIGLHKSLIPTGPLAAMMSFLVVFWLTLRLFMTDEKINKSKICNEKISTQQKLEHYFGNVDNATYEKFVKCLKEKCEN----YWIFSCCFAMLFVSVNGSIVLFRIXXXXXXXXXXXXXXXSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIIQVRYFHSRFLELTSMKQT-------------QVCV--------ESERERVKSSKDEMDKNKFSVK---NTVEFIRDVNNMVFTATEKLKSLYTLTQPSIWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSASIVILKMIYQIKIFQTFNWLTNCSQ-YGNFAN-SSMEI---------IDNAKWLGLEKLENFQLHILKWTAILVGCAVWHIVRYHQMQFYKLNLDQKP-KTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNV-LWLPYMIFLGILLPVQYVICVGLPPGLCIEYPL---NVIP---KLRQWLYLPNYKVSPVPGKILADFVQYIFVVLQYQVFQMEKRKKSDSHKLVKQRLLEGFQKSIH--KDFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCINPMSWEIRGIHGKNADKQCSSVASGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLXXXXXXXXXXXXXXXXLNRIERKIKKIEQ-----RQAQHGKPEL---------------------------NEHYLVMRSGDYYLF 4287
            HW   +      IV+   AGI  PS  + VYL+ +L + T+W+C   + +  F  + + +  + A H+  ++  Q  F+Q  +  G   +RL GL    D  NC +   ++ N + +   YVSP I+L +YY +    ++       + KE P  D+E  +  +      ++  E   R +        +     P ID   V HVL +Q+      +   +       ++KE   L  + + ++  S++   +AMM WS+ Y SW +F+ LL +C +W +     + +  SP I+ Y   L  ++Y++   LPELPT        +   ++GL  +  P   L AM+ +L+ FWL LR F+      K K+  ++ +    LE    + +    +  ++ L E        YWI+ C    + VS  G +V+++IVYM L +  L +F + Y+ WR+ ++VFWW V+ Y +  L+++Y FQFQ      +N+TG ++E L D+GL++F  S+L  S+ IP  FL+  I+Q+ YFH  F++LT ++               Q  V        + E E  +     MD    + +    T      V + +        ++ T  Q  +  L E H  K + +  V+V + +V  MN++L+++     P+PR   +      V +  I++ KM+YQ+KI     + +NC++ + N  N   +EI         +D A W G+ K      +I     IL+   V+  V Y + + Y+    Q P     +  +       ++    LKY +NF F K GLE+ F+  V V   R++   +++   L+  L  +R      LW  Y +FL + L  QY++C+G+PP LCI+YP      IP    L +WLYLP++  +P    +++DF+  +    Q+QVF  E+ ++      V    LE  +   +   +FI  + SY+D LK  VF + +WL L ++F+TG   I++FGLGYLL  F  L  G  +L    ++ +   + ++ YN  VI++K +  L+ CVF+  +++   CW++ LF++ C     ++ + +  ++ D       +G+ WD +CFFF++LQR +F +  FL V  DL      +SRG  L N   +K+I   +++EE+ L +++R++K+I       RQ+Q  + +L                            +H  V+ SGDY+LF
Sbjct:  191 HWLLVTSGRMLVIVLLALAGIAHPSAFSSVYLMVFLAICTWWSCHFPLSSLGFNTLCVMVSCFGAGHLVCLYCYQTPFVQSVLLPGSLWARLFGLKNFVDIPNCSSPNVLVLNTKHAWPIYVSPGILLLLYYTATSLLKLRKGRFSELRKEIPREDEEHELELD------QLEPEPQARGTTQGATPTTTG----PDIDNCTV-HVLTSQSPVRQRPVRPRLA------ELKEMSPLHGLGHLILDQSYVCALIAMMVWSIMYHSWLTFVLLLWACLIWTVRSRHQLAMLCSPCILLYGLTLCCLRYVWAMELPELPTTL----GPVSLHQLGLEHTRYPCLDLGAMLLYLLTFWLLLRQFV------KEKLLKKRKAPSTLLEVTVSDTEPTQTQTLLRSLGELVTGIYVKYWIYVCAGMFIVVSFAGRLVVYKIVYMFLFLLCLTLFQVYYTLWRKLLRVFWWLVVAYTMLVLIAVYTFQFQDFPTYWRNLTGFTDEQLGDLGLEQFSVSELFSSILIPGFFLLACILQLHYFHRPFMQLTDLEHVPPPGTRRLRWAHRQDTVSEAPLLQHQEEEEVFRDDGQSMDGPHQTTQVPEGTASKWGLVADRLLDLASSFSAVLTRIQVFVRCLLELHVFKLVALYTVWVALKEVSVMNLLLVVLWAFALPYPRFRPMASCLSTVWTCIIIVCKMLYQLKIVNPHEYSSNCTEPFPNNTNLQPLEISQSLLYRGPVDPANWFGVRKGYPNLGYIQNHLQILL-LLVFEAVVYRRQEHYRRQHQQAPLPAQALCADGTRQRLDQDLLSCLKYFINFFFYKFGLEICFLMAVNVIGQRMNFMVILHGCWLVAILTRRRREAIARLWPNYCLFLTLFLLYQYLLCLGMPPALCIDYPWRWSQAIPMNSALIKWLYLPDFFRAPNSTNLISDFLLLLCASQQWQVFSAEQTEEWQRMAGVNTDHLEPLRGEPNPIPNFIHCR-SYLDMLKVAVFRYLFWLVLVVVFVTGATRISIFGLGYLLACFYLLLFGTTLLQKDTRAQLVLWDCLILYNVTVIISKNMLSLLSCVFVEQMQSN-FCWVIQLFSLVCTVKGYYDPKEMKTRDRDCLLPVEEAGIIWDSICFFFLLLQRRVFLSHYFLHVSADLKATALQASRGFALYNAANIKNINFHRQTEERSLAQLKRQMKRIRAKQEKYRQSQASRGQLQSTDPQEPGPDSPGGSSPPRTQWWRPWQDHATVIHSGDYFLF 1402          

HSP 2 Score: 342.428 bits (877), Expect = 6.220e-93
Identity = 217/605 (35.87%), Postives = 350/605 (57.85%), Query Frame = 1
Query: 5764 KQLKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKI-VRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQ---NQNNTYLNISLSM----------------KTDNAMMWWEVNEIIQGQSYCPNPDSPAKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQ 7515
            + L++F+  + + K     DVYA+MFL +   +++II G+++FG  + +   A   +  ++ P  F+ M++ QF  ++IDRAL+LRK V G   FQ+  V+ IH W+FF LP +T+R F      QL YF+KC+YFALS+YQ+R GYP RILGNFLT+ YN+ NL  F+ +  +PFL ELR VMDW+WTD++++  +WM VEDI++ IF++KC R  E  +P  +G+ ++ +VKY +G LI++F    IW PL+  S I  +  V   PI+ + ++ +G Y PLF  S+++ ++ P T + +EE+ +    +  +  ++  + P+D     I+ +S  +W I+PP   ++K +L    A + +      +R      S E    + T      +  +  L  L+  + + + V +P +FP+++ A      EAN + Q   ++   YL + + +                K  + + WW V E+   Q+ C            L + IF++++S    G + + YGI+G+Y +   VV +F+R F+S+IS+ I  EELP VDRI KL  +I+LVRE ++L LEE+L AKLIFLYRS ETMIKWT+
Sbjct: 1944 QPLRRFFHDILHTKYRAATDVYALMFLADIVDIVVIIFGFWAFGKHSAATDIASS-LSDDQVPQAFLFMLLVQFGTMVIDRALYLRKTVLGNLAFQVVLVVAIHLWMFFILPAVTERMFRQNAVAQLWYFVKCIYFALSAYQIRCGYPTRILGNFLTKKYNHLNLFLFQGFRLVPFLVELRAVMDWVWTDTTLSLSNWMCVEDIYANIFIIKCSRETEKKYPQPKGQKKKKIVKYGMGGLIILFLIAIIWFPLLFMSLIRSVVGVVNQPIDVTVTLKLGGYEPLFTMSAQQPSIVPFTPEDYEELSQQFDPYPLAMQFISQYSPEDIVTAQIEGSSGALWRISPPSRAQMKHELYNGTADITLRFTWNFQRDLAKGGSVEYTNEKHTLELAPNSTARRQLAQLLEGRPDQS-VVIPHLFPKYIRAPNG--PEANPVKQLQPDEEEDYLGVRIQLRREQVGTGTSGEQAGTKASDFLEWW-VIELQDCQAECN----------LLPMVIFSDKVSPPSLGFL-AGYGIVGLYVSIVLVVGKFVRGFFSDISHSIMFEELPCVDRILKLCQDIFLVRETRELELEEELYAKLIFLYRSPETMIKWTR 2532          

HSP 3 Score: 117.857 bits (294), Expect = 1.343e-24
Identity = 72/247 (29.15%), Postives = 124/247 (50.20%), Query Frame = 1
Query: 5167 DGRKSVSEDKEEKNKQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLN-VLPVPEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLW--------RDH---------SEFYKDIKISNEEEVNHIQPLKP------------QSAMRTGIKFRNPIKQLKKFYGKMTNRKLNKR 5817
            D R  + E +E +     F   + +   LL +  +    +SE  CYF++I+NH+++ +  SL  P LVF W ML++PRPSK FW+  I +TE+++V KY+ QF     N  + +  +   P   P ILG+EK+ +Y   D++QL+ LF HRS L   GLW        +DH         +E   + K+ ++ E     P +P            + ++R+  + ++P + LK  + +  + +  +R
Sbjct: 1638 DRRLRIPELEEAEQ----FEAQQGRTLRLLRAMYQCVAAHSELLCYFIIILNHMVTASAASLVLPVLVFLWAMLTIPRPSKRFWMTAIVFTEVMVVTKYLFQFGFFPWNSYIVLRRYENKPYFPPRILGLEKTDSYIKYDLVQLMALFFHRSQLLCYGLWDHEEDGVPKDHCRSSEKDQEAEEESEAKLESQPETGTGHPEEPVLTGTPKDHIQGKGSVRSKDEIQDPPEDLKPQHRRHISIRFRRR 1880          
BLAST of Piezo-type mechanosensitive ion channel component vs. UniProt/SwissProt
Match: sp|Q9H5I5|PIEZ2_HUMAN (Piezo-type mechanosensitive ion channel component 2 OS=Homo sapiens OX=9606 GN=PIEZO2 PE=1 SV=2)

HSP 1 Score: 388.652 bits (997), Expect = 6.142e-107
Identity = 221/595 (37.14%), Postives = 360/595 (60.50%), Query Frame = 1
Query: 5758 PIKQLKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLI---NTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAMM----WWEVNEIIQGQSYCPNPDSPAKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQH 7518
            PIKQ   F+  + + + +   DVY +MFL +    +II+ G+++FG  + +       +  ++ P PF+ M++ QF  +++DRAL+LRK V GK +FQ+  V  IH W+FF LP +T+RKF+     QL YF+KCVYF LS+YQ+R GYP R+LGNFLT++YNY NL  F+ +  +PFL ELR VMDW+WTD++++   W+ VEDI++ IF+LKCWR  E  +P  RG+ ++ VVKY +G +I++     +W PL+  S I  +  V   P++ S +I +G Y P+F  S++++ ++ + +++F +  +       +  +L+++E +D T   ++  S+++W I+PP  +K+  +L  P +S  +      +R  +    +E I     S  L N  + N+  +I   +T+ + T V +  I+P ++ A   + S+      ++NN +++I++ +  DN       WW +N +   + Y PN  +       L + +FN+++S    G + + YGI+G+YA+   V+ +F+R F+S IS+ I  EELPNVDRI KL  +I+LVRE  +L LEE L AKLIFLYRS ETMIKWT+ 
Sbjct: 2170 PIKQ---FFYNLIHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHS-AAADITSSLSEDQVPGPFLVMVLIQFGTMVVDRALYLRKTVLGKVIFQVILVFGIHFWMFFILPGVTERKFSQNLVAQLWYFVKCVYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFILKCWRESEKRYPQPRGQKKKKVVKYGMGGMIIVLLICIVWFPLLFMSLIKSVAGVINQPLDVSVTITLGGYQPIFTMSAQQSQLKVMDQQSFNKFIQAFSRDTGAMQFLENYEKEDITVAELEGNSNSLWTISPPSKQKMIHELLDPNSSFSVVFSWSIQRNLSLGAKSE-IATDKLSFPLKNITRKNIAKMIAGNSTESSKTPVTIEKIYPYYVKAPSDSNSKPIKQLLSENN-FMDITIILSRDNTTKYNSEWWVLN-LTGNRIYNPNSQA-------LELVVFNDKVSPPSLGFL-AGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPNVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTRE 2749          

HSP 2 Score: 202.986 bits (515), Expect = 2.103e-50
Identity = 161/590 (27.29%), Postives = 292/590 (49.49%), Query Frame = 1
Query: 2596 QPSIWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSASIVILKMIYQIKIFQTFNWLTNCSQYG--------NFANSSM---EIIDNAKWLGLEKLENFQLHILKWTAILVGCAVWHIVRYHQMQFYK-LNLDQKPKTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNV-LWLPYMIFLGILLPVQYVICVGLPPGLCIEYPL---------NVIPKLRQWLYLPNYKVSPVPGKILADFVQYIFVVLQYQVFQMEKRKK-----SDSHKLVKQRLLEGF-QKSIHKDFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCINPMSWEIRGIHGKNADKQCS--SVASGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLXXXXXXXXXXXXXXXXLNRIERKIKKIEQRQAQHGKPELNEHYLVMRSGD 4275
            Q  +W + E H  K +   I++V + +V   N + ++      P+ +L  +  +   V +  I++ KM+YQ++  +  N+  NCS           N  N S+     ID  +W+GL K     ++ L+   +++    + +  Y   ++Y+  N    P +  IF ++      +   +  KY +N+ F K GLE  F+ +V V   R+D Y++++   L+  L  +R      +W  Y  FL  ++  QY IC+G+PP  C +YP          N+I    +WLY P++ V P P  ++ DF+  +   LQ Q+F+ E +        D+ ++        F Q +   DFI  +S Y+D  K ++F + +W  L IIFITG   I++F +GYL+  F +L  G  +L+   KS++R  + ++ YN  VI  K I  +  C ++  L     CW++  F++ C       ++G     A+  C+  S  +G+ WD +CF F++LQR +F +  FL V  D+      +SRGA L    I+K+++ + + E+K +++++R++ +I+ RQ ++ K +     L    G+
Sbjct:  931 QVFMWWILELHIIKIVSSYIIWVSVKEVSLFNYVFLISWAFALPYAKLRRLASSVCTVWTCVIIVCKMLYQLQTIKPENFSVNCSLPNENQTNIPFNELNKSLLYSAPIDPTEWVGLRKSSPLLVY-LRNNLLMLAILAFEVTIYRHQEYYRGRNNLTAPVSRTIFHDITRLHLDDGLINCAKYFINYFFYKFGLETCFLMSVNVIGQRMDFYAMIHACWLIAVLYRRRRKAIAEIWPKYCCFLACIITFQYFICIGIPPAPCRDYPWRFKGASFNDNII----KWLYFPDFIVRPNPVFLVYDFMLLLCASLQRQIFEDENKAAVRIMAGDNVEICMNLDAASFSQHNPVPDFIHCRS-YLDMSKVIIFSYLFWFVLTIIFITGTTRISIFCMGYLVACFYFLLFGGDLLLKPIKSILRYWDWLIAYNVFVITMKNILSIGACGYIGTL-VHNSCWLIQAFSLACT------VKGYQMPAANSPCTLPSGEAGIIWDSICFAFLLLQRRVFMSYYFLHVVADIKASQILASRGAELFQATIVKAVKARIEEEKKSMDQLKRQMDRIKARQQKYKKGKERMLSLTQEPGE 1507          

HSP 3 Score: 173.711 bits (439), Expect = 1.536e-41
Identity = 111/355 (31.27%), Postives = 179/355 (50.42%), Query Frame = 1
Query: 1513 LLSIINTMISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNLPELPTIFRISSSEMQSSEIGLHKSLIPTGPLAAMMSFLVVFWLTLRLFMTDEKINKSK---ICNEKISTQQKLE----------------------------------------------HYFGNVDNATYEKFVKCLKEKCENYWIFSCCFAMLFVSVNGSIVLFRIXXXXXXXXXXXXXXXSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIIQVRYFHSRFLELTSMK 2430
            ++S+   ++  S+I   +AMMAWS+ Y SW +F+ L+ SC LW+I + R   + +SP +V Y  LL+++QYI+ F LPE+  +             G  +   P G LA+ + F + FWL LR  +T++K  + K   +   KI +Q+  E                                                 GN+  A + K+           WI+ C     FVS  G IV+++I+YMVL ++ + ++ + Y +WR+ +K FW +V+ Y +  L+ IY +QF+      QN+TGL +E L D+GLK+F  ++L   +FIP  FL++ I+ + YFH RFLELT +K
Sbjct:  489 MVSVFQFIMKQSYICALIAMMAWSITYHSWLTFVLLIWSCTLWMIRNRRKYAMISSPFMVVYGNLLLILQYIWSFELPEIKKV------------PGFLEKKEP-GELASKILFTITFWLLLRQHLTEQKALQEKEALLSEVKIGSQENEEKDEELQDIQVEGEPKEEEEEEAKEEKQERKKVEQEEAEEEDEQDIMKVLGNLVVAMFIKY-----------WIYVCGGMFFFVSFEGKIVMYKIIYMVLFLFCVALYQVHYEWWRKILKYFWMSVVIYTMLVLIFIYTYQFENFPGLWQNMTGLKKEKLEDLGLKQFTVAELFTRIFIPTSFLLVCILHLHYFHDRFLELTDLK 819          

HSP 4 Score: 127.487 bits (319), Expect = 1.683e-27
Identity = 74/213 (34.74%), Postives = 113/213 (53.05%), Query Frame = 1
Query: 5173 RKSVSEDKEEKNKQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLPVPEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLW-------------------------RDHSEFYKDIKISNEEEVNHIQPLKPQSAMR 5736
            +K   +D+ E++++  F   + +F  L  +     +  SE  CYF++I+NH++S ++++L  P L+F W MLSVPRPS+ FW++ I YTE+ IV KY  QF     N   V  ++  P   P I+G+EK   Y + D+IQLL LF HRS LK +GLW                         RD S+  K I ++   E  H+   + Q+A+R
Sbjct: 1886 KKMFHDDELEESEK--FYVGQPRFLLLFYAMYNTLVARSEMVCYFVIILNHMVSASMITLLLPILIFLWAMLSVPRPSRRFWMMAIVYTEVAIVVKYFFQFGFFPWNK-NVEVNKDKPYHPPNIIGVEKKEGYVLYDLIQLLALFFHRSILKCHGLWDEDDMTESGMAREESDDELSLGHGRRDSSDSLKSINLAASVESVHVTFPEQQTAVR 2095          

HSP 5 Score: 56.9954 bits (136), Expect = 3.455e-6
Identity = 38/130 (29.23%), Postives = 72/130 (55.38%), Query Frame = 1
Query:  850 VITGFAGIISPXXXXXXXXXXXXXXXTFWACGNNVMTSNFARMRLFLLLYSAAHVCLIFIVQLEFMQLYIPTGQRLSRLLGLYLMFDTNCKNRGEIIFNNQRS-IDYVSPFIILYVYYLSAIETRIWLEE 1236
            ++ G +G++ PSL + VY   +LG+ T+W+         F+ + + L +++A H+  +++ Q +F Q  +P     +RL G+  +  T+C +  +II N   S   + +P ++L +YY  A   RIWL+E
Sbjct:  229 ILLGSSGMMLPSLTSSVYFFVFLGLCTWWSWCRTFDPLLFSCLCVLLAIFTAGHLIGLYLYQFQFFQEAVPPNDYYARLFGIKSVIQTDCSSTWKIIVNPDLSWYHHANPILLLVMYYTLATLIRIWLQE 358          
BLAST of Piezo-type mechanosensitive ion channel component vs. TrEMBL
Match: A0A0L8GDG7 (Piezo-type mechanosensitive ion channel component OS=Octopus bimaculoides OX=37653 GN=OCBIM_22035390mg PE=3 SV=1)

HSP 1 Score: 1021.54 bits (2640), Expect = 0.000e+0
Identity = 712/2152 (33.09%), Postives = 1113/2152 (51.72%), Query Frame = 1
Query: 1498 KERPLLLSIINTMISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNL--PELPTIFRISSSEMQSSEIGLHKSLIPTGPLAAMMSFLVVFWLTLRLFMTDEKINKSKICNEKISTQQKLEHYFGNVDNATYEKFVKCLKEKCENYWIFSCCFAMLFVSVNGSIVLFRIXXXXXXXXXXXXXXXSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIIQVRYFHSRFLELTSMKQTQVCVESERERVKSSKDEMDKNKFSVKNTVEFIRDVNNMVFTATE----------------KLKSLYTLTQPS-------IWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSASIVILKMIYQIKIFQTFNWLTNCSQYGNFANSSM-----EIIDNAKWLGLEKLENFQL--HILKWTAILVGCAVWHIVRYHQMQFYKLNLDQKPKTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNVLWLPYMIFLGILLPVQYVICVGLPPGLCIEYPLNVI--PKLRQWLYLPNYKVSPVPGKIL-ADFVQYIFVVLQYQVFQMEKRKKSDSHKLVKQR-LLEGFQKSIH---KDFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCINPMSWEIRGIHGKNADKQCSSVASGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLXXXXXXXXXXXXXXXXLNRIERKIKKIEQRQAQHGKP--ELNEHYLVMRSGDYYLFXXXXXXXXXXXXXXXXXXMVGSNTISLESNLPTSSVGKDISVSTDSQRHLEDDSNSLDRHTNENKRKSIGIILEKNEQEDEKSGDDDLSLIGTLNPLQLINAVVKEGPKQAIRQYKRXXXXXXXXXXLRVNLDMLPNEYESCCIENPDVSPSEEVRENSFRSSTVHDNSTNFPQYHNLHLHTPIPSENETRYQSSHNTAIVNTGTESSVDPVSN--GNQRLESSWENFKNVIKLCVCFIGSTMASLTVLFNEWTREYYR-------NIRK-----------------LEEEKKLVKSHVLSTFIEID---EKLGQEIEKFVK-DGRKSVS----EDKEEKNKQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLPVPEH-RIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLWRDHSEFYKDIK----------------------------------------ISNEEEVN------------------HIQPLKPQSAMRT--GIKFRNPIKQLKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKL-KEKLSIPRASLKINMQAVCERPSTDSKST-EKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTL-SEANSL--HQNQNNTYL-----NISLSMKTDNAMMWWEVNEIIQGQSYCPNPDSPAKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQ 7515
            ++R ++ S++  +++ S++LT +AMMAWS+ + SW +F+FLL +C +W++P SR  CL  SP+IV YA +L+ IQ+IYG +L   ELPT   I   +M  +EIG  K   P G LA  + + +VF LTLR  M ++++ K     +     + ++ Y    D +T +   + +      YWIF C   ML +++   +  +R++Y++  +YF+++F LSY+ WR  M +FWW VI Y++  L  IY +QF +     +N TGLS+E+L D+GL+++    L + L  P  FL+++IIQV YFH  F+ L+ + +        RE  K    +M   +           DV N   T TE                + +SL+     +       +WRL E H  K +   I+ V   +V A++ + ++I+ +     +   ++   L + +A +++ K  +Q+ + +  +W  NC+   + +   M     E I+N  W+GLEK+++  L  +++ + AIL+  A   IVRYHQ Q YK +  ++PK  +IF  V    + +   D+LKY  N+ F K GLE+ +I T +   +R+D YS++Y + L   L++ R     +W  Y++ L +LLP+QY+  +G   GLC EYP   +  P L+ WL+LP+Y + P P  IL ADF Q +FV LQ+QVF +E+  +S ++     + +L   + S+     DF +  +SY+D  K+ VFY  +W+T+AI+F  G   I +FGLGY++I F ++W G+  L+   + L+   N ++ Y F+V+L K   QL+GCV+M+ +     CW V LF I C+N    E  G         C +  +GL WDV+CF F++LQR ++++  F  +  +L  Q + +SRGA LIN  +++ +  QK+ E + L  I++K++ ++ +QA   K   E +EH+  +RSGDYYLF                                                  ED++  +    ++    S+ I         E+SG +D      L PLQL++  +  G   A+                                        E+ RE + +  + HD++               PS ++       + AIV  GT  SVD V +    +  ES      N   L +  + S    L   FN  +R Y R       ++RK                 +EE    V S    T    D    K+  E++   + D RKS +    +D +   +++ F  ++  F+ LL+++  + I  SE  CYFL+++N ++S +LLS+P P +VF WGMLSVPRPSK FW+ +ITYTE ++V KY+ QF     N     ++ + +P   P ILGIEK   YA+ D+  LL LF+HR+ LK  GLW+D  +   D+                                            E EV+                  HI  L+P+ A  T    KF + +K  + FY +MTN   N  VDVYA MF+C+F A LI++ GY++FGP     G    +++ N+ P+PF+ M++ QF+FIIIDRALFLRK V GKF+FQ+  VI++H WLFF LP IT R F    P  L YF+KC+YFALS++Q+RSGYP RILGNFLT+NY+Y NL  FK ++ IPFL ELR +MDWMWTD+++A   W+++EDI++ IFVLKCWR+ E  +PT R   R+  +KY +G L+L+   F IW PL++ SF    +   PP  C+  I++G Y PLF  + ++ ++  L +  ++ + + +     +  +L S++P D T I I+  S +VW I+PP  KKL ++ +      + +++     + S  S  T  K  + T    LTN   + L  +I+   +S  V +P +F  F+      + S  + L   + + + YL     NIS   K+   + WW V+E      + PN  S A + + +T   FN+RI+   F  I + YGI+G+Y +  FV+ RF R F S +S+ I   ELP VD I KL  +IYLVRE   L LEE+L AKLIFLYRS ETMI+WT+
Sbjct:   96 EKRSVIASVLIYIMNQSYVLTLIAMMAWSITFHSWLTFVFLLGACLIWMVPKSRRACLVVSPMIVIYAEVLLTIQFIYGLDLNDQELPT--NIKGVKM--AEIGFIKPHTPCGNLALQILYTLVFLLTLRQHMREKQLKKETTNEDSPMDSEFVDGY----DGSTIKHIGRYIWSLLSKYWIFICAGMMLTIAIQDRVA-YRLIYLIFFLYFVILFQLSYTIWRLTMYIFWWVVIIYSMAILCIIYTYQFSQFPEYWRNSTGLSKEMLEDLGLQQYDVQGLFEKLLTPTSFLIVIIIQVHYFHQPFMNLSCLDRYL------REMPKFEGIDMTAEE-------GLTTDVTNQTSTDTEAEPSKRPKHWRKELLLRCRSLWKRANDTWNYVSQYLWRLTEIHIYKVVGFTIMVVAAKEVSAISAVYVIILALFLLLVKCRLLLSHILQIYTALVLLAKTSFQMSVARVTDWENNCTDTWSNSTDEMDYPFNETINNNIWIGLEKVDSNYLPNYLVNYVAILLIIAFQSIVRYHQHQHYKHSEHRRPKEGIIFCNVTREDADKGIIDVLKYFANYFFYKFGLEICYITTAITISVRVDAYSILYAIFLAALLLMNRRNNARVWPVYVLILTVLLPLQYMSSLGFLLGLCTEYPWKEMLKPSLQYWLFLPSY-LHPPPAIILIADFFQLLFVCLQWQVFNVEQGSQSTNYAGGDNKDILPEVEASLEIPVPDFTTTMASYLDVAKYAVFYHLFWVTMAIVFFAGTNRINIFGLGYVIIVFCFMWFGREFLLKPLRKLLWWWNFLIGYTFIVLLVKISLQLVGCVYMDGVGIAH-CWAVKLFGITCLNSFPKEQHG--------NCEADKNGLGWDVICFAFLLLQRRVYSSHYFRHIVAELEAQRRLASRGAELINRILIREVLLQKERETEVLYTIKKKMEHLKAKQAGLKKSFHEPDEHFQAIRSGDYYLF--------------------------------------------------EDETEEVPESPDQGPTTSLNI------GRSERSGSED----KALGPLQLLSTAIDSGTDTAL----------------------------------------EKAREETDQPVSQHDST---------------PSGDK-------HVAIV-MGT--SVDKVEDEETTKPKESLCSKISNSFSLFIAILVSMANWLIKFFNRISRNYRRVAYTLTDDMRKEKLKIQAEKLTFLSLSAMEEGITTVDSKEAVTRAAEDIGVNKIAVEVDTPQETDIRKSFTKTNLQDIDNAEEENEFELAQPVFYRLLVAYYYMLISRSELVCYFLIVLNQMMSASLLSMPLPIMVFLWGMLSVPRPSKTFWVTVITYTEAIVVLKYLFQFTFFPWNDDDNSKNWKNNPFWPPRILGIEKQDYYAMYDLALLLVLFIHRTILKRYGLWKDAEDITADLAKAEGKELSPPASPQMHDERKFAAAAATAAAVPEKQEYDFDAGQESEVDVPLKKKMIVTQDPKDNSPHITTLEPEPAEETVQKKKFVSVMKPFQNFYRQMTNSAYNAVVDVYAPMFVCDFLAFLIVVFGYWAFGPVQSGEGSVTTYLEENRVPIPFLVMLVVQFMFIIIDRALFLRKCVHGKFIFQVSLVIIVHIWLFFILPAITNRMFIKNVPAMLWYFVKCIYFALSAHQIRSGYPTRILGNFLTKNYSYLNLFLFKGFLVIPFLLELRALMDWMWTDTTLALGSWLQMEDIYANIFVLKCWRHAEATYPTPRALKRKSTIKYGVGGLLLLLIIFIIWFPLVLFSFANTVYEVNPPKTCTVRISLGGYQPLFKMTVQQADIFALDESQYKLLHKFYDTTPRASSFLTSYDPQDITVITINGESTSVWGISPPSQKKLIRDLMDAKHMDMDLDVSFTRGKRSPQSPGTFSKQFQVT----LTNDTASKLAQIISGGNSSQLVAIPKLFYPFMRLQNNGIVSVVHPLMKEKEEPDIYLGFRSGNIS---KSSGRVDWWYVSEETDLNIWKPNSKSNASRLILVT---FNDRIAPATFSLI-TGYGIIGLYVSMVFVIGRFARMFVSEVSFRIMFMELPRVDNILKLCLDIYLVRECSDLCLEEELFAKLIFLYRSPETMIRWTK 2079          
BLAST of Piezo-type mechanosensitive ion channel component vs. TrEMBL
Match: A0A0L8GDH1 (Piezo-type mechanosensitive ion channel component OS=Octopus bimaculoides OX=37653 GN=OCBIM_22035390mg PE=3 SV=1)

HSP 1 Score: 1017.68 bits (2630), Expect = 0.000e+0
Identity = 711/2160 (32.92%), Postives = 1113/2160 (51.53%), Query Frame = 1
Query: 1498 KERPLLLSIINTMISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNL--PELPTIFRISSSEMQSSEIGLHKSLIPTGPLAAMMSFLVVFWLTLRLFMTDEKINKSKICNEKISTQQKLEHYFGNVDNATYEKFVKCLKEKCENYWIFSCCFAMLFVSVNGSIVLFRIXXXXXXXXXXXXXXXSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIIQVRYFHSRFLELTSMKQTQVCVESERERVKSSKDEMDKNKFSVKNTVEFIRDVNNMVFTATE----------------KLKSLYTLTQPS-------IWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSASIVILKMIYQIKIFQTFNWLTNCSQYGNFANSSM-----EIIDNAKWLGLEKLENFQL--HILKWTAILVGCAVWHIVRYHQMQFYKLNLDQKPKTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNVLWLPYMIFLGILLPVQYVICVGLPPGLCIEYPLNVI--PKLRQWLYLPNYKVSPVPGKIL-ADFVQYIFVVLQYQVFQMEKRKKSDSHKLVKQR-LLEGFQKSIH---KDFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCINPMSWEIRGIHGKNADKQCSSVASGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLXXXXXXXXXXXXXXXXLNRIERKIKKIEQRQAQHGKP--ELNEHYLVMRSGDYYLFXXXXXXXXXXXXXXXXXXMVGSNTISLESNLPTSSVGKDISVSTDSQRHLEDDSNSLDRHTNENKRKSIGIILEKNEQEDEKSGDDDLSLIGTLNPLQLINAVVKEGPKQAIRQYKRXXXXXXXXXXLRVNLDMLPNEYESCCIENPDVSPSEEVRENSFRSSTVHDNSTNFPQYHNLHLHTPIPSENETRYQSSHNTAIVNTGTESSVDPVSN--GNQRLESSWENFKNVIKLCVCFIGSTMASLTVLFNEWTREYYR-------NIRK-----------------LEEEKKLVKSHVLSTFIEID---EKLGQEIEKFVK-DGRKSVS----EDKEEKNKQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLPVPEH-RIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLWRDHSEFYKDIK----------------------------------------ISNEEEVN------------------HIQPLKPQSAMRT----------GIKFRNPIKQLKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKL-KEKLSIPRASLKINMQAVCERPSTDSKST-EKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTL-SEANSL--HQNQNNTYL-----NISLSMKTDNAMMWWEVNEIIQGQSYCPNPDSPAKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQ 7515
            ++R ++ S++  +++ S++LT +AMMAWS+ + SW +F+FLL +C +W++P SR  CL  SP+IV YA +L+ IQ+IYG +L   ELPT   I   +M  +EIG  K   P G LA  + + +VF LTLR  M ++++ K     +     + ++ Y    D +T +   + +      YWIF C   ML +++   +  +R++Y++  +YF+++F LSY+ WR  M +FWW VI Y++  L  IY +QF +     +N TGLS+E+L D+GL+++    L + L  P  FL+++IIQV YFH  F+ L+ + +        RE  K    +M   +           DV N   T TE                + +SL+     +       +WRL E H  K +   I+ V   +V A++ + ++I+ +     +   ++   L + +A +++ K  +Q+ + +  +W  NC+   + +   M     E I+N  W+GLEK+++  L  +++ + AIL+  A   IVRYHQ Q YK +  ++PK  +IF  V    + +   D+LKY  N+ F K GLE+ +I T +   +R+D YS++Y + L   L++ R     +W  Y++ L +LLP+QY+  +G   GLC EYP   +  P L+ WL+LP+Y + P P  IL ADF Q +FV LQ+QVF +E+  +S ++     + +L   + S+     DF +  +SY+D  K+ VFY  +W+T+AI+F  G   I +FGLGY++I F ++W G+  L+   + L+   N ++ Y F+V+L K   QL+GCV+M+ +     CW V LF I C+N    E  G         C +  +GL WDV+CF F++LQR ++++  F  +  +L  Q + +SRGA LIN  +++ +  QK+ E + L  I++K++ ++ +QA   K   E +EH+  +RSGDYYLF                                                  ED++  +    ++    S+ I         E+SG +D      L PLQL++  +  G   A+                                        E+ RE + +  + HD++               PS ++       + AIV  GT  SVD V +    +  ES      N   L +  + S    L   FN  +R Y R       ++RK                 +EE    V S    T    D    K+  E++   + D RKS +    +D +   +++ F  ++  F+ LL+++  + I  SE  CYFL+++N ++S +LLS+P P +VF WGMLSVPRPSK FW+ +ITYTE ++V KY+ QF     N     ++ + +P   P ILGIEK   YA+ D+  LL LF+HR+ LK  GLW+D  +   D+                                            E EV+                  HI  L+P+ A  T            +F + +K  + FY +MTN   N  VDVYA MF+C+F A LI++ GY++FGP     G    +++ N+ P+PF+ M++ QF+FIIIDRALFLRK V GKF+FQ+  VI++H WLFF LP IT R F    P  L YF+KC+YFALS++Q+RSGYP RILGNFLT+NY+Y NL  FK ++ IPFL ELR +MDWMWTD+++A   W+++EDI++ IFVLKCWR+ E  +PT R   R+  +KY +G L+L+   F IW PL++ SF    +   PP  C+  I++G Y PLF  + ++ ++  L +  ++ + + +     +  +L S++P D T I I+  S +VW I+PP  KKL ++ +      + +++     + S  S  T  K  + T    LTN   + L  +I+   +S  V +P +F  F+      + S  + L   + + + YL     NIS   K+   + WW V+E      + PN  S A + + +T   FN+RI+   F  I + YGI+G+Y +  FV+ RF R F S +S+ I   ELP VD I KL  +IYLVRE   L LEE+L AKLIFLYRS ETMI+WT+
Sbjct:   96 EKRSVIASVLIYIMNQSYVLTLIAMMAWSITFHSWLTFVFLLGACLIWMVPKSRRACLVVSPMIVIYAEVLLTIQFIYGLDLNDQELPT--NIKGVKM--AEIGFIKPHTPCGNLALQILYTLVFLLTLRQHMREKQLKKETTNEDSPMDSEFVDGY----DGSTIKHIGRYIWSLLSKYWIFICAGMMLTIAIQDRVA-YRLIYLIFFLYFVILFQLSYTIWRLTMYIFWWVVIIYSMAILCIIYTYQFSQFPEYWRNSTGLSKEMLEDLGLQQYDVQGLFEKLLTPTSFLIVIIIQVHYFHQPFMNLSCLDRYL------REMPKFEGIDMTAEE-------GLTTDVTNQTSTDTEAEPSKRPKHWRKELLLRCRSLWKRANDTWNYVSQYLWRLTEIHIYKVVGFTIMVVAAKEVSAISAVYVIILALFLLLVKCRLLLSHILQIYTALVLLAKTSFQMSVARVTDWENNCTDTWSNSTDEMDYPFNETINNNIWIGLEKVDSNYLPNYLVNYVAILLIIAFQSIVRYHQHQHYKHSEHRRPKEGIIFCNVTREDADKGIIDVLKYFANYFFYKFGLEICYITTAITISVRVDAYSILYAIFLAALLLMNRRNNARVWPVYVLILTVLLPLQYMSSLGFLLGLCTEYPWKEMLKPSLQYWLFLPSY-LHPPPAIILIADFFQLLFVCLQWQVFNVEQGSQSTNYAGGDNKDILPEVEASLEIPVPDFTTTMASYLDVAKYAVFYHLFWVTMAIVFFAGTNRINIFGLGYVIIVFCFMWFGREFLLKPLRKLLWWWNFLIGYTFIVLLVKISLQLVGCVYMDGVGIAH-CWAVKLFGITCLNSFPKEQHG--------NCEADKNGLGWDVICFAFLLLQRRVYSSHYFRHIVAELEAQRRLASRGAELINRILIREVLLQKERETEVLYTIKKKMEHLKAKQAGLKKSFHEPDEHFQAIRSGDYYLF--------------------------------------------------EDETEEVPESPDQGPTTSLNI------GRSERSGSED----KALGPLQLLSTAIDSGTDTAL----------------------------------------EKAREETDQPVSQHDST---------------PSGDK-------HVAIV-MGT--SVDKVEDEETTKPKESLCSKISNSFSLFIAILVSMANWLIKFFNRISRNYRRVAYTLTDDMRKEKLKIQAEKLTFLSLSAMEEGITTVDSKEAVTRAAEDIGVNKIAVEVDTPQETDIRKSFTKTNLQDIDNAEEENEFELAQPVFYRLLVAYYYMLISRSELVCYFLIVLNQMMSASLLSMPLPIMVFLWGMLSVPRPSKTFWVTVITYTEAIVVLKYLFQFTFFPWNDDDNSKNWKNNPFWPPRILGIEKQDYYAMYDLALLLVLFIHRTILKRYGLWKDAEDITADLAKAEGKELSPPASPQMHDERKFAAAAATAAAVPEKQEYDFDAGQESEVDVPLKKKMIVTQDPKDNSPHITTLEPEPAEETVQKKNILTVLETRFVSVMKPFQNFYRQMTNSAYNAVVDVYAPMFVCDFLAFLIVVFGYWAFGPVQSGEGSVTTYLEENRVPIPFLVMLVVQFMFIIIDRALFLRKCVHGKFIFQVSLVIIVHIWLFFILPAITNRMFIKNVPAMLWYFVKCIYFALSAHQIRSGYPTRILGNFLTKNYSYLNLFLFKGFLVIPFLLELRALMDWMWTDTTLALGSWLQMEDIYANIFVLKCWRHAEATYPTPRALKRKSTIKYGVGGLLLLLIIFIIWFPLVLFSFANTVYEVNPPKTCTVRISLGGYQPLFKMTVQQADIFALDESQYKLLHKFYDTTPRASSFLTSYDPQDITVITINGESTSVWGISPPSQKKLIRDLMDAKHMDMDLDVSFTRGKRSPQSPGTFSKQFQVT----LTNDTASKLAQIISGGNSSQLVAIPKLFYPFMRLQNNGIVSVVHPLMKEKEEPDIYLGFRSGNIS---KSSGRVDWWYVSEETDLNIWKPNSKSNASRLILVT---FNDRIAPATFSLI-TGYGIIGLYVSMVFVIGRFARMFVSEVSFRIMFMELPRVDNILKLCLDIYLVRECSDLCLEEELFAKLIFLYRSPETMIRWTK 2087          
BLAST of Piezo-type mechanosensitive ion channel component vs. TrEMBL
Match: A0A0L8GD91 (Piezo-type mechanosensitive ion channel component OS=Octopus bimaculoides OX=37653 GN=OCBIM_22035390mg PE=3 SV=1)

HSP 1 Score: 1017.68 bits (2630), Expect = 0.000e+0
Identity = 711/2160 (32.92%), Postives = 1113/2160 (51.53%), Query Frame = 1
Query: 1498 KERPLLLSIINTMISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNL--PELPTIFRISSSEMQSSEIGLHKSLIPTGPLAAMMSFLVVFWLTLRLFMTDEKINKSKICNEKISTQQKLEHYFGNVDNATYEKFVKCLKEKCENYWIFSCCFAMLFVSVNGSIVLFRIXXXXXXXXXXXXXXXSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIIQVRYFHSRFLELTSMKQTQVCVESERERVKSSKDEMDKNKFSVKNTVEFIRDVNNMVFTATE----------------KLKSLYTLTQPS-------IWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSASIVILKMIYQIKIFQTFNWLTNCSQYGNFANSSM-----EIIDNAKWLGLEKLENFQL--HILKWTAILVGCAVWHIVRYHQMQFYKLNLDQKPKTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNVLWLPYMIFLGILLPVQYVICVGLPPGLCIEYPLNVI--PKLRQWLYLPNYKVSPVPGKIL-ADFVQYIFVVLQYQVFQMEKRKKSDSHKLVKQR-LLEGFQKSIH---KDFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCINPMSWEIRGIHGKNADKQCSSVASGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLXXXXXXXXXXXXXXXXLNRIERKIKKIEQRQAQHGKP--ELNEHYLVMRSGDYYLFXXXXXXXXXXXXXXXXXXMVGSNTISLESNLPTSSVGKDISVSTDSQRHLEDDSNSLDRHTNENKRKSIGIILEKNEQEDEKSGDDDLSLIGTLNPLQLINAVVKEGPKQAIRQYKRXXXXXXXXXXLRVNLDMLPNEYESCCIENPDVSPSEEVRENSFRSSTVHDNSTNFPQYHNLHLHTPIPSENETRYQSSHNTAIVNTGTESSVDPVSN--GNQRLESSWENFKNVIKLCVCFIGSTMASLTVLFNEWTREYYR-------NIRK-----------------LEEEKKLVKSHVLSTFIEID---EKLGQEIEKFVK-DGRKSVS----EDKEEKNKQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLPVPEH-RIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLWRDHSEFYKDIK----------------------------------------ISNEEEVN------------------HIQPLKPQSAMRT----------GIKFRNPIKQLKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKL-KEKLSIPRASLKINMQAVCERPSTDSKST-EKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTL-SEANSL--HQNQNNTYL-----NISLSMKTDNAMMWWEVNEIIQGQSYCPNPDSPAKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQ 7515
            ++R ++ S++  +++ S++LT +AMMAWS+ + SW +F+FLL +C +W++P SR  CL  SP+IV YA +L+ IQ+IYG +L   ELPT   I   +M  +EIG  K   P G LA  + + +VF LTLR  M ++++ K     +     + ++ Y    D +T +   + +      YWIF C   ML +++   +  +R++Y++  +YF+++F LSY+ WR  M +FWW VI Y++  L  IY +QF +     +N TGLS+E+L D+GL+++    L + L  P  FL+++IIQV YFH  F+ L+ + +        RE  K    +M   +           DV N   T TE                + +SL+     +       +WRL E H  K +   I+ V   +V A++ + ++I+ +     +   ++   L + +A +++ K  +Q+ + +  +W  NC+   + +   M     E I+N  W+GLEK+++  L  +++ + AIL+  A   IVRYHQ Q YK +  ++PK  +IF  V    + +   D+LKY  N+ F K GLE+ +I T +   +R+D YS++Y + L   L++ R     +W  Y++ L +LLP+QY+  +G   GLC EYP   +  P L+ WL+LP+Y + P P  IL ADF Q +FV LQ+QVF +E+  +S ++     + +L   + S+     DF +  +SY+D  K+ VFY  +W+T+AI+F  G   I +FGLGY++I F ++W G+  L+   + L+   N ++ Y F+V+L K   QL+GCV+M+ +     CW V LF I C+N    E  G         C +  +GL WDV+CF F++LQR ++++  F  +  +L  Q + +SRGA LIN  +++ +  QK+ E + L  I++K++ ++ +QA   K   E +EH+  +RSGDYYLF                                                  ED++  +    ++    S+ I         E+SG +D      L PLQL++  +  G   A+                                        E+ RE + +  + HD++               PS ++       + AIV  GT  SVD V +    +  ES      N   L +  + S    L   FN  +R Y R       ++RK                 +EE    V S    T    D    K+  E++   + D RKS +    +D +   +++ F  ++  F+ LL+++  + I  SE  CYFL+++N ++S +LLS+P P +VF WGMLSVPRPSK FW+ +ITYTE ++V KY+ QF     N     ++ + +P   P ILGIEK   YA+ D+  LL LF+HR+ LK  GLW+D  +   D+                                            E EV+                  HI  L+P+ A  T            +F + +K  + FY +MTN   N  VDVYA MF+C+F A LI++ GY++FGP     G    +++ N+ P+PF+ M++ QF+FIIIDRALFLRK V GKF+FQ+  VI++H WLFF LP IT R F    P  L YF+KC+YFALS++Q+RSGYP RILGNFLT+NY+Y NL  FK ++ IPFL ELR +MDWMWTD+++A   W+++EDI++ IFVLKCWR+ E  +PT R   R+  +KY +G L+L+   F IW PL++ SF    +   PP  C+  I++G Y PLF  + ++ ++  L +  ++ + + +     +  +L S++P D T I I+  S +VW I+PP  KKL ++ +      + +++     + S  S  T  K  + T    LTN   + L  +I+   +S  V +P +F  F+      + S  + L   + + + YL     NIS   K+   + WW V+E      + PN  S A + + +T   FN+RI+   F  I + YGI+G+Y +  FV+ RF R F S +S+ I   ELP VD I KL  +IYLVRE   L LEE+L AKLIFLYRS ETMI+WT+
Sbjct:   93 EKRSVIASVLIYIMNQSYVLTLIAMMAWSITFHSWLTFVFLLGACLIWMVPKSRRACLVVSPMIVIYAEVLLTIQFIYGLDLNDQELPT--NIKGVKM--AEIGFIKPHTPCGNLALQILYTLVFLLTLRQHMREKQLKKETTNEDSPMDSEFVDGY----DGSTIKHIGRYIWSLLSKYWIFICAGMMLTIAIQDRVA-YRLIYLIFFLYFVILFQLSYTIWRLTMYIFWWVVIIYSMAILCIIYTYQFSQFPEYWRNSTGLSKEMLEDLGLQQYDVQGLFEKLLTPTSFLIVIIIQVHYFHQPFMNLSCLDRYL------REMPKFEGIDMTAEE-------GLTTDVTNQTSTDTEAEPSKRPKHWRKELLLRCRSLWKRANDTWNYVSQYLWRLTEIHIYKVVGFTIMVVAAKEVSAISAVYVIILALFLLLVKCRLLLSHILQIYTALVLLAKTSFQMSVARVTDWENNCTDTWSNSTDEMDYPFNETINNNIWIGLEKVDSNYLPNYLVNYVAILLIIAFQSIVRYHQHQHYKHSEHRRPKEGIIFCNVTREDADKGIIDVLKYFANYFFYKFGLEICYITTAITISVRVDAYSILYAIFLAALLLMNRRNNARVWPVYVLILTVLLPLQYMSSLGFLLGLCTEYPWKEMLKPSLQYWLFLPSY-LHPPPAIILIADFFQLLFVCLQWQVFNVEQGSQSTNYAGGDNKDILPEVEASLEIPVPDFTTTMASYLDVAKYAVFYHLFWVTMAIVFFAGTNRINIFGLGYVIIVFCFMWFGREFLLKPLRKLLWWWNFLIGYTFIVLLVKISLQLVGCVYMDGVGIAH-CWAVKLFGITCLNSFPKEQHG--------NCEADKNGLGWDVICFAFLLLQRRVYSSHYFRHIVAELEAQRRLASRGAELINRILIREVLLQKERETEVLYTIKKKMEHLKAKQAGLKKSFHEPDEHFQAIRSGDYYLF--------------------------------------------------EDETEEVPESPDQGPTTSLNI------GRSERSGSED----KALGPLQLLSTAIDSGTDTAL----------------------------------------EKAREETDQPVSQHDST---------------PSGDK-------HVAIV-MGT--SVDKVEDEETTKPKESLCSKISNSFSLFIAILVSMANWLIKFFNRISRNYRRVAYTLTDDMRKEKLKIQAEKLTFLSLSAMEEGITTVDSKEAVTRAAEDIGVNKIAVEVDTPQETDIRKSFTKTNLQDIDNAEEENEFELAQPVFYRLLVAYYYMLISRSELVCYFLIVLNQMMSASLLSMPLPIMVFLWGMLSVPRPSKTFWVTVITYTEAIVVLKYLFQFTFFPWNDDDNSKNWKNNPFWPPRILGIEKQDYYAMYDLALLLVLFIHRTILKRYGLWKDAEDITADLAKAEGKELSPPASPQMHDERKFAAAAATAAAVPEKQEYDFDAGQESEVDVPLKKKMIVTQDPKDNSPHITTLEPEPAEETVQKKNILTVLETRFVSVMKPFQNFYRQMTNSAYNAVVDVYAPMFVCDFLAFLIVVFGYWAFGPVQSGEGSVTTYLEENRVPIPFLVMLVVQFMFIIIDRALFLRKCVHGKFIFQVSLVIIVHIWLFFILPAITNRMFIKNVPAMLWYFVKCIYFALSAHQIRSGYPTRILGNFLTKNYSYLNLFLFKGFLVIPFLLELRALMDWMWTDTTLALGSWLQMEDIYANIFVLKCWRHAEATYPTPRALKRKSTIKYGVGGLLLLLIIFIIWFPLVLFSFANTVYEVNPPKTCTVRISLGGYQPLFKMTVQQADIFALDESQYKLLHKFYDTTPRASSFLTSYDPQDITVITINGESTSVWGISPPSQKKLIRDLMDAKHMDMDLDVSFTRGKRSPQSPGTFSKQFQVT----LTNDTASKLAQIISGGNSSQLVAIPKLFYPFMRLQNNGIVSVVHPLMKEKEEPDIYLGFRSGNIS---KSSGRVDWWYVSEETDLNIWKPNSKSNASRLILVT---FNDRIAPATFSLI-TGYGIIGLYVSMVFVIGRFARMFVSEVSFRIMFMELPRVDNILKLCLDIYLVRECSDLCLEEELFAKLIFLYRSPETMIRWTK 2084          
BLAST of Piezo-type mechanosensitive ion channel component vs. TrEMBL
Match: A0A0L8GD76 (Piezo-type mechanosensitive ion channel component OS=Octopus bimaculoides OX=37653 GN=OCBIM_22035390mg PE=3 SV=1)

HSP 1 Score: 1017.68 bits (2630), Expect = 0.000e+0
Identity = 711/2160 (32.92%), Postives = 1113/2160 (51.53%), Query Frame = 1
Query: 1498 KERPLLLSIINTMISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNL--PELPTIFRISSSEMQSSEIGLHKSLIPTGPLAAMMSFLVVFWLTLRLFMTDEKINKSKICNEKISTQQKLEHYFGNVDNATYEKFVKCLKEKCENYWIFSCCFAMLFVSVNGSIVLFRIXXXXXXXXXXXXXXXSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIIQVRYFHSRFLELTSMKQTQVCVESERERVKSSKDEMDKNKFSVKNTVEFIRDVNNMVFTATE----------------KLKSLYTLTQPS-------IWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSASIVILKMIYQIKIFQTFNWLTNCSQYGNFANSSM-----EIIDNAKWLGLEKLENFQL--HILKWTAILVGCAVWHIVRYHQMQFYKLNLDQKPKTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNVLWLPYMIFLGILLPVQYVICVGLPPGLCIEYPLNVI--PKLRQWLYLPNYKVSPVPGKIL-ADFVQYIFVVLQYQVFQMEKRKKSDSHKLVKQR-LLEGFQKSIH---KDFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCINPMSWEIRGIHGKNADKQCSSVASGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLXXXXXXXXXXXXXXXXLNRIERKIKKIEQRQAQHGKP--ELNEHYLVMRSGDYYLFXXXXXXXXXXXXXXXXXXMVGSNTISLESNLPTSSVGKDISVSTDSQRHLEDDSNSLDRHTNENKRKSIGIILEKNEQEDEKSGDDDLSLIGTLNPLQLINAVVKEGPKQAIRQYKRXXXXXXXXXXLRVNLDMLPNEYESCCIENPDVSPSEEVRENSFRSSTVHDNSTNFPQYHNLHLHTPIPSENETRYQSSHNTAIVNTGTESSVDPVSN--GNQRLESSWENFKNVIKLCVCFIGSTMASLTVLFNEWTREYYR-------NIRK-----------------LEEEKKLVKSHVLSTFIEID---EKLGQEIEKFVK-DGRKSVS----EDKEEKNKQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLPVPEH-RIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLWRDHSEFYKDIK----------------------------------------ISNEEEVN------------------HIQPLKPQSAMRT----------GIKFRNPIKQLKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKL-KEKLSIPRASLKINMQAVCERPSTDSKST-EKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTL-SEANSL--HQNQNNTYL-----NISLSMKTDNAMMWWEVNEIIQGQSYCPNPDSPAKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQ 7515
            ++R ++ S++  +++ S++LT +AMMAWS+ + SW +F+FLL +C +W++P SR  CL  SP+IV YA +L+ IQ+IYG +L   ELPT   I   +M  +EIG  K   P G LA  + + +VF LTLR  M ++++ K     +     + ++ Y    D +T +   + +      YWIF C   ML +++   +  +R++Y++  +YF+++F LSY+ WR  M +FWW VI Y++  L  IY +QF +     +N TGLS+E+L D+GL+++    L + L  P  FL+++IIQV YFH  F+ L+ + +        RE  K    +M   +           DV N   T TE                + +SL+     +       +WRL E H  K +   I+ V   +V A++ + ++I+ +     +   ++   L + +A +++ K  +Q+ + +  +W  NC+   + +   M     E I+N  W+GLEK+++  L  +++ + AIL+  A   IVRYHQ Q YK +  ++PK  +IF  V    + +   D+LKY  N+ F K GLE+ +I T +   +R+D YS++Y + L   L++ R     +W  Y++ L +LLP+QY+  +G   GLC EYP   +  P L+ WL+LP+Y + P P  IL ADF Q +FV LQ+QVF +E+  +S ++     + +L   + S+     DF +  +SY+D  K+ VFY  +W+T+AI+F  G   I +FGLGY++I F ++W G+  L+   + L+   N ++ Y F+V+L K   QL+GCV+M+ +     CW V LF I C+N    E  G         C +  +GL WDV+CF F++LQR ++++  F  +  +L  Q + +SRGA LIN  +++ +  QK+ E + L  I++K++ ++ +QA   K   E +EH+  +RSGDYYLF                                                  ED++  +    ++    S+ I         E+SG +D      L PLQL++  +  G   A+                                        E+ RE + +  + HD++               PS ++       + AIV  GT  SVD V +    +  ES      N   L +  + S    L   FN  +R Y R       ++RK                 +EE    V S    T    D    K+  E++   + D RKS +    +D +   +++ F  ++  F+ LL+++  + I  SE  CYFL+++N ++S +LLS+P P +VF WGMLSVPRPSK FW+ +ITYTE ++V KY+ QF     N     ++ + +P   P ILGIEK   YA+ D+  LL LF+HR+ LK  GLW+D  +   D+                                            E EV+                  HI  L+P+ A  T            +F + +K  + FY +MTN   N  VDVYA MF+C+F A LI++ GY++FGP     G    +++ N+ P+PF+ M++ QF+FIIIDRALFLRK V GKF+FQ+  VI++H WLFF LP IT R F    P  L YF+KC+YFALS++Q+RSGYP RILGNFLT+NY+Y NL  FK ++ IPFL ELR +MDWMWTD+++A   W+++EDI++ IFVLKCWR+ E  +PT R   R+  +KY +G L+L+   F IW PL++ SF    +   PP  C+  I++G Y PLF  + ++ ++  L +  ++ + + +     +  +L S++P D T I I+  S +VW I+PP  KKL ++ +      + +++     + S  S  T  K  + T    LTN   + L  +I+   +S  V +P +F  F+      + S  + L   + + + YL     NIS   K+   + WW V+E      + PN  S A + + +T   FN+RI+   F  I + YGI+G+Y +  FV+ RF R F S +S+ I   ELP VD I KL  +IYLVRE   L LEE+L AKLIFLYRS ETMI+WT+
Sbjct:   84 EKRSVIASVLIYIMNQSYVLTLIAMMAWSITFHSWLTFVFLLGACLIWMVPKSRRACLVVSPMIVIYAEVLLTIQFIYGLDLNDQELPT--NIKGVKM--AEIGFIKPHTPCGNLALQILYTLVFLLTLRQHMREKQLKKETTNEDSPMDSEFVDGY----DGSTIKHIGRYIWSLLSKYWIFICAGMMLTIAIQDRVA-YRLIYLIFFLYFVILFQLSYTIWRLTMYIFWWVVIIYSMAILCIIYTYQFSQFPEYWRNSTGLSKEMLEDLGLQQYDVQGLFEKLLTPTSFLIVIIIQVHYFHQPFMNLSCLDRYL------REMPKFEGIDMTAEE-------GLTTDVTNQTSTDTEAEPSKRPKHWRKELLLRCRSLWKRANDTWNYVSQYLWRLTEIHIYKVVGFTIMVVAAKEVSAISAVYVIILALFLLLVKCRLLLSHILQIYTALVLLAKTSFQMSVARVTDWENNCTDTWSNSTDEMDYPFNETINNNIWIGLEKVDSNYLPNYLVNYVAILLIIAFQSIVRYHQHQHYKHSEHRRPKEGIIFCNVTREDADKGIIDVLKYFANYFFYKFGLEICYITTAITISVRVDAYSILYAIFLAALLLMNRRNNARVWPVYVLILTVLLPLQYMSSLGFLLGLCTEYPWKEMLKPSLQYWLFLPSY-LHPPPAIILIADFFQLLFVCLQWQVFNVEQGSQSTNYAGGDNKDILPEVEASLEIPVPDFTTTMASYLDVAKYAVFYHLFWVTMAIVFFAGTNRINIFGLGYVIIVFCFMWFGREFLLKPLRKLLWWWNFLIGYTFIVLLVKISLQLVGCVYMDGVGIAH-CWAVKLFGITCLNSFPKEQHG--------NCEADKNGLGWDVICFAFLLLQRRVYSSHYFRHIVAELEAQRRLASRGAELINRILIREVLLQKERETEVLYTIKKKMEHLKAKQAGLKKSFHEPDEHFQAIRSGDYYLF--------------------------------------------------EDETEEVPESPDQGPTTSLNI------GRSERSGSED----KALGPLQLLSTAIDSGTDTAL----------------------------------------EKAREETDQPVSQHDST---------------PSGDK-------HVAIV-MGT--SVDKVEDEETTKPKESLCSKISNSFSLFIAILVSMANWLIKFFNRISRNYRRVAYTLTDDMRKEKLKIQAEKLTFLSLSAMEEGITTVDSKEAVTRAAEDIGVNKIAVEVDTPQETDIRKSFTKTNLQDIDNAEEENEFELAQPVFYRLLVAYYYMLISRSELVCYFLIVLNQMMSASLLSMPLPIMVFLWGMLSVPRPSKTFWVTVITYTEAIVVLKYLFQFTFFPWNDDDNSKNWKNNPFWPPRILGIEKQDYYAMYDLALLLVLFIHRTILKRYGLWKDAEDITADLAKAEGKELSPPASPQMHDERKFAAAAATAAAVPEKQEYDFDAGQESEVDVPLKKKMIVTQDPKDNSPHITTLEPEPAEETVQKKNILTVLETRFVSVMKPFQNFYRQMTNSAYNAVVDVYAPMFVCDFLAFLIVVFGYWAFGPVQSGEGSVTTYLEENRVPIPFLVMLVVQFMFIIIDRALFLRKCVHGKFIFQVSLVIIVHIWLFFILPAITNRMFIKNVPAMLWYFVKCIYFALSAHQIRSGYPTRILGNFLTKNYSYLNLFLFKGFLVIPFLLELRALMDWMWTDTTLALGSWLQMEDIYANIFVLKCWRHAEATYPTPRALKRKSTIKYGVGGLLLLLIIFIIWFPLVLFSFANTVYEVNPPKTCTVRISLGGYQPLFKMTVQQADIFALDESQYKLLHKFYDTTPRASSFLTSYDPQDITVITINGESTSVWGISPPSQKKLIRDLMDAKHMDMDLDVSFTRGKRSPQSPGTFSKQFQVT----LTNDTASKLAQIISGGNSSQLVAIPKLFYPFMRLQNNGIVSVVHPLMKEKEEPDIYLGFRSGNIS---KSSGRVDWWYVSEETDLNIWKPNSKSNASRLILVT---FNDRIAPATFSLI-TGYGIIGLYVSMVFVIGRFARMFVSEVSFRIMFMELPRVDNILKLCLDIYLVRECSDLCLEEELFAKLIFLYRSPETMIRWTK 2075          
BLAST of Piezo-type mechanosensitive ion channel component vs. TrEMBL
Match: A0A0L8GD87 (Piezo-type mechanosensitive ion channel component OS=Octopus bimaculoides OX=37653 GN=OCBIM_22035390mg PE=3 SV=1)

HSP 1 Score: 1015.76 bits (2625), Expect = 0.000e+0
Identity = 710/2153 (32.98%), Postives = 1111/2153 (51.60%), Query Frame = 1
Query: 1498 KERPLLLSIINTMISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNL--PELPTIFRISSSEMQSSEIGLHKSLIPTGPLAAMMSFLVVFWLTLRLFMTDEKINKSKICNEKISTQQKLEHYFGNVDNATYEKFVKCLKEKCENYWIFSCCFAMLFVSVNGSIVLFRIXXXXXXXXXXXXXXXSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIIQVRYFHSRFLELTSMKQTQVCVESERERVKSSKDEMDKNKFSVKNTVEFIRDVNNMVFTATE----------------KLKSLYTLTQPS-------IWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSASIVILKMIYQIKIFQTFNWLTNCSQYGNFANSSM-----EIIDNAKWLGLEKLENFQL--HILKWTAILVGCAVWHIVRYHQMQFYKLNLDQKPKTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNVLWLPYMIFLGILLPVQYVICVGLPPGLCIEYPLNVI--PKLRQWLYLPNYKVSPVPGKIL-ADFVQYIFVVLQYQVFQMEKRKKSDSHKLVKQR-LLEGFQKSIH---KDFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCINPMSWEIRGIHGKNADKQCSSVASGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLXXXXXXXXXXXXXXXXLNRIERKIKKIEQRQAQHGKP--ELNEHYLVMRSGDYYLFXXXXXXXXXXXXXXXXXXMVGSNTISLESNLPTSSVGKDISVSTDSQRHLEDDSNSLDRHTNENKRKSIGIILEKNEQEDEKSGDDDLSLIGTLNPLQLINAVVKEGPKQAIRQYKRXXXXXXXXXXLRVNLDMLPNEYESCCIENPDVSPSEEVRENSFRSSTVHDNSTNFPQYHNLHLHTPIPSENETRYQSSHNTAIVNTGTESSVDPVSN--GNQRLESSWENFKNVIKLCVCFIGSTMASLTVLFNEWTREYYR-------NIRK-----------------LEEEKKLVKSHVLSTFIEID---EKLGQEIEKFVK-DGRKSVS----EDKEEKNKQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLPVPEH-RIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLWRDHSEFYKDIK----------------------------------------ISNEEEVN------------------HIQPLKPQSAMRT--GIKFRNPIKQLKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKL-KEKLSIPRASLKINMQAVCERPSTDSKST-EKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTL-SEANSL--HQNQNNTYL-----NISLSMKTDNAMMWWEVNEIIQGQSYCPNPDSPAKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQH 7518
            ++R ++ S++  +++ S++LT +AMMAWS+ + SW +F+FLL +C +W++P SR  CL  SP+IV YA +L+ IQ+IYG +L   ELPT   I   +M  +EIG  K   P G LA  + + +VF LTLR  M ++++ K     +     + ++ Y    D +T +   + +      YWIF C   ML +++   +  +R++Y++  +YF+++F LSY+ WR  M +FWW VI Y++  L  IY +QF +     +N TGLS+E+L D+GL+++    L + L  P  FL+++IIQV YFH  F+ L+ + +        RE  K    +M   +           DV N   T TE                + +SL+     +       +WRL E H  K +   I+ V   +V A++ + ++I+ +     +   ++   L + +A +++ K  +Q+ + +  +W  NC+   + +   M     E I+N  W+GLEK+++  L  +++ + AIL+  A   IVRYHQ Q YK +  ++PK  +IF  V    + +   D+LKY  N+ F K GLE+ +I T +   +R+D YS++Y + L   L++ R     +W  Y++ L +LLP+QY+  +G   GLC EYP   +  P L+ WL+LP+Y + P P  IL ADF Q +FV LQ+QVF +E+  +S ++     + +L   + S+     DF +  +SY+D  K+ VFY  +W+T+AI+F  G   I +FGLGY++I F ++W G+  L+   + L+   N ++ Y F+V+L K   QL+GCV+M+ +     CW V LF I C+N    E  G         C +  +GL WDV+CF F++LQR ++++  F  +  +L  Q + +SRGA LIN  +++ +  QK+ E + L  I++K++ ++ +QA   K   E +EH+  +RSGDYYLF                                                  ED++  +    ++    S+ I         E+SG +D      L PLQL++  +  G   A+                                        E+ RE + +  + HD++               PS ++       + AIV  GT  SVD V +    +  ES      N   L +  + S    L   FN  +R Y R       ++RK                 +EE    V S    T    D    K+  E++   + D RKS +    +D +   +++ F  ++  F+ LL+++  + I  SE  CYFL+++N ++S +LLS+P P +VF WGMLSVPRPSK FW+ +ITYTE ++V KY+ QF     N     ++ + +P   P ILGIEK   YA+ D+  LL LF+HR+ LK  GLW+D  +   D+                                            E EV+                  HI  L+P+ A  T    KF + +K  + FY +MTN   N  VDVYA MF+C+F A LI++ GY++FGP     G    +++ N+ P+PF+ M++ QF+FIIIDRALFLRK V GKF+FQ+  VI++H WLFF LP IT R F    P  L YF+KC+YFALS++Q+RSGYP RILGNFLT+NY+Y NL  FK ++ IPFL ELR +MDWMWTD+++A   W+++EDI++ IFVLKCWR+ E  +PT R   R+  +KY +G L+L+   F IW PL++ SF    +   PP  C+  I++G Y PLF  + ++ ++  L +  ++ + + +     +  +L S++P D T I I+  S +VW I+PP  KKL ++ +      + +++     + S  S  T  K  + T    LTN   + L  +I+   +S  V +P +F  F+      + S  + L   + + + YL     NIS   K+   + WW V+E      + PN  S A + + +T   FN+RI+   F  I + YGI G+Y ++  ++ RFLR    N+   I   ELP VDRI KL  +IYLVRE  + RLEE L AKLIFLYRS ET+IKWT+ 
Sbjct:   84 EKRSVIASVLIYIMNQSYVLTLIAMMAWSITFHSWLTFVFLLGACLIWMVPKSRRACLVVSPMIVIYAEVLLTIQFIYGLDLNDQELPT--NIKGVKM--AEIGFIKPHTPCGNLALQILYTLVFLLTLRQHMREKQLKKETTNEDSPMDSEFVDGY----DGSTIKHIGRYIWSLLSKYWIFICAGMMLTIAIQDRVA-YRLIYLIFFLYFVILFQLSYTIWRLTMYIFWWVVIIYSMAILCIIYTYQFSQFPEYWRNSTGLSKEMLEDLGLQQYDVQGLFEKLLTPTSFLIVIIIQVHYFHQPFMNLSCLDRYL------REMPKFEGIDMTAEE-------GLTTDVTNQTSTDTEAEPSKRPKHWRKELLLRCRSLWKRANDTWNYVSQYLWRLTEIHIYKVVGFTIMVVAAKEVSAISAVYVIILALFLLLVKCRLLLSHILQIYTALVLLAKTSFQMSVARVTDWENNCTDTWSNSTDEMDYPFNETINNNIWIGLEKVDSNYLPNYLVNYVAILLIIAFQSIVRYHQHQHYKHSEHRRPKEGIIFCNVTREDADKGIIDVLKYFANYFFYKFGLEICYITTAITISVRVDAYSILYAIFLAALLLMNRRNNARVWPVYVLILTVLLPLQYMSSLGFLLGLCTEYPWKEMLKPSLQYWLFLPSY-LHPPPAIILIADFFQLLFVCLQWQVFNVEQGSQSTNYAGGDNKDILPEVEASLEIPVPDFTTTMASYLDVAKYAVFYHLFWVTMAIVFFAGTNRINIFGLGYVIIVFCFMWFGREFLLKPLRKLLWWWNFLIGYTFIVLLVKISLQLVGCVYMDGVGIAH-CWAVKLFGITCLNSFPKEQHG--------NCEADKNGLGWDVICFAFLLLQRRVYSSHYFRHIVAELEAQRRLASRGAELINRILIREVLLQKERETEVLYTIKKKMEHLKAKQAGLKKSFHEPDEHFQAIRSGDYYLF--------------------------------------------------EDETEEVPESPDQGPTTSLNI------GRSERSGSED----KALGPLQLLSTAIDSGTDTAL----------------------------------------EKAREETDQPVSQHDST---------------PSGDK-------HVAIV-MGT--SVDKVEDEETTKPKESLCSKISNSFSLFIAILVSMANWLIKFFNRISRNYRRVAYTLTDDMRKEKLKIQAEKLTFLSLSAMEEGITTVDSKEAVTRAAEDIGVNKIAVEVDTPQETDIRKSFTKTNLQDIDNAEEENEFELAQPVFYRLLVAYYYMLISRSELVCYFLIVLNQMMSASLLSMPLPIMVFLWGMLSVPRPSKTFWVTVITYTEAIVVLKYLFQFTFFPWNDDDNSKNWKNNPFWPPRILGIEKQDYYAMYDLALLLVLFIHRTILKRYGLWKDAEDITADLAKAEGKELSPPASPQMHDERKFAAAAATAAAVPEKQEYDFDAGQESEVDVPLKKKMIVTQDPKDNSPHITTLEPEPAEETVQKKKFVSVMKPFQNFYRQMTNSAYNAVVDVYAPMFVCDFLAFLIVVFGYWAFGPVQSGEGSVTTYLEENRVPIPFLVMLVVQFMFIIIDRALFLRKCVHGKFIFQVSLVIIVHIWLFFILPAITNRMFIKNVPAMLWYFVKCIYFALSAHQIRSGYPTRILGNFLTKNYSYLNLFLFKGFLVIPFLLELRALMDWMWTDTTLALGSWLQMEDIYANIFVLKCWRHAEATYPTPRALKRKSTIKYGVGGLLLLLIIFIIWFPLVLFSFANTVYEVNPPKTCTVRISLGGYQPLFKMTVQQADIFALDESQYKLLHKFYDTTPRASSFLTSYDPQDITVITINGESTSVWGISPPSQKKLIRDLMDAKHMDMDLDVSFTRGKRSPQSPGTFSKQFQVT----LTNDTASKLAQIISGGNSSQLVAIPKLFYPFMRLQNNGIVSVVHPLMKEKEEPDIYLGFRSGNIS---KSSGRVDWWYVSEETDLNIWKPNSKSNASRLILVT---FNDRIAPATFSLI-TGYGIAGLYVSFILLIARFLRMGTINMHPSIMFRELPFVDRILKLTLDIYLVREMHEFRLEEDLYAKLIFLYRSPETLIKWTRR 2068          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Cavefish
Match: piezo2a.2 (piezo-type mechanosensitive ion channel component 2-like [Source:NCBI gene;Acc:103047759])

HSP 1 Score: 385.571 bits (989), Expect = 5.263e-107
Identity = 219/607 (36.08%), Postives = 359/607 (59.14%), Query Frame = 1
Query: 5728 AMRTGIKFRNPIKQLKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSL---HQNQNNTYLNISLSMK-TDNA----MMWWEVNEIIQGQ-SYCPNPDSPAKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQH 7518
             + T ++   PI+Q   F+  + + + +   DVY +MFL +    +II+ G+++FG  + +       +  ++ P  F+ M++ QF  +++DRAL+LRK V GK +FQ+  V  IH W+FF LP +T+R+F+     QL YF+KC+YF LS+YQ+R GYP R+LGNFLT++YNY NL  F+ +  +PFL ELR VMDW+WTD++++   W+ VEDI++ IFVLKCWR  E  +P  RG+ ++ VVKY +G +I++     +W PL+  S +  +  V   P++ S +I +G + P+F  S+++N ++ +T+  F +    + +   +  +L+++  +D T+  ++  S+++W I+PP  K L E LS       + M    +R  +     E +       +L    +  L++L+N   N   V +  +FP F+    R  S++N+    H   +N Y +I+L +K +DN+      WW V++   G         +  K+   L +++F++++S    G + + YGI+G+YA+   V+ +F+R F+S IS+ I  EELP VDRI KL  +I+LVRE  +L LEE L AKLIFLYRS ETMIKWT+ 
Sbjct: 2229 TIHTTLEIYIPIRQ---FFYNLIHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHS-AAADITSSLSEDQVPEAFLVMVLIQFGTMVVDRALYLRKTVMGKVIFQVILVFGIHFWMFFILPGVTERRFSQNMVAQLWYFVKCIYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFVLKCWRESEKRYPQPRGQKKKKVVKYGMGGMIVMLLICIVWFPLLFMSLVKSVAGVVNKPLDVSVTITLGGFQPIFTMSAQQNQLKDVTEAEFLKFMNSYNYIPGAMQFLEAYTAEDVTEAELEGNSNSLWTISPPSRKSLMEVLS-KEDQFPVTMSWTIQRNLSLGAKAE-VAMDKHVTYLDTNTRQELINLLNGTRNKA-VIIKEVFPCFI----RAPSDSNAKPIDHLYGDNGYKDITLDLKRSDNSSGEIQEWWIVDQPSAGMIDMKSGVKTEQKREAGLRLYVFSDKVSPPSLGFL-AGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPCVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTRE 2823          

HSP 2 Score: 348.206 bits (892), Expect = 1.397e-95
Identity = 337/1266 (26.62%), Postives = 602/1266 (47.55%), Query Frame = 1
Query:  850 VITGFAGIISPXXXXXXXXXXXXXXXTFWACGNNVMTSNFARMRLFLLLYSAAHVCLIFIVQLEFMQLYIPTGQRLSRLLGLYLMFDTNCKNRGEIIFNNQRSID-YVSPFIILYVYYLSAIETRIWLEERKRI---------NKERPAVDKETFIHTESYLSGE---EINQEESQRI---------SNSFNVEIGS-NVSDGPYI-DFTDVPH----VLDAQNSR--STLF----IEEDITKDMEKNQVKERPLLLSIINT---MISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGF-NLPELPTIFRISSSEMQSSEIGLHKSLIPTGPLAAMMSFLVVFWLTLRLFMTDEKINK------SKICNEKIS----------TQQKLEHYFGNVDNATYEKFVKCLKEKCENYWIFSCCFAMLFVSVNGSIVLFRIXXXXXXXXXXXXXXXSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIIQVRYFHSRFLELTSMKQTQVCVESERERV------------------KSSKDE-------MDKNKFSVKNTVEFIRDVNNMVF-TAT----------------EKLKSLYTLTQPSIWRLW------------------ECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSASIVILKMIYQIKIFQTFNWLTNCSQYGNFA--------NSSM--EIIDNAKWLGLEKLENFQLHILKWTAILVGCAVWHIVRYHQMQFYKL-NLDQKPKTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNVL-WLPYMIFLGILLPVQYVICVGLPPGLCIEYPL-----NVIPKLRQWLYLPNYKVSPVPGKILADFVQYIFVVLQYQVFQMEKRKK-----SDSHKLVKQRLLEGF-QKSIHKDFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCINPMSWEIRGIH--GKNADKQCS--SVASGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLXXXXXXXXXXXXXXXXLNRIERKIKKIEQRQAQ 4224
            ++ G  GI+ PSL + VY  ++LG+ T+W+   +     F+ + + + ++SA H+ ++++ Q +F Q  +P     ++L G+  M  +NC +      N +     +V+P ++L +YY  A   R+WL+E +           ++    V++E   + + + + E   EI +    R          SN   V++ S +  +GP   +    PH    + ++ + R  S+++    +++++   +   +  ER  + +++ T   ++  S+I   +AMMAWS+ Y SW +F+FL+ SC LW++   R   +  SP +V Y  LLI++QYI+ F  L  +P +F               K  +P   L + +  L+ FWL LR  +T+ +  +      S I  E  S           Q+++    G+   A   K           YWI+ C     FVS  G IV+++I+YM++ ++ + ++ + Y  WR  +K FW +++ Y +  L+ IY FQF+       N+TGLS+E L D+GL++F  + L   +FIP  FL++ I+ + YFH RFL+LT +K      +S   R+                   S K+E       +D+++  VK   E + +VN++   TAT                + LK+ + L    +  L+                  E H  K +   I++V + +V   N + ++      PF +   +  +   V +  I++ KM+YQ+   Q   +   CS   N+         NS++    +D A W+GL+K      ++     +L   A + +  Y    FY++ N    P +  IF  +      +   +  KY +N+ F K GLE  F+  V V   R+D  ++ +   L+  L  +R     L W  Y  FL  +L  QY+IC+G+PP  C +YP      ++   + +WLYLP+++  P    +L DF+  +   LQ +VF+ E          D+ ++ +      F Q +   DFI  +S Y+D LK ++F + +W  L IIFITG   I++F +GYL+  F +L  G  +L+   KS++   + ++ YN  VI  K I  +  C ++  L T   CW++ LF++ C       I+G     + A+KQC   S  +G+ WD +CF  ++LQR +F +  FL V  D+      +SRGA L    I+K+++ + + E+K ++ ++R++ +I+ RQ +
Sbjct:  257 ILLGLTGIMLPSLTSTVYFFTFLGLCTWWSFCRSFDPLLFSCLCVLMAIFSAGHLIVLYLYQFQFFQEAVPREDNYAKLFGISPMVMSNCSHTWMFEVNPKLEWHHFVNPIMLLVLYYTLATLVRLWLQESEDTMKEKDDDDDDEGEGEVEQELSENMKIHQTAEKKREIWRMAHYRTDEKNVLIVTSNGGPVDLMSLSHENGPVTPELYSTPHYKAGLAESGSERMDSSMYEIDPVQDELPGALSSPEKAER--VNAVVKTFRFIMKQSYICALIAMMAWSITYVSWLTFVFLIWSCTLWMVRDRRKYAMLTSPFMVFYGNLLIVLQYIWSFETLTPVPGLFL--------------KKEVPFRELGSKILCLLSFWLLLRQALTERRERQRDETQLSDIRVEDCSPEKEMEEEPGEQREMMDVLGSTVMAMLNK-----------YWIYICGGMFFFVSFEGRIVMYKIIYMMMFLFCVALYQVHYERWRWMLKYFWMSIVVYTMLVLILIYTFQFESSIHVWSNMTGLSKEKLEDLGLEQFSVAALFTRIFIPTSFLLVCILHLHYFHDRFLQLTDIKSVADKQKSTISRLVHLDGSLADISMIKPEFNASVKEEEMGDRVDLDEDEEDVKKKAEEVEEVNDVYCKTATFTCHIAPAPAPEPVCKDDLKNKWHLVVDRLTVLFLKFLQYIHQLQLLIWWLLELHVIKIVSSYIIWVSVKEVSLFNYVFLVSWAFALPFSQFRPLASSVCTVWTCVIIVCKMLYQLTSIQPETYSKICSMPHNYTELQRIDMNNSTLYSSPVDPANWVGLKKFSPLLENLRNNLLMLALLA-FEVTVYRHQDFYRMRNNLTAPVSRTIFHNITRQHLDDGIVNCAKYFINYFFYKFGLETCFLLAVNVIGQRMDFCAMFHAFGLIAVLYQRRRKAIALVWPKYCCFLACMLTFQYLICIGIPPAACSDYPWRNPSSSMDSNVVKWLYLPDFRTKPNSLFLLYDFMLLLCASLQRRVFEEEDDSAVRLLAGDNVEICRDLDAASFSQHNPVPDFIHCRS-YLDMLKVIMFSYLFWFVLTIIFITGTTRISIFCMGYLVACFYFLLFGGELLLKPIKSILHYWDFLIAYNVFVITMKNILSIAACGYIKALVTNH-CWLIQLFSLACT------IKGYSRPEQQANKQCELPSDEAGIIWDSICFASLLLQRRVFMSYYFLHVVADIRSSQVLASRGAELFQATIVKAVKARIEEEKKSMDLLKRQMDRIKSRQQK 1486          

HSP 3 Score: 117.472 bits (293), Expect = 1.642e-25
Identity = 61/151 (40.40%), Postives = 88/151 (58.28%), Query Frame = 1
Query: 5197 EEKNKQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLPVPEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLWRD 5649
            EE  + + F  S+ +   L  +   + + +SE  CY ++I+NH++S ++ +L  P L+F W MLSVPRPSK FW+  I YTE+ IV KY  QF     N   +   +  P   P I+G+EK   Y   D++QLL LF HRS LK +GLW +
Sbjct: 1959 EELEESERFYSSQPQILQLCYALYNMLVAHSEMVCYLVIILNHMISASVATLVLPILIFLWAMLSVPRPSKRFWMTAIVYTEVTIVIKYFFQFGFFPFN-QNIELDKSKPFHPPNIIGVEKKEGYVHYDLVQLLALFFHRSILKCHGLWDE 2108          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Cavefish
Match: PIEZO2 (piezo type mechanosensitive ion channel component 2 [Source:HGNC Symbol;Acc:HGNC:26270])

HSP 1 Score: 385.185 bits (988), Expect = 6.348e-107
Identity = 225/609 (36.95%), Postives = 362/609 (59.44%), Query Frame = 1
Query: 5731 MRTGIKFRNPIKQLKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCER-----PSTDSKSTEKIVRFTQSRFLTNPEKANLLHLIN-TKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAMMWWEVNE----IIQGQSYCPNPDSPAKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQHWK 7524
            ++  ++   PI+Q   F+  + +   +   DVY +MFL +    +II+ G+++FG     G      +  ++ P PF+ M++ QF  +++DRAL+LRK V GK +FQ+  V  IH W+FF LP +T+R+F+     QL YF+KC+YF LS+YQ+R GYP R+LGNFLT++YNY NL  F+ +  IPFL ELR VMDW+WTD++++   W+ VEDI++ IFVLKCWR  E  +P  RG+ ++ VVKY +G +I++     +W PL+  S +  +  V   P++ S S+ +G + P+F  S+++ N+  +T   F+   +    +  +  +L+++   D T   ++ +S+++W I+PP  K L   L+   +   + M    +R       ++  + +KI+   +    T  + A LL   N T  +   V + +IFPR+L    R  S++N+    Q +T +++ L+   D+   WW VN+    +++ +S   N DSP      L ++IF++++S    G + + YGI+G+Y +   V+ +F+R F+S IS+ I  EELPNVDRI KL  +I+LVRE  +L LEE L AKLIFLYRS ETMIKWT+  K
Sbjct: 2099 LKKAMEIYLPIRQ---FFYNLIHPDYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKH-QGGADITSSLSEDQVPGPFLVMVLIQFGTMVVDRALYLRKTVMGKVIFQVVLVFGIHFWMFFILPGVTERRFSQNRIAQLWYFVKCIYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLIPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFVLKCWRESEKRYPQPRGQKKKKVVKYGMGGMIVMLLICIVWFPLLFMSLVKSVAGVVNTPLDVSVSLTLGGFQPIFTMSAQQKNLNSITSAKFDNFVKHFSKNSFAVQFLEAYVYQDLTVAHLEGSSNSMWTISPPSKKNLIGMLNQADSDFPLTMTWSIQRNLSLGAKSEMATGKKIINLDKE---TKIQLAKLLIETNSTDAHKKPVCIKSIFPRYL----RAPSDSNAKLIEQLSTDIDLFLNRAEDSNKEWWVVNQTKFGLLKLESVKIN-DSPR-----LELYIFSDQVSPPSLGFL-AGYGIMGLYMSVVLVIGKFVREFFSGISHTIMFEELPNVDRILKLCTDIFLVRETGELDLEEDLYAKLIFLYRSPETMIKWTREKK 2689          

HSP 2 Score: 317.39 bits (812), Expect = 3.845e-86
Identity = 275/1031 (26.67%), Postives = 482/1031 (46.75%), Query Frame = 1
Query: 1534 MISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGF-NLPELPTIFRISSSEMQSSEIGLHKSLIPTGPLAAMMSFLVVFWLTLRLFMTD--EKINKSKICNE-KISTQQKLE--------------HYFGNVDNATYEKFVKCLKEKCEN----------------YWIFSCCFAMLFVSVNG--SIVLFRIXXXXXXXXXXXXXXXSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIIQVRYFHSRFLELTSMKQTQVCVESERERVKSS------------------KDEMDKNKFSVKNTVEFIRDVNNMVFTATEKLKSLYTLTQPSI-----------WRL-----------------------W---ECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSASIVILKMIYQIKIFQTFNWLTNCSQYGN----FANSSM---EIIDNAKWLGLEKLENFQLHILKWTAILVGCAVWHIVRYHQMQFYKLNLDQKPKTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNV-LWLPYMIFLGILLPVQYVICVGLPPGLCIEYPL---------NVIPKLRQWLYLPNYKVSPVPGKILADFVQYIFVVLQYQVFQMEKRK-----KSDSHKLVKQRLLEGFQKSIHK---DFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCINPMSWEIRGIHGKNADK-QCSSVASGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLXXXXXXXXXXXXXXXXLNRIERKIKKIEQRQAQHGKPELNEHYLVMRSGD 4275
            ++  S++   +AMM WS+ Y SW +F+FLL SC LW++   R   +  SP +V Y  LL+++QYI+ F  L ++P IF+  +              +P   L++ +  L+ FWL LR  +T+  +K+ +  + +E  + T++K E              H+   V  A  EK V+  ++  EN                YWI+ C      VS      I ++++ YM++ ++ + ++ + +  WRR +K FW +V+ Y +  ++ IY  QF         +TG+S E L  +GLK+F+ ++L + +FIP  FL++ I+ + YFH  FLELT +K       +   R+                     K++ +K    V+  +E  +  +++  ++ E  +     T P I           W L                       W   E H  K +   I+ VC+ +V  +N +L+       P+ +  T+  +   V +  I+  KM YQ++  +  N+   C +  N    + N S+   + +D A W+GL K +    ++     I+   A    +  HQ  F + N    P +  IF ++          + +KY +N+ F K G+E+ F+  V V   R+D YS+++   L   +  +R      +W  Y  FL  ++  QY +C+G+PP  C +YP          NVI    +WL+LP++   P    +L DF+  +   LQ QVF  E +        D+ ++ +   L+    S+H    DFI  + SY+D LK ++F + +W  L IIFITG   I++F +GYL+  F +L  G  +L+   K L+   + ++ YN  VI  K IF L+ C +++ ++ K  CW++ L ++ C       I+     N D+       +G+ WD +CF F++LQR +F +  FL V  D+      +SRGA L    I+K++  + + E K + +++R++ +I+ RQ +  K +     +   SGD
Sbjct:  396 IMKQSYVCALIAMMTWSITYVSWLTFVFLLWSCALWMVRDRRKYAMLTSPFMVAYGNLLLVLQYIWSFETLKDVPDIFKTPT--------------VPFSELSSKVLCLLSFWLLLRQTLTERQDKLKEEAVLSEVTVETEKKGETQTRPENKWFTGHKHFKIFVCFADEEKQVE--EDGMENDLVQVVGKLVMAMLVKYWIYICGSMFFLVSFEDVDHIAMYKVFYMMMFLFCVAMYQVDFERWRRILKYFWMSVVVYTMLVVILIYTCQFTTSVPFWSKVTGVSTESLGKLGLKQFEVTELFRRIFIPTSFLLVCILHLHYFHEHFLELTDIKTIIHMAYNLLYRLAHPDGSLADLTMMSSSPEPLLKEDKEKEVLVVEAIMEEKKKDDSVQLSSHEGSQQCSVATDPEIPSEQSSDLKSKWHLVVDRLTVLFLKFLEYFHKLQLFIWWLLEMHIVKIVPFYIILVCVKEVSLLNYVLLASWAFALPYRQFRTLASSICIVWTCVIITCKMFYQLETIEPRNYSVECLKPENITDVYINQSLLYTDPVDPANWVGLRKSKELLTYLTNDLLIVAILAFEVTIYRHQEYFRRHNKLSPPPSRTIFHDITRQHLDNGIINCIKYFINYSFYKFGVEVCFLLAVNVIGQRMDFYSMLHAFALAAVMYRRRRKAIAEIWPKYCCFLACMITFQYAMCIGIPPAACSDYPWRFPSSTTNSNVI----KWLFLPDFSTRPNSMFLLYDFMLLLSASLQRQVFDEENKAAVRLMAGDNVEICRD--LDAASFSVHNPVPDFIHCR-SYLDMLKVIMFSYLFWFVLTIIFITGTTRISIFCMGYLVACFYFLLFGGELLLKPIKKLLHYWDFLIAYNVFVITMKNIFSLLACGYIDSMQ-KNSCWLIQLLSLACT------IKEYTPPNTDRCDLPKDEAGIIWDSICFSFLLLQRRVFMSYYFLHVVADIRAGQILASRGAELFQASIVKAVRARLEEENKSMEQLKRQMDRIKTRQQKFKKGKEKMLSMTQESGD 1396          

HSP 3 Score: 214.157 bits (544), Expect = 7.814e-55
Identity = 174/619 (28.11%), Postives = 294/619 (47.50%), Query Frame = 1
Query: 2605 IWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSASIVILKMIYQIKIFQTFNWLTNCSQYGN----FANSSM---EIIDNAKWLGLEKLENFQLHILKWTAILVGCAVWHIVRYHQMQFYKLNLDQKPKTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNV-LWLPYMIFLGILLPVQYVICVGLPPGLCIEYPL---------NVIPKLRQWLYLPNYKVSPVPGKILADFVQYIFVVLQYQVFQMEKRKK-----SDSHKLVKQRLLEGFQKSIHK---DFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCINPMSWEIRGIHGKNADK-QCSSVASGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLXXXXXXXXXXXXXXXXLNRIERKIKKIEQRQAQHGK--------------------PELNEH------------YLVMRSGDYYLF 4287
            IW L E H  K +   I+ VC+ +V  +N +L+       P+ +  T+  +   V +  I+  KM YQ++  +  N+   C +  N    + N S+   + +D A W+GL K +    ++     I+   A    +  HQ  F + N    P +  IF ++          + +KY +N+ F K G+E+ F+  V V   R+D YS+++   L   +  +R      +W  Y  FL  ++  QY +C+G+PP  C +YP          NVI    +WL+LP++   P    +L DF+  +   LQ QVF  E +        D+ ++ +   L+    S+H    DFI  +S Y+D LK ++F + +W  L IIFITG   I++F +GYL+  F +L  G  +L+   K L+   + ++ YN  VI  K IF L+ C +++ ++ K  CW++ L ++ C       I+     N D+       +G+ WD +CF F++LQR +F +  FL V  D+      +SRGA L    I+K++  + + E K + +++R++ +I+ RQ +  K                    PE  +               V+RSGDYYLF
Sbjct:  828 IWWLLEMHIVKIVPFYIILVCVKEVSLLNYVLLASWAFALPYRQFRTLASSICIVWTCVIITCKMFYQLETIEPRNYSVECLKPENITDVYINQSLLYTDPVDPANWVGLRKSKELLTYLTNDLLIVAILAFEVTIYRHQEYFRRHNKLSPPPSRTIFHDITRQHLDNGIINCIKYFINYSFYKFGVEVCFLLAVNVIGQRMDFYSMLHAFALAAVMYRRRRKAIAEIWPKYCCFLACMITFQYAMCIGIPPAACSDYPWRFPSSTTNSNVI----KWLFLPDFSTRPNSMFLLYDFMLLLSASLQRQVFDEENKAAVRLMAGDNVEICRD--LDAASFSVHNPVPDFIHCRS-YLDMLKVIMFSYLFWFVLTIIFITGTTRISIFCMGYLVACFYFLLFGGELLLKPIKKLLHYWDFLIAYNVFVITMKNIFSLLACGYIDSMQ-KNSCWLIQLLSLACT------IKEYTPPNTDRCDLPKDEAGIIWDSICFSFLLLQRRVFMSYYFLHVVADIRAGQILASRGAELFQASIVKAVRARLEEENKSMEQLKRQMDRIKTRQQKFKKGKEKMLSMTQESGDGQNLIPPEEEDDDDAFVFTFPTFLLSVVRSGDYYLF 1432          

HSP 4 Score: 113.235 bits (282), Expect = 3.511e-24
Identity = 65/167 (38.92%), Postives = 94/167 (56.29%), Query Frame = 1
Query: 5197 EEKNKQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLPVPEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLW--RDHSEFYKDIKISNEE 5691
            EE    + F +++     L  +   + + +SE   Y ++I+NH++S ++++L  P L+F W MLSVPRPSK FW+  I YTE+ IV KY  QF+    N   +  ++  P   P I+G+EK   Y   D+IQLL LF HRS LK +GLW   D     KD  +  EE
Sbjct: 1819 EELEGSERFYKTQPLGLQLCYALYNLLVAHSEMVSYLVIILNHMISASMVTLVLPILIFLWAMLSVPRPSKRFWMTAIVYTEVTIVIKYFFQFSFFPFNQNMIDRNK--PYHPPNIIGVEKKDGYVHYDLIQLLTLFFHRSILKCHGLWDEDDPKAKKKDTPLHREE 1983          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Cavefish
Match: piezo2a.2 (piezo-type mechanosensitive ion channel component 2-like [Source:NCBI gene;Acc:103047759])

HSP 1 Score: 382.874 bits (982), Expect = 4.072e-106
Identity = 220/599 (36.73%), Postives = 356/599 (59.43%), Query Frame = 1
Query: 5758 PIKQLKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLP--SKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSL---HQNQNNTYLNISLSMK-TDNA----MMWWEVNEIIQGQ-SYCPNPDSPAKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQH 7518
            PI+Q   F+  + + + +   DVY +MFL +    +II+ G+++FG  + +       +  ++ P  F+ M++ QF  +++DRAL+LRK V GK +FQ+  V  IH W+FF LP +T+R+F+     QL YF+KC+YF LS+YQ+R GYP R+LGNFLT++YNY NL  F+ +  +PFL ELR VMDW+WTD++++   W+ VEDI++ IFVLKCWR  E  +P  RG+ ++ VVKY +G +I++     +W PL+  S +  +  V   P++ S +I +G + P+F  S+++N ++ +T+  F  +  C+    P  +  +L+++  +D T+  ++  S+++W I+PP  K L E LS       + M    +R  +     E +       +L    +  L++L+N   N   V +  +FP F+    R  S++N+    H   +N Y +I+L +K +DN+      WW V++   G         +  K+   L +++F++++S    G + + YGI+G+YA+   V+ +F+R F+S IS+ I  EELP VDRI KL  +I+LVRE  +L LEE L AKLIFLYRS ETMIKWT+ 
Sbjct: 2092 PIRQ---FFYNLIHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHS-AAADITSSLSEDQVPEAFLVMVLIQFGTMVVDRALYLRKTVMGKVIFQVILVFGIHFWMFFILPGVTERRFSQNMVAQLWYFVKCIYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFVLKCWRESEKRYPQPRGQKKKKVVKYGMGGMIVMLLICIVWFPLLFMSLVKSVAGVVNKPLDVSVTITLGGFQPIFTMSAQQNQLKDVTEAEFLNLM-CNICFFPQGAMQFLEAYTAEDVTEAELEGNSNSLWTISPPSRKSLMEVLS-KEDQFPVTMSWTIQRNLSLGAKAE-VAMDKHVTYLDTNTRQELINLLNGTRNKA-VIIKEVFPCFI----RAPSDSNAKPIDHLYGDNGYKDITLDLKRSDNSSGEIQEWWIVDQPSAGMIDMKSGVKTEQKREAGLRLYVFSDKVSPPSLGFL-AGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPCVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTRE 2677          

HSP 2 Score: 354.755 bits (909), Expect = 1.387e-97
Identity = 335/1222 (27.41%), Postives = 593/1222 (48.53%), Query Frame = 1
Query:  850 VITGFAGIISPXXXXXXXXXXXXXXXTFWACGNNVMTSNFARMRLFLLLYSAAHVCLIFIVQLEFMQLYIPTGQRLSRLLGLYLMFDTNCKNRGEIIFNNQRSID-YVSPFIILYVYYLSAIETRIWLEERK---------RINKERPAVDKETFIHTESYL---SGEEINQEESQRISNSFNVEIGS-NVSDGPYI-DFTDVPHVLDAQNSRSTLF----IEEDITKDMEKNQVKERPLLLSIINT---MISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGF-NLPELPTIFRISSSEMQSSEIGLHKSLIPTGPLAAMMSFLVVFWLTLRLFMTDEKINK------SKICNEKIS----------TQQKLEHYFGNVDNATYEKFVKCLKEKCENYWIFSCCFAMLFVSVNGSIVLFRIXXXXXXXXXXXXXXXSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIIQVRYFHSRFLELTSMKQTQVCVESERERV----KSSKD-EMDKNKFSV-KNTVEF------------------IRDVNNMVFTATEKLKSLYT-------LTQPSIWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSASIVILKMIYQIKIFQTFNWLTNCSQYGNFA--------NSSM--EIIDNAKWLGLEKLENFQLHILKWTAILVGCAVWHIVRYHQMQFYKL-NLDQKPKTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNVL-WLPYMIFLGILLPVQYVICVGLPPGLCIEYPL-----NVIPKLRQWLYLPNYKVSPVPGKILADFVQYIFVVLQYQVFQMEKRKK-----SDSHKLVKQRLLEGF-QKSIHKDFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCINPMSWEIRGIH--GKNADKQCS--SVASGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLXXXXXXXXXXXXXXXXLNRIERKIKKIEQRQAQ 4224
            ++ G  GI+ PSL + VY  ++LG+ T+W+   +     F+ + + + ++SA H+ ++++ Q +F Q  +P     ++L G+  M  +NC +      N +     +V+P ++L +YY  A   R+WL+E +          I+     V + +++    Y+   +G +I  +     SN   V++ S +  +GP   +    PH   A+   S+++    +++++   +   +  ER  + +++ T   ++  S+I   +AMMAWS+ Y SW +F+FL+ SC LW++   R   +  SP +V Y  LLI++QYI+ F  L  +P +F               K  +P   L + +  L+ FWL LR  +T+ +  +      S I  E  S           Q+++    G+   A   K           YWI+ C     FVS  G IV+++I+YM++ ++ + ++ + Y  WR  +K FW +++ Y +  L+ IY FQF+       N+TGLS+E L D+GL++F  + L   +FIP  FL++ I+ + YFH RFL+LT +K      +S   R+     S  D  M K +F++ ++TV+                     D+ N      ++L  L+          Q  IW L E H  K +   I++V + +V   N + ++      PF +   +  +   V +  I++ KM+YQ+   Q   +   CS   N+         NS++    +D A W+GL+K      ++     +L   A + +  Y    FY++ N    P +  IF  +      +   +  KY +N+ F K GLE  F+  V V   R+D  ++ +   L+  L  +R     L W  Y  FL  +L  QY+IC+G+PP  C +YP      ++   + +WLYLP+++  P    +L DF+  +   LQ +VF+ E          D+ ++ +      F Q +   DFI  +S Y+D LK ++F + +W  L IIFITG   I++F +GYL+  F +L  G  +L+   KS++   + ++ YN  VI  K I  +  C ++  L T   CW++ LF++ C       I+G     + A+KQC   S  +G+ WD +CF  ++LQR +F +  FL V  D+      +SRGA L    I+K+++ + + E+K ++ ++R++ +I+ RQ +
Sbjct:  215 ILLGLTGIMLPSLTSTVYFFTFLGLCTWWSFCRSFDPLLFSCLCVLMAIFSAGHLIVLYLYQFQFFQEAVPREDNYAKLFGISPMVMSNCSHTWMFEVNPKLEWHHFVNPIMLLVLYYTLATLVRLWLQESEDTSAVIDLCSISACMQCVLQCSYVQFVQYVNAVTGVKILSQVLIVTSNGGPVDLMSLSHENGPVTPELYSTPH-YKAERMDSSMYEIDPVQDELPGALSSPEKAER--VNAVVKTFRFIMKQSYICALIAMMAWSITYVSWLTFVFLIWSCTLWMVRDRRKYAMLTSPFMVFYGNLLIVLQYIWSFETLTPVPGLFL--------------KKEVPFRELGSKILCLLSFWLLLRQALTERRERQRDETQLSDIRVEDCSPEKEMEEEPGEQREMMDVLGSTVMAMLNK-----------YWIYICGGMFFFVSFEGRIVMYKIIYMMMFLFCVALYQVHYERWRWMLKYFWMSIVVYTMLVLILIYTFQFESSIHVWSNMTGLSKEKLEDLGLEQFSVAALFTRIFIPTSFLLVCILHLHYFHDRFLQLTDIKSVADKQKSTISRLVHLDGSLADISMIKPEFNILQHTVDLNTLFLSRSCMYPDPLSCLCADLKNKWHLVVDRLTVLFLKFLQYIHQLQLLIWWLLELHVIKIVSSYIIWVSVKEVSLFNYVFLVSWAFALPFSQFRPLASSVCTVWTCVIIVCKMLYQLTSIQPETYSKICSMPHNYTELQRIDMNNSTLYSSPVDPANWVGLKKFSPLLENLRNNLLMLALLA-FEVTVYRHQDFYRMRNNLTAPVSRTIFHNITRQHLDDGIVNCAKYFINYFFYKFGLETCFLLAVNVIGQRMDFCAMFHAFGLIAVLYQRRRKAIALVWPKYCCFLACMLTFQYLICIGIPPAACSDYPWRNPSSSMDSNVVKWLYLPDFRTKPNSLFLLYDFMLLLCASLQRRVFEEEDDSAVRLLAGDNVEICRDLDAASFSQHNPVPDFIHCRS-YLDMLKVIMFSYLFWFVLTIIFITGTTRISIFCMGYLVACFYFLLFGGELLLKPIKSILHYWDFLIAYNVFVITMKNILSIAACGYIKALVTNH-CWLIQLFSLAC------TIKGYSRPEQQANKQCELPSDEAGIIWDSICFASLLLQRRVFMSYYFLHVVADIRSSQVLASRGAELFQATIVKAVKARIEEEKKSMDLLKRQMDRIKSRQQK 1399          

HSP 3 Score: 117.087 bits (292), Expect = 2.617e-25
Identity = 61/151 (40.40%), Postives = 88/151 (58.28%), Query Frame = 1
Query: 5197 EEKNKQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLPVPEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLWRD 5649
            EE  + + F  S+ +   L  +   + + +SE  CY ++I+NH++S ++ +L  P L+F W MLSVPRPSK FW+  I YTE+ IV KY  QF     N   +   +  P   P I+G+EK   Y   D++QLL LF HRS LK +GLW +
Sbjct: 1806 EELEESERFYSSQPQILQLCYALYNMLVAHSEMVCYLVIILNHMISASVATLVLPILIFLWAMLSVPRPSKRFWMTAIVYTEVTIVIKYFFQFGFFPFN-QNIELDKSKPFHPPNIIGVEKKEGYVHYDLVQLLALFFHRSILKCHGLWDE 1955          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Cavefish
Match: piezo1 (piezo-type mechanosensitive ion channel component 1 [Source:ZFIN;Acc:ZDB-GENE-041111-255])

HSP 1 Score: 360.147 bits (923), Expect = 2.848e-99
Identity = 322/1214 (26.52%), Postives = 568/1214 (46.79%), Query Frame = 1
Query:  928 TFWACGNNVMTSNFARMRLFLLLYSAAHVCLIFIVQLEFMQLYIPTGQRLSRLLGLY-LMFDTNCKNRGEIIFNNQRSID-YVSPFIILYVYYLSA----IETRIWLE-------ERKRINKERPAVDKETFIHTESYLSGEEINQEESQRISNSFNVEIGSNVSDGPYIDFTDVPHVLDAQNSRSTLFIEEDITKDMEKNQVKERPLLLSIINTMISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNL-PELPTIFRISSSEMQSSEIGLHKSLIPTGPLAAMMSFLVVFWLTLRLFMTDEKINKSKICNEKISTQQKLEHYFGNVDNATYEKFVKCLKEKCENYWIFSCCFAMLFVSVNGSIVLFRIXXXXXXXXXXXXXXXSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIIQVRYFHSRFLELTSMKQT------QVCVESERERVKSSK------DEMDKNKFSVKNTVEFIRDVNNMVFTATEKLKSLYTLTQPSIWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVM--VTALFVCSASIVILKMIYQIKIFQTFNWLTNCS---------QYGNFANSSM--EIIDNAKWLGLEKLENFQLHILKWTAILVGCAVWHIVRYHQMQFYKLNLDQKPKTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNV-LWLPYMIFLGILLPVQYVICVGLPPGLCIEYPLN----------VIPKLRQWLYLPNYKVSPVPGKILADFVQYIFVVLQYQVFQMEKRK-------KSDSHKLVKQRLLEGFQKSIHKDFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCINPMSWEIRGIHGKNADKQCSSVA--SGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLXXXXXXXXXXXXXXXXLNRIERKIKKIEQRQAQHG---KPELNE--------------------------------HYLVMRSGDYYLF 4287
            T+WAC   +    F  + + +  ++A H+  +++ Q +  Q         +RL GL  ++   NC +   +I N +     YV+P I+L +Y   A    I T  + E       E K+    R + D +T    +  L+  E   +ES   +   +V  GS   D                           ++    + + +E   LL +   ++  S+I   +AMM WS+ Y SW +F+ LL +C +W++   R   +  SP I+ Y   L  +QY++  +L PELP         M   ++GL ++  P   L AM+ F + FWL LR  + D    K K   +    Q+         D++  +   + +      YWI+ C    + VS  G +V ++IVYM+L +  + ++ + YS WRR +K FWW V+ Y +  L++IY +QF+      +N TG +EE L DIGL+ F+ S+L  S+ IP  FL+  I+Q+ YFH  F+++T ++        +V   SE    +         D+  ++   V +    + D   ++F    K   + TL Q  +WR+ E H  K +   +V+V +++   MN++L+++     P+ R   +   ++ ++VC   I++ KM+YQ+ I     +  NC+         +     NS++  + +D A W G  K      +      +L+       V  HQ+  Y+      P    IF +       +     +KY LN+ F K GLE+ F+ TV V   R++   + +   L+  ++ +R +    +W  Y +FL I +  QY++CVG+PP LCI+YP            +    +  LY     V       +ADF+  +    Q++VF+ EK++       +++ +     RL   F  +   +FI+ + SY+D +K +VF + +W  LA++F+TG   I++FGLGYLL +F +L  G  +LI +  + +   + ++ YN  VI++K I  ++ CVF+  ++ +  CW++ LF++ C     ++   ++    DK+CS     +G+ WD +CFFF++LQR +F +  FL V  DL    + +SRG  L    I+K++   K++E+K + +++  +++I  +Q ++    KP   E                                H  V+ SGDYYLF
Sbjct:  196 TWWACHFPISHLGFNALCVMVSFFTAGHLVCLYLYQSDLAQTIFTPDSLWARLFGLKDIIIPANCSSSDALILNTEHDWPVYVNPGILLLLYITVATILKISTHSYSEVGSGEEVELKQWGAGRKSPDDDT---KQMLLASGESPGQESNPTNTKEHVTNGSGQHD-------------------------LGLSTSAVQQEEEEDSALLLVGRMIMQQSYICALIAMMVWSITYHSWLTFVLLLWACLIWMLRARRHFAMLCSPFILLYGLGLCCLQYVWAMHLEPELPQ----HVGYMSLRQMGLDRATYPCLRLGAMLLFTLTFWLLLRQSVKDIFWRKKK---QTAPLQEVTTGENTGRDDSILKLLGRVVMSLYAKYWIYVCGGMFIMVSFAGKLVGYKIVYMLLFLLCMCLYQVYYSLWRRLLKPFWWLVVAYTMLVLIAIYTYQFEDFPDYWRNFTGFTEEQLSDIGLETFKLSELFTSIMIPGFFLLACILQLHYFHKPFMKITDLEHVTPLHRPEVLQSSEGRGFEEEDLQTDLGDDESEDGVMVPSKWGLVMDRLMVLF---RKFSDILTLIQAFLWRILELHILKIVAFFVVWVALLEPSVMNLVLVVLWSFAMPYARFRPMASCLSTVWVC--VIIVCKMLYQLSIVNPNEYSNNCTVPLSNETSLEMNEIVNSTLYKDPVDPANWFGFRKAATALGYSKNHLLVLLLLVFEATVYRHQVHHYRQLQRSPPTIPAIFPQATRDKLDQGLLPCIKYLLNYSFYKFGLEICFLMTVNVIGQRMNFLVIFHGCWLVAIMVRRRRVAIAKIWSKYCLFLVIFMIYQYILCVGIPPALCIDYPWRWKTSVTINSMLCEHFKCKLYCLCVCVCVCVCVCVADFLLLMCASQQWKVFENEKKEEWMVLGGENNDNPDPMDRL--PFNPA--PNFINCR-SYLDMMKVLVFRYMFWFVLAVVFVTGSTRISVFGLGYLLASFFFLLFGTRLLIKRSCTRLLMWDCLIIYNVTVIISKNILSILACVFVADMQAR-FCWVIQLFSLVCTVKDYYDPASLN----DKECSLPVEEAGIIWDSICFFFLLLQRRVFLSFYFLHVTADLQASARQASRGFELFRASIIKNMRFHKQAEKKSIQQLKNSMQRIRDKQQKYKEGRKPSEREEQPTESQEELERKQRKERKTSKHKEWHRPWIDHATVLHSGDYYLF 1359          

HSP 2 Score: 347.051 bits (889), Expect = 2.738e-95
Identity = 218/611 (35.68%), Postives = 357/611 (58.43%), Query Frame = 1
Query: 5713 LKPQSAMRTGIKFRNPIKQLKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIV-RFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANS-LHQNQNNTYLNISLSMKTD------NAMMWWEVNEIIQGQSYCPNPDSPAKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQH 7518
            LK +SA  +G+  R+  +   +F+  + + +     DVYA+MFL +    +II+ G+++FG  + +   A   +  ++ P  F+ M++ QF  ++IDRAL+LRK V GK +FQI  V  IH W+FF LP +T+R FN  F  QL YF+KC+YF LS+YQ+R GYP RILGNFLT+ YN+ NL  F+ +  +PFL ELR VMDW+WTD++++  +WM VEDI++ IF++KC R  E  +P  +G+ ++ +VKY +G LI+ F    IW PL+  S +  +  V   P++ + ++ +G Y PLF  S ++ +++P T+  +  + E    +  +  ++  +  +D     I+ +S +VW I+PP  +++ ++L    A + + +    +R      + E    + + +    NP +A+L  L+     +  V +P +FP ++ A     ++  S L++     Y N++LS+  D       A  WW+++          + D  +     L + IFN+++S    G + + YGI+G+Y +   V+ +F+R F+S IS+ I  EELP VDRI KL  +I+LVRE  +L LEE+L +KLIFLYRS ETMIKWT+ 
Sbjct: 1881 LKLKSAFISGV--RSVYRPTHRFFHNILHAEYRAATDVYALMFLTDVVDFIIIVFGFWAFGKHSAAADIA-STLSEDQVPEAFLVMLLIQFSTMVIDRALYLRKAVLGKLIFQIILVFGIHLWMFFILPAVTERMFNQNFVAQLWYFVKCIYFTLSAYQVRCGYPTRILGNFLTKKYNHLNLFLFQGFRLVPFLVELRAVMDWVWTDTTLSLSNWMCVEDIYANIFIIKCSRETEKKYPQPKGQKKKKIVKYGMGGLIVFFLICIIWFPLLFISLVRSVVGVVNHPVDVTVTVKLGGYEPLFTMSVQQQSIQPFTEADYNHLTELFGSNAVAMQFITLYSYEDIVTANIEGSSGSVWRISPPSRQEVIKELLGSPADMTLRLAWNFQRDLNKGGTVENTFDKHSINLEPGNPVRADLASLLVGN-RTEPVRVPHMFPNYIRAPNGAEAKPVSQLYEGDEEGYQNVTLSLMRDGSLNGSGAQEWWDIS--------VADCDQSSGACGVLPMIIFNDKVSPPSLGFL-AGYGIMGLYVSVVLVIGKFVRGFFSEISHSIMFEELPCVDRILKLCTDIFLVRETGELELEEELYSKLIFLYRSPETMIKWTRE 2478          

HSP 3 Score: 120.168 bits (300), Expect = 2.611e-26
Identity = 64/155 (41.29%), Postives = 94/155 (60.65%), Query Frame = 1
Query: 5197 EEKNKQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLPVPEHRID---PLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLWRDH 5652
            EE      F  S+++   LL +   V   +SE  CYF++++N+ ++ +++SL  P L+F W ML+VPRPSK+FW+  I YTE+++V KY+ QF     N     E R++   P   P ILG+EK+  Y   D++QLL LF HRS L+  GLW DH
Sbjct: 1591 EELVHSRDFYSSQNRMLKLLFALYNVLACHSELACYFIIVLNNAVTASVISLVLPILIFLWAMLAVPRPSKSFWMTAIVYTEVMVVVKYLFQFGFFPWN--SEYETRLNENKPFFPPRILGLEKTDNYIRYDLLQLLALFFHRSLLQRYGLW-DH 1742          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Cavefish
Match: piezo1 (piezo-type mechanosensitive ion channel component 1 [Source:ZFIN;Acc:ZDB-GENE-041111-255])

HSP 1 Score: 68.1662 bits (165), Expect = 5.005e-11
Identity = 63/282 (22.34%), Postives = 129/282 (45.74%), Query Frame = 1
Query: 6466 YSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIV-RFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTD------NAMMWWEVNEIIQGQSYCPNPDSPAKKYLFLTIFIFNERISDNIFGHIFSSYGILG 7287
            Y +G LI+ F    IW PL+  S +  +  V   P++ + ++ +G Y PLF  S ++ +++P T+  +  + E    +  +  ++  +  +D     I+ +S +VW I+PP  +++ ++L    A + + +    +R      + E    + + +    NP +A+L  L+    N T+  +P +FP ++ A     +EA  + Q     Y N++LS+  D       A  WW+++          + D  +     L + IFN++    +    FS + + G
Sbjct:   44 YGMGGLIVFFLICIIWFPLLFISLVRSVVGVVNHPVDVTVTVKLGGYEPLFTMSVQQQSIQPFTEADYNHLTELFGSNAVAMQFITLYSYEDIVTANIEGSSGSVWRISPPSRQEVIKELLGSPADMTLRLAWNFQRDLNKGGTVENTFDKHSINLEPGNPVRADLASLLVG--NRTD-RVPHMFPNYIRAPNG--AEAKPVSQLYEEGYQNVTLSLMRDGSLNGSGAQEWWDIS--------VADCDQSSGACGVLPMIIFNDKDHGAVRIRDFSLHHVRG 312          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009619.1 (pep scaffold:Pmarinus_7.0:GL484020:1370:4517:1 gene:ENSPMAG00000008693.1 transcript:ENSPMAT00000009619.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 122.865 bits (307), Expect = 1.032e-31
Identity = 61/129 (47.29%), Postives = 85/129 (65.89%), Query Frame = 1
Query: 7132 WWEVNEIIQGQSYCPNPDSPAKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQH 7518
            WW + ++          D P ++   + I +F++R+S    G + + YGILG+YA+   VV +F+R F+S IS+ I  EELPNVDR+ KL  +I+LVRE  +L+LEE L AKLIFLYRS ETMIKWT+ 
Sbjct:   75 WWSLRQL--------RSDCPGRRCDDIRIIVFSDRVSPPSLGFL-AGYGILGLYASVVLVVGKFVREFFSGISHSIMFEELPNVDRVLKLCTDIFLVRETGELQLEEDLYAKLIFLYRSPETMIKWTRE 194          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Nematostella
Match: EDO30292 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T173])

HSP 1 Score: 194.897 bits (494), Expect = 3.093e-52
Identity = 104/296 (35.14%), Postives = 166/296 (56.08%), Query Frame = 1
Query: 6001 DRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHK-----------------FHLPSKDYLQSFEPD--DATQII---IDYASDNVWLITPPGLKKLKEKL 6822
            DR L+LRK V  K  F +F  +  H ++F  +PY+TKR F    P   +Y   C+YF LS+YQ+RSGYP RILGNFLT++Y   + + F+ +  IPFL ELR+V+DW+ TD+++  YHW+++EDI++ I+VLKC+R  E  W   RG+   ++ K+++G L++      IW PL+  S+I   +   PP + +F++++G Y PLF  S++E  +  L     + +K  H                  F+   K  + +F  D  D   ++   I   S ++W I+PP  + +   L
Sbjct:  184 DRCLYLRKYVFAKLFFLLFLTVSFHVFMFIVVPYVTKRPFFKNIPAIFMYIFMCMYFGLSAYQVRSGYPTRILGNFLTKSYTLTSGVLFQGFQAIPFLLELRSVLDWVCTDTTLTLYHWLKMEDIYANIYVLKCYRESEKTWFQGRGQKYWMLSKWTVGGLLVALLVIVIWFPLLFMSYINSVYTSNPPQDATFTLSIGGYQPLFRVSAQEQFLERLNNTKIDRIKTQHPGLHQGADTQPPLQVAIIFNCVLKIQIDTFLADYHDRGTVVLVKITGNSSSIWQISPPSRQLMMHDL 479          

HSP 2 Score: 93.2041 bits (230), Expect = 4.982e-19
Identity = 41/80 (51.25%), Postives = 64/80 (80.00%), Query Frame = 1
Query: 7279 ILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQH 7518
            I+G+Y  + ++V +F+R F+++ISY I  +E+PNVD++ KL  +I++VRE+K  +LEE L AKL+FLYRS ET+IKWT++
Sbjct:  496 IIGLYVGFVWLVGKFVRLFFTSISYRIMFDEMPNVDKVLKLCLDIFMVRESKSFKLEEDLFAKLMFLYRSPETLIKWTKY 575          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Nematostella
Match: EDO47371 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMM5])

HSP 1 Score: 157.918 bits (398), Expect = 1.427e-41
Identity = 105/360 (29.17%), Postives = 182/360 (50.56%), Query Frame = 1
Query: 3034 KPKTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNVLWLPYMIFLGILLPVQYVICVGLPPGLCIEYPLNVI--PKLRQWLYLPNYKVSPVPGKILADFVQYIFVVLQYQVFQMEKRKKSDSHKLVKQRLLEGFQKSIHKDFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLL-KTKGLCWMVSLFAIQCINPMSWEIRGIHGKNADKQCSSVASGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSR 4104
            +P+  ++F+      + ++    +KY  N  F   G E+S +  VV   +R DV S++Y L L  FL L R    V+W  Y+ FL  LLPVQY++ +G PPGLC+ YP   +  P L  WLYL +      P  +L DF Q +F   Q  V+ +E+   +       ++   G +            +++D+ K  +F   YW+TLA+++IT    +++F  G++L  F +LW GQ + +  +K L+R   + + YN+L +L K   Q++ CV+ + + +    C  + L ++ C+   ++  +   G +     +   +GL  D  CF F++ Q  IFT++ F  V  D   Q++ + R
Sbjct:   10 EPEPGILFESASRQKADDDMLQCVKYLFNRFFYHFGWEVSLVVMVVNMAVRCDVTSVIYALWLGSFLALGRQSSAVIWPVYVGFLAFLLPVQYLLVLGWPPGLCLAYPWTKVLDPNLSHWLYLTDVSFPSDPKLLLGDFFQLLFACCQENVYGLERYSWTAEETEQSRQTRRGSRVKFSTPDFMWNITWLDFCKVTLFQHMYWVTLAVVYITVQSTVSIFNFGFILWCFFFLWHGQALYLQPRKKLLRLWKLFICYNYLTLLAKVCLQVVACVWQDYVTQYTSNCLPLQLLSMFCLRNSTYSGKPQTGMDC---VAPDDTGLAMDCACFTFLLTQYRIFTSEYFRHVVRDHREQSEMAYR 366          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Nematostella
Match: EDO47370 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMM3])

HSP 1 Score: 126.716 bits (317), Expect = 2.444e-29
Identity = 86/269 (31.97%), Postives = 138/269 (51.30%), Query Frame = 1
Query: 5221 FRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLPVPE--HRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLWR------DHSEFYKDIKISNEEEVN--------HIQPLKPQSAM------RTGIKFRNPI-KQLKKFYGKMTNRKLNK-RVDVYAIMFLCEFTAMLIIILGYFSF-GPGTDSGGHAIDFIKTNKTP 5952
            ++ S  +     ++F    + +++  CY L+I+NH++   LLS+P PFLVF WGMLS+PRP+K +WI +ITYT++VIV KY+ +F    +N     +   + DPL    I+GIE+    +  D++ LL L+ HR  LK +GLWR      DH E Y+     N  +          ++    P S         +G    N I + +K F  ++ + ++    VDVYAIMF C+F   +II+  + +F  P        +  ++ N  P
Sbjct:  222 WKHSHMRVARFSVAFVYALLAHTDIICYLLMILNHMVYACLLSMPLPFLVFMWGMLSIPRPTKRYWITVITYTQIVIVIKYLFKFQFKFINNCNSSDGPDKNDPLCPARIIGIERDSHTSAYDLLLLLALYFHRYSLKVHGLWRDKAAHDDHDELYEPPLSPNSPKSEPTPFAGSRNMAASSPDSEQYQSDVEDSGESLWNKICRSVKAFLNRIYDPEVGSGAVDVYAIMFACQFIIFIIILFSWSAFSSPEPQRQAQFVKIVEENVVP 490          

HSP 2 Score: 114.005 bits (284), Expect = 2.291e-25
Identity = 52/144 (36.11%), Postives = 88/144 (61.11%), Query Frame = 1
Query: 6256 LIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECH 6687
            LI    +  IPFL ELR+V+DW+ TD+++  YHW+++EDI++ I+VLKC+R  E  W   RG+   ++ K+++G L++      IW PL+  S+I   +   PP + +F++++G Y PLF  S++E  +  L     + +K  H
Sbjct:  503 LIIIDRFQAIPFLLELRSVLDWVCTDTTLTLYHWLKMEDIYANIYVLKCYRESEKTWFQGRGQKYWMLSKWTVGGLLVALLVIVIWFPLLFMSYINSVYTSNPPQDATFTLSIGGYQPLFRVSAQEQFLERLNNTKIDRIKTQH 646          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Nematostella
Match: EDO47369 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMM2])

HSP 1 Score: 93.5893 bits (231), Expect = 1.008e-22
Identity = 41/83 (49.40%), Postives = 66/83 (79.52%), Query Frame = 1
Query: 7279 ILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQHWKS 7527
            I+G+Y  + ++V +F+R F+++ISY I  +E+PNVD++ KL  +I++VRE+K  +LEE L AKL+FLYRS ET+IKWT++ ++
Sbjct:    1 IIGLYVGFVWLVGKFVRLFFTSISYRIMFDEMPNVDKVLKLCLDIFMVRESKSFKLEEDLFAKLMFLYRSPETLIKWTKYKRA 83          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Nematostella
Match: EDO47372 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMM6])

HSP 1 Score: 87.4261 bits (215), Expect = 1.353e-19
Identity = 48/159 (30.19%), Postives = 87/159 (54.72%), Query Frame = 1
Query: 2008 LKEKCENYWIFSCCFAMLFVSVNGSIVLFRIXXXXXXXXXXXXXXXSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIIQVRYFHSRFLELTSMKQTQVCVESERERVKSSKD 2484
            +K     YWI  CC A L V +   + +++I YM + ++ L+ + +S + WR  ++  WW ++ Y++  LL IY +QF  + +   N TGLS++ L ++GL++   + LL  L  P  F +I++IQ+ +FH  F+ +  ++           R  S+KD
Sbjct:    3 VKSVLAKYWILLCCGAFLLVGLQNEVSVYQIGYMAIFLFILICYQISITTWRLILRPLWWVMVIYSICILLIIYTYQFDNMPLYWHNATGLSDQWLYNLGLRQHTKASLLMELLTPTAFSIIIVIQLHFFHQPFMAMIDLRNA---------RSDSTKD 152          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Medaka
Match: piezo1 (piezo type mechanosensitive ion channel component 1 [Source:NCBI gene;Acc:101175341])

HSP 1 Score: 417.157 bits (1071), Expect = 6.400e-117
Identity = 278/792 (35.10%), Postives = 440/792 (55.56%), Query Frame = 1
Query: 5284 YSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLN-VLPVPEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLWRDHSEFYKD-----------------------IKISNEEEVNHIQPLKPQSAMRTG-------IKFRNPIKQLKK-----FYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANS-----LHQNQNNTYLNISLSMKTDNA------MMWWEVNEIIQGQSYCPNPDSPAKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQ 7515
            +SE  CY ++++N+++S +++S+  P LVF W ML++PRPSK FW+  I YTE+++V KYI QF     N    +  ++  P   P ILG+EK+  Y   D++QLL LF HR+ L    L  +   F  D                       ++   EEE   ++  K Q  + T        +K    +K ++      F+  + + K     DVYA+MFL +    +III G+++FG  + +   A   +  ++ P  F+ M++  F  +IIDRAL+LRK V GK +FQ   V+ IH W+FF LP +T+RKFN  F  QL YF+KC+YF LS+YQ+R GYP RILGNFLT+N+ + NL  F+ +  +PFL ELR VMDW+WTD++++  +WM VEDI++ IF++KC R  E  +P  +G+ ++ +VKY +G LI+ F    IW PL+  S +  +  V   PI+ + ++ +G Y PLF  S ++ +++P     +EE+ +  K +  +  ++  +  +D     I+ +S +VW I+PP  +++ ++L   +  L + +    +R      + E     T  ++  + E  NL+          N   P + P F   Y R  + A +     L++   + YL I+LS+K+D +        WW++   ++G   C  P         L + IFN+++S    G + + YGI+G+Y +   V+ +F+R F+S IS+ I  EELP VDRI KL  +I+LVRE  +L LEE+L +KLIFLYRS ETMIKWT+
Sbjct: 1494 HSELLCYLIIVLNNVVSASVISVVLPILVFLWAMLALPRPSKRFWMTAIVYTEVMVVLKYIFQFGFFSWNSAHEMTVNKDRPFFPPRILGLEKTDNYLRYDLLQLLALFFHRALLMVCTL--NLKSFRPDQEALLAKAAALRKKEALVPEEIHLRAKEEEEEMRLRAKKEQLELETDLTVASARLKVYESLKDVQSSPAQNFFKNLMHNKHQASTDVYALMFLTDMVDFVIIIFGFWAFGKHSAAADIA-STLSEDQVPEAFLVMLLIHFSTMIIDRALYLRKAVLGKLIFQGILVLGIHVWMFFILPSVTERKFNQNFVAQLWYFVKCIYFGLSAYQIRCGYPTRILGNFLTKNFGHLNLFLFQGFRLVPFLVELRAVMDWVWTDTTLSLSNWMCVEDIYANIFIIKCSRETEKKYPQPKGQKKKKIVKYGMGGLIVFFLICIIWFPLLFISLVRSVVGVVNHPIDVTVTVKLGGYEPLFTMSVQQQSIQPFNNSQYEELTKMFKDN-TAMQFITLYSYEDIVTAQIEGSSGSVWRISPPSRQEVIKELLGSQVDLTLRLAWNFQRDLGKGGTVEH----TFDKYSIDLEPGNLVRAELASLLIGNRTEPVLVPNFFPNYIRAPNGAEAKPVSQLYKGGEDGYLGITLSLKSDRSSNSSGTREWWDIA--VEG---CVPPSCGV-----LRMVIFNDKVSPPSLGFL-AGYGIMGLYVSVVLVIGKFVRGFFSEISHSIMFEELPCVDRILKLCTDIFLVRETGELELEEELYSKLIFLYRSPETMIKWTR 2266          

HSP 2 Score: 392.889 bits (1008), Expect = 1.974e-109
Identity = 332/1172 (28.33%), Postives = 559/1172 (47.70%), Query Frame = 1
Query:  928 TFWACGNNVMTSNFARMRLFLLLYSAAHVCLIFIVQLEFMQLYIPTGQRLSRLLGLY-LMFDTNCKNRGEIIFN-NQRSIDYVSPFIILYVYYLSAIETRIWLEERKRINKER-PAVDKETFIHTESYLSGEEINQEESQRISNSFNVEIGSNVSDGPYIDFTDVPHVLDAQNSRSTLFIEEDITKDMEKNQVKERPLLLSIINTMISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNL-PELPTIFRISSSEMQSSEIGLHKSLIPTGPLAAMMSFLVVFWLTLRLFMTDEKINKSKICNEKISTQQKLEHYFGNVDNATYEKFVKCLKEKC-ENYWIFSCCFAMLFVSVNGSIVLFRIXXXXXXXXXXXXXXXSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIIQVRYFHSRFLELTSMKQ--------------TQVCVESERERVKSSKDEMDKNKFSVKNTVEFIRD----VNNMVFTATEKLKSLYTLTQPSIWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVM--VTALFVCSASIVILKMIYQIKIFQTFNWLTNCS-----QYGNFANSSM--EIIDNAKWLGLEKLENFQLHILKWTAILVGCAVWHIVRY-HQMQFYKLNLDQKPKTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXX-XXXXXXXXXXXXCNVLWLPYMIFLGILLPVQYVICVGLPPGLCIEYP----------LNVIPKLRQWLYLPNYKVSPVPGKILADFVQYIFVVLQYQVFQMEKRKK--------SDSHKLVKQRLLEGFQKSIHKDFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCINPMSWEIRGIHGKNADKQCSSVASGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLXXXXXXXXXXXXXXXXLNRIERKIKKIEQRQAQHGKPELNEHYLVMRSGDYYLF 4287
            T+WAC   +    F+ + + +  ++A H+  +++ Q    Q   P     +RL GL   +   NC    E+I N N     YV+P I+L +Y       R     R + +  R P+  K+          G E    E    S         +     ++   + P  L    S + LF+              E P  L +   ++  S++   +AMM WS+ Y SW +F+ LL +C +WI+   R      SP I+ Y  +L  +QYI+   L PELPT    S   M   ++GL K+  P   L AM+ F++ FWL LR  + +    KS       S+Q  L+       N +  K V  +   C   YWI+ C    + VS  G +V ++IVYM+L +  L  + + YS WR  +K+FWW V+ Y +  L++IY +QF+   +  +N+TG ++E L  IGL+ F  S+L  S+ IP  FL+  I+Q+ YFH  F+ +T ++               +   VE   E   S+ +E      + K T E +      V + +   + K   + +  Q  +WRL E H  K +    V+V + +   MN++L+++  +  PF R   +   ++ ++VC   I+I KM+YQ+ +     +  NCS           NSS+  E +D AKW G+ K +   L   K   I++   V+    Y HQ   Y+      P    +F      S  +     LKY +N+ F K GLE+ F+ TV V   R++   L++   M+ + +  +R     +W  Y +FL I +  QY++CVG+PP LC++YP             +  L +WLYLP++   P  G ++ADFV  +    Q++VF  E+ ++        SD  + ++ RL          +FI+ + SY+D LK +VF + +W  L+++FITG   I++FGLGYLL  F +L  G  +++ + ++ +   + ++ YN  VI++K +  ++ CVF+  ++ +  CW++ LF++ C       ++G + ++         +G+ WD  CF  ++LQR +F +  FL V  +L    K +SRG  L    +MK+++  K++E+K L++++R    +    A            V+ SG+YYLF
Sbjct:  198 TWWACHLPISQLGFSALCVMVGFFAAGHIVCLYLYQSLLAQALFPPHSLWARLFGLKDFIVPGNCSLPDELILNTNHDWPVYVNPGILLLLYVTVVAVLRSGSHTRVQGSHPRDPSPLKQQ--------GGPEAPVLEPCPQSRGCRTLERPSPPMTRFLAEHETPLSLLYSYSNAFLFLRPS----------GESPFFL-LGKVVMQQSYVSALIAMMVWSITYHSWLTFVLLLWACLIWILRARRHAATLCSPFILLYGLVLCCLQYIWAMELHPELPT----SVGTMSLRQLGLDKAQYPCLRLGAMLLFVLTFWLLLRQAVMENFRRKS-------SSQTPLQEVATKGQNQSMLKVVGGMVMSCYAKYWIYVCGGMFIMVSFAGKLVAYKIVYMLLFLLCLCFYQVYYSLWRHLLKLFWWLVVAYTMLVLITIYTYQFEDFPVYWKNLTGFTDEQLAAIGLETFDLSELFTSILIPGFFLLACILQLHYFHKPFMRITDLENVTPTHKRRNSDAVGSADAVELNTEEDPSNTEESADEGRTQKTTKELMPSKWGLVMDRLLVLSRKFSEILSKVQVFLWRLLELHILKMVAFFTVWVALQEASVMNLVLVVLWSLATPFCRFRPMASCLSTVWVC--VIIICKMLYQLSVVNPEEYSRNCSTPLTNHTKLLLNSSLYKEPVDPAKWFGIRK-DATALGYSKNHLIVLMLLVFEATVYRHQAHHYRQLQRSPPPIPAVFPSATRDSLDQGLVACLKYLVNYTFYKFGLEICFLMTVNVIGQRMNFLVLIHGCWMVAILVRRRRAAIARIWPKYCLFLSIFMIYQYLLCVGIPPVLCMDYPWRWSNPVLQDWGTLDALIKWLYLPDFFTVPNSGNLMADFVLLMCASQQWKVFDCERTEEWMVLAGENSDEPEPMEGRLFNP-----APNFINCR-SYLDMLKVLVFRYFFWFVLSVVFITGASRISVFGLGYLLGCFFFLLFGTKLMVKRSRTRLILWDCLIIYNVAVIISKSVLSILACVFVFKMQER-FCWVIQLFSLVC------TVKGYYDRDDTCTLPIEEAGILWDGFCFICLLLQRRVFLSFYFLHVSAELQASAKQASRGFELFRASMMKNMDFHKQAEDKSLSQLKRSQTLMSCCAA------------VIHSGEYYLF 1311          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Medaka
Match: PIEZO2 (piezo type mechanosensitive ion channel component 2 [Source:NCBI gene;Acc:101174622])

HSP 1 Score: 370.163 bits (949), Expect = 2.780e-102
Identity = 329/1289 (25.52%), Postives = 591/1289 (45.85%), Query Frame = 1
Query:  850 VITGFAGIISPXXXXXXXXXXXXXXXTFWACGNNVMTSNFARMRLFLLLYSAAHVCLIFIVQLEFMQLYIPTGQRLSRLLGLYLMFDTNCKNRGEI-IFNNQRSIDYVSPFIILYVYYLSAIETRIWLEER----KRINKERPA-----VDKETFIHTESYLSGEEINQEESQR----ISNSFNVEIGSNVSDGPYIDFTDVPHVLDAQNSRSTLFIEEDITKDMEKNQVKERPL--LLSIINTMISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNLPELPTIFRISSSEMQSSEIGLHKSLIPTGPLAAMMSFLVVFWLTLRLFMTD----EKINKSKICNEKISTQ-------------QKLEHYFGNVDNATYEKFVKCLKEKCENYWIFSCCFAMLFVSVNGSIVLFRIXXXXXXXXXXXXXXXSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIIQVRYFHSRFLELTSMKQTQVCVESERERV--------------------------KSSKDEMDK---------NKFSVKNTVEFIRDVNNMVFTATEKLKSLYTLT------------------QPSIWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSASIVILKMIYQIKIFQTFNWLTNCSQYGNFANSSMEII-DNAKWLGLEKLENFQLHILKWTAILVGCAVWHIVRYHQMQFYKLNLDQKPKTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNV-LWLPYMIFLGILLPVQYVICVGLPPGLCIEYP--LNVIPKLRQWLYLPNYKVSPVPGKILADFVQYIFVVLQYQVFQMEKRKK-----SDSHKLVKQRLLEGFQKSIHK---DFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCINPMSWEIRGIHGKNADKQCSSVA---SGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLXXXXXXXXXXXXXXXXLNRIERKIKKIEQRQ----------------AQHGKPELN--------------------------EHYLVMRSGDYYLF 4287
            ++ G  GII PSL + VY   +L + T+W+      T  F+ M + + +YSA H+ ++++ Q +F Q  +       R+ G+  +  +NC    ++ + ++++   +VSP ++L +YY  A   R+WL+E        + + PA     V    F +T ++++ E +N     R     SN  +++  +  +  P ++F   P     Q   ST       T+D E+N +K++ +  ++ + + ++  S+I   +AMMAWS+ Y SW +F+FL+ SC LW++   R   + +SP +V Y  L+I++QY + F   +    F +                 P   L++ M  ++ FWL LR  +T+    +K   + + +  +  Q             Q + H FG++  A   K           YWI+ C     FVS  G+IV+++I+YM++ +  + ++ + + +WRR +K FW +V+ Y +  L  +Y FQF         +  +  E L D+GL++F  S L   +FIP  FL++ I+ + YFH  FL+LT +   Q  +  E+  +                           SS+   D              +K  + F+  +   +F  +  LKS + L                   Q  IW L E H  K +   I+ + + +V  +N + ++      P+ +   +  +   V +  I++ KM+YQ+K      +  +CS    F +   +I  D   W GL+K E+   ++     +L   A    +  HQ+ F   N    P   +IF ++            +KY +N+ F K GLE   +  V V   R+D Y++++   L+  +  +R      +W  Y  FL  +L  QY +C+G+PP  C +YP        + +WLY+P++   P P  ++ DF+  +   +Q QVF+ E +        D+ ++   R L+    S+H    DFI  +S Y+D LK ++F + +W  L IIFITG   I++F +GYL+  F +L  G  +L+   K ++   + ++ YN  VI  K I  ++ C +++ L     CW++ LF++ C       I+G   K A      +    +G+ WD +CF F++LQR +F +  FL V  D+      +SRGA L    I+K+++ + + E K + +++R++++I+ RQ                +  G+P +                           +H  ++RSGDYYLF
Sbjct:  197 ILLGMTGIILPSLTSFVYFSIFLFLCTWWSLCRTFNTLIFSCMCVLMAIYSAGHIIVLYLYQFQFFQESVSPQDEYIRVFGISPIVQSNCSCTWKLSVHSDRKWYHFVSPIMLLVLYYTLATLIRLWLQEPIDHLMVSSADTPAEHQLNVPFLLFGNTCAFIT-ETLNVISDDRQNGPTSNGTSLDFMATENGPPCLNFYSTPQYKMDQPGDSTEDSAAKETED-EENDIKKKGVGAMVKVFHFVMKQSYICALIAMMAWSITYVSWLTFVFLMWSCILWMVRDRRRYAMMSSPFMVAYGNLIIVLQYFWSFERAKPVAGFFVEKKN-------------PFHSLSSKMLCMLSFWLLLRQTLTERQEKQKEESAGLSDVHVEDQKKKEEEESKEEEEQDIMHVFGSMVMAVLVK-----------YWIYICGGMFFFVSFEGNIVMYKIIYMMMFLSCVALYQVHFEYWRRILKYFWMSVVIYTMLVLTVVYTFQFDGSKDFWSGMLNVKNESLNDLGLEQFSVSTLFTRIFIPTSFLLVCILHLHYFHDHFLQLTDL---QAVIAKEQSTIYSHAKVSGRVYLIVNRWVSARFLWHPPSSQFTFDSLPVATRRWSGSLCLKKMLSFLSKLG-FLFLLSIDLKSKWHLVVDRLTVLFLKFLEYFHKLQLFIWWLLEIHIIKIVSCYIILLTLYEVSLLNFVFLVCWAFALPYSQYRPLASSICTVWTCVIIVCKMLYQLKTINPPPF--DCSYVCTFTSLLYKIPGDPGNWWGLKKTEDLLGYLRNNLLMLALLAFEVTIYRHQLYFRLRNKLSPPAAPIIFHDITRQHLDMGITYFIKYFINYFFYKFGLETCLLLVVNVIGQRMDFYAMLHAFALIAVMYRRRRKAIAEIWSKYCFFLACMLTFQYFVCIGIPPAACKDYPWSFTTDSNVIKWLYIPDFYKKPDPLFLIYDFMLLLCASMQRQVFEDENKAAVRLIAGDNVEIC--RDLDAASFSVHNPVPDFIHCRS-YLDMLKVIMFSYLFWFVLTIIFITGTTRISIFCMGYLVACFYFLLFGGELLLKPIKKILHYWDFLIAYNIFVITMKNILSILACGYIDSLMENN-CWLIQLFSLSC------TIKGYVIKLASSDTCDIPKNEAGIIWDSICFAFLLLQRRVFMSYYFLHVVADIRASQVLASRGAELFQATIVKAVKARLEEEHKSVEQLKRQMERIKVRQQKFKRGKDKILSLAQESAEGQPVVQPEEDDDDGAQRTKAKPKKKQWWRPWVDHASMVRSGDYYLF 1443          

HSP 2 Score: 356.295 bits (913), Expect = 5.332e-98
Identity = 216/605 (35.70%), Postives = 345/605 (57.02%), Query Frame = 1
Query: 5770 LKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCER-PSTDSKST--EKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVY-------------LPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMK-----TDNAMMWWEVNEIIQGQSYCPNPDSPAKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQH 7518
            +K+F+  + + + +   DVY +MFL +    +II+ G+++FG    S       +  ++ P PF+ M++ QF  +++DRAL+LRK V GK +FQ+  V  IH W+FF LP IT+++FN     Q+ YF+KC+YF LS+YQ+R GYP R+LGNFLT++YNY NL  F+ +  +PFL ELR VMDW+WTD+S++   W+ VEDI++ IF+LKCWR  E  +P  RG+ ++ VVKY +G +I++     +W PL+  S +  +  V   P++ S +I +  + P+F  S+++  +  +TK   +              +L+++ P+D     +  +S+++W I+PP    L + L   +    I +    +R P+ DS     + I+  T    L   +   ++ L   +F     Y             L  + PR++ A  +  S+A S+ Q   N  ++I L+M+     +  A  WW VN+  Q       P    K    L I++F++++S    G + + YGI+G+YA+   V+ +F+R F+S IS+ I  EELPNVDRI KL  +I+LVRE  +L LEE + +KLIFLYRS ETMIKWT+ 
Sbjct: 2167 MKQFFYNLIHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFG--KHSTADITSSLSEDQVPGPFLVMVLIQFGTMVVDRALYLRKTVLGKVIFQVLLVFGIHFWMFFILPIITEKRFNENTVAQMWYFVKCIYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTSLSLSSWICVEDIYAHIFILKCWRESEKRYPQPRGQKKKKVVKYGMGGMIVVLLICIVWFPLLFMSLVKSVAGVVNAPLDVSVTITLAGFQPIFTMSAQQKQLWNVTKTAIQ--------------WLENYTPEDLIIAELKGSSNSLWTISPPSRDNLIDMLR-SQEEFSITVSWSIQRYPNIDSPLMMFDHIIPHTLQLCLKKKKLFYVILLNIFQFLFVIFYFIFFKQNLFRKKTLTKLIPRYIRAPSK--SDATSVEQ-LGNKMIDIHLTMQRAQNDSGQAQEWWIVNQTEQSII----PKIGRKHEAGLEIYVFSDQVSPPSLGFL-AGYGIMGLYASVVLVIGKFVREFFSGISHKIMFEELPNVDRILKLCTDIFLVRETGELDLEEDMYSKLIFLYRSPETMIKWTRE 2746          

HSP 3 Score: 119.783 bits (299), Expect = 3.260e-26
Identity = 70/199 (35.18%), Postives = 105/199 (52.76%), Query Frame = 1
Query: 5197 EEKNKQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLPVPEHRI---DPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLW-RDHSEFYKDIKISNEEEVNHIQPLKPQSAMRTGIKFRNPIKQLKKF 5781
            EE  + D F +++        +   + + +SEF CY ++I+NH++S + +SL  P  +F W MLSVPRPSK +W+  I YTE+ IV KY CQF     +      +R+    P     I+G+EK   Y + D++QLL LF HRS LK +GLW  D  +  K+  +  +E     +P  P S  R     R+    +K F
Sbjct: 1883 EELEQSDHFYQNQPLILQFSYALYNMLVAHSEFVCYLVIIINHMVSASCVSLVLPVTIFLWAMLSVPRPSKRYWMTAIVYTEVTIVIKYFCQFGFFPHS----KNYRLYKNAPYYPANIIGVEKKDGYVLYDLVQLLALFFHRSILKCHGLWDEDDPKERKEASVREKES----EPSSPLSHKR-----RSSTNTMKSF 2068          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Medaka
Match: PIEZO2 (piezo type mechanosensitive ion channel component 2 [Source:NCBI gene;Acc:101174622])

HSP 1 Score: 369.007 bits (946), Expect = 6.273e-102
Identity = 324/1267 (25.57%), Postives = 587/1267 (46.33%), Query Frame = 1
Query:  850 VITGFAGIISPXXXXXXXXXXXXXXXTFWACGNNVMTSNFARMRLFLLLYSAAHVCLIFIVQLEFMQLYIPTGQRLSRLLGLYLMFDTNCKNRGEI-IFNNQRSIDYVSPFIILYVYYLSAIETRIWLEER----KRINKERPA-----VDKETFIHTESYLSGEEINQEESQR----ISNSFNVEIGSNVSDGPYIDFTDVPHVLDAQNSRS-------TLFIEEDITKDME--KNQVKERPL--LLSIINTMISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNLPELPTIFRISSSEMQSSEIGLHKSLIPTGPLAAMMSFLVVFWLTLRLFMTD----EKINKSKICNEKISTQQK--------LEHYFGNVDNATYEKFVKCLKEKCENYWIFSCCFAMLFVSVNGSIVLFRIXXXXXXXXXXXXXXXSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIIQVRYFHSRFLELTSMKQTQVCVESERERVKSSKDEM-DKNKFSVKNTVEFIRDVNNMVF----------------------TATEKLKSLYTLT------------------QPSIWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSASIVILKMIYQIKIFQTFNWLTNCSQYGNFANSSMEII---DNAKWLGLEKLENFQLHILKWTAILVGCAVWHIVRYHQMQFYKLNLDQKPKTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNV-LWLPYMIFLGILLPVQYVICVGLPPGLCIEYP--LNVIPKLRQWLYLPNYKVSPVPGKILADFVQYIFVVLQYQVFQMEKRKK-----SDSHKLVKQRLLEGFQKSIHK---DFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCINPMSWEIRGIHGKNADKQCSSVASGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLXXXXXXXXXXXXXXXXLNRIERKIKKIEQRQ----------------AQHGKPELNEH-------------YLVMRSGDYYLF 4287
            ++ G  GII PSL + VY   +L + T+W+      T  F+ M + + +YSA H+ ++++ Q +F Q  +       R+ G+  +  +NC    ++ + ++++   +VSP ++L +YY  A   R+WL+E        + + PA     V    F +T ++++ E +N     R     SN  +++  +  +  P ++F   P     Q  +        +L  E+   K+ E  +N +K++ +  ++ + + ++  S+I   +AMMAWS+ Y SW +F+FL+ SC LW++   R   + +SP +V Y  L+I++QY + F   +    F +                 P   L++ M  ++ FWL LR  +T+    +K   + + +  +  Q+K        + H FG++  A   K           YWI+ C     FVS  G+IV+++I+YM++ +  + ++ + + +WRR +K FW +V+ Y +  L  +Y FQF         +  +  E L D+GL++F  S L   +FIP  FL++ I+ + YFH  FL+LT ++      +S   R+      + D    S  +    + +    VF                      +  + LKS + L                   Q  IW L E H  K +   I+ + + +V  +N + ++      P+ +   +  +   V +  I++ KM+YQ+K      +  +CS   +    S+      D   W GL+K E+   ++     +L   A    +  HQ+ F   N    P   +IF ++            +KY +N+ F K GLE   +  V V   R+D Y++++   L+  +  +R      +W  Y  FL  +L  QY +C+G+PP  C +YP        + +WLY+P++   P P  ++ DF+  +   +Q QVF+ E +        D+ ++   R L+    S+H    DFI  +S Y+D LK ++F + +W  L IIFITG   I++F +GYL+  F +L  G  +L+   K ++   + ++ YN  VI  K I  ++ C +++ L     CW++ LF++ C       I+G   K          +G+ WD +CF F++LQR +F +  FL V  D+      +SRGA L    I+K+++ + + E K + +++R++++I+ RQ                +  G+P +                + V+RSGDYYLF
Sbjct:  252 ILLGMTGIILPSLTSFVYFSIFLFLCTWWSLCRTFNTLIFSCMCVLMAIYSAGHIIVLYLYQFQFFQESVSPQDEYIRVFGISPIVQSNCSCTWKLSVHSDRKWYHFVSPIMLLVLYYTLATLIRLWLQEPIDHLMVSSADTPAEHQLNVPFLLFGNTCAFIT-ETLNVISDDRQNGPTSNGTSLDFMATENGPPCLNFYSTPQYKMDQPEKKEECVYEVSLPPEDSAAKETEDEENDIKKKGVGAMVKVFHFVMKQSYICALIAMMAWSITYVSWLTFVFLMWSCILWMVRDRRRYAMMSSPFMVAYGNLIIVLQYFWSFERAKPVAGFFVEKKN-------------PFHSLSSKMLCMLSFWLLLRQTLTERQEKQKEESAGLSDVHVEDQKKKGKPYEQDIMHVFGSMVMAVLVK-----------YWIYICGGMFFFVSFEGNIVMYKIIYMMMFLSCVALYQVHFEYWRRILKYFWMSVVIYTMLVLTVVYTFQFDGSKDFWSGMLNVKNESLNDLGLEQFSVSTLFTRIFIPTSFLLVCILHLHYFHDHFLQLTDLQAVIAKEQSTIYRLVDQDGSLPDLTMLSASSVEGVLSEDKPKVFPDQRQSSTDESQHYSAGSEPEPSTEQNLKSKWHLVVDRLTVLFLKFLEYFHKLQLFIWWLLEIHIIKIVSCYIILLTLYEVSLLNFVFLVCWAFALPYSQYRPLASSICTVWTCVIIVCKMLYQLKTINPPPF--DCSYVLSEVKESLLYKIPGDPGNWWGLKKTEDLLGYLRNNLLMLALLAFEVTIYRHQLYFRLRNKLSPPAAPIIFHDITRQHLDMGITYFIKYFINYFFYKFGLETCLLLVVNVIGQRMDFYAMLHAFALIAVMYRRRRKAIAEIWSKYCFFLACMLTFQYFVCIGIPPAACKDYPWSFTTDSNVIKWLYIPDFYKKPDPLFLIYDFMLLLCASMQRQVFEDENKAAVRLIAGDNVEIC--RDLDAASFSVHNPVPDFIHCRS-YLDMLKVIMFSYLFWFVLTIIFITGTTRISIFCMGYLVACFYFLLFGGELLLKPIKKILHYWDFLIAYNIFVITMKNILSILACGYIDSLMENN-CWLIQLFSLSCT------IKGYVIKLDTCDIPKNEAGIIWDSICFAFLLLQRRVFMSYYFLHVVADIRASQVLASRGAELFQATIVKAVKARLEEEHKSVEQLKRQMERIKVRQQKFKRGKDKILSLAQESAEGQPVVQPEEDDDDGMVNPTPTHSVVRSGDYYLF 1481          

HSP 2 Score: 360.533 bits (924), Expect = 2.100e-99
Identity = 214/596 (35.91%), Postives = 338/596 (56.71%), Query Frame = 1
Query: 5770 LKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKL------KEKLSIPRA-SLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMK-----TDNAMMWWEVNEIIQGQSYCPNPDSPAKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQH 7518
            +K+F+  + + + +   DVY +MFL +    +II+ G+++FG    S       +  ++ P PF+ M++ QF  +++DRAL+LRK V GK +FQ+  V  IH W+FF LP IT+++FN     Q+ YF+KC+YF LS+YQ+R GYP R+LGNFLT++YNY NL  F+ +  +PFL ELR VMDW+WTD+S++   W+ VEDI++ IF+LKCWR  E  +P  RG+ ++ VVKY +G +I++     +W PL+  S +  +  V   P++ S +I +  + P+F  S+++  +  +TK   +              +L+++ P+D     +  +S+++W I+PP    L      +E+ SI  + S++ N+    E  S   K+            L    K NL+ L+N   ++ N  +      FLT                 N  ++I L+M+     +  A  WW VN+  Q       P    K    L I++F++++S    G + + YGI+G+YA+   V+ +F+R F+S IS+ I  EELPNVDRI KL  +I+LVRE  +L LEE + +KLIFLYRS ETMIKWT+ 
Sbjct: 2053 MKQFFYNLIHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFG--KHSTADITSSLSEDQVPGPFLVMVLIQFGTMVVDRALYLRKTVLGKVIFQVLLVFGIHFWMFFILPIITEKRFNENTVAQMWYFVKCIYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTSLSLSSWICVEDIYAHIFILKCWRESEKRYPQPRGQKKKKVVKYGMGGMIVVLLICIVWFPLLFMSLVKSVAGVVNAPLDVSVTITLAGFQPIFTMSAQQKQLWNVTKTAIQ--------------WLENYTPEDLIIAELKGSSNSLWTISPPSRDNLIDMLRSQEEFSITVSWSIQRNLSLGAEAESAYGKNV---------MVLNQETKQNLILLLNGAADAANTQVI-----FLTG----------------NKMIDIHLTMQRAQNDSGQAQEWWIVNQTEQSII----PKIGRKHEAGLEIYVFSDQVSPPSLGFL-AGYGIMGLYASVVLVIGKFVREFFSGISHKIMFEELPNVDRILKLCTDIFLVRETGELDLEEDMYSKLIFLYRSPETMIKWTRE 2597          

HSP 3 Score: 118.242 bits (295), Expect = 1.016e-25
Identity = 60/154 (38.96%), Postives = 89/154 (57.79%), Query Frame = 1
Query: 5197 EEKNKQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLPVPEHRI---DPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLWRD 5649
            EE  + D F +++        +   + + +SEF CY ++I+NH++S + +SL  P  +F W MLSVPRPSK +W+  I YTE+ IV KY CQF     +      +R+    P     I+G+EK   Y + D++QLL LF HRS LK +GLW +
Sbjct: 1772 EELEQSDHFYQNQPLILQFSYALYNMLVAHSEFVCYLVIIINHMVSASCVSLVLPVTIFLWAMLSVPRPSKRYWMTAIVYTEVTIVIKYFCQFGFFPHS----KNYRLYKNAPYYPANIIGVEKKDGYVLYDLVQLLALFFHRSILKCHGLWDE 1921          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Medaka
Match: PIEZO2 (piezo type mechanosensitive ion channel component 2 [Source:NCBI gene;Acc:101174622])

HSP 1 Score: 360.147 bits (923), Expect = 1.800e-101
Identity = 304/1172 (25.94%), Postives = 547/1172 (46.67%), Query Frame = 1
Query:  850 VITGFAGIISPXXXXXXXXXXXXXXXTFWACGNNVMTSNFARMRLFLLLYSAAHVCLIFIVQLEFMQLYIPTGQRLSRLLGLYLMFDTNCKNRGEI-IFNNQRSIDYVSPFIILYVYYLSAIETRIWLEER----KRINKERPA-----VDKETFIHTESYLSGEEINQEESQR----ISNSFNVEIGSNVSDGPYIDFTDVPHVLDAQNSRSTLFIEEDITKDME--KNQVKERPL--LLSIINTMISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNLPELPTIFRISSSEMQSSEIGLHKSLIPTGPLAAMMSFLVVFWLTLRLFMTD----EKINKSKICNEKISTQ-------------QKLEHYFGNVDNATYEKFVKCLKEKCENYWIFSCCFAMLFVSVNGSIVLFRIXXXXXXXXXXXXXXXSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIIQVRYFHSRFLELTSMKQTQVCVESERERVKSSKDEM-DKNKFSVKNTVEFIRDVN-------NMVFTATEKLKSLYTLT------------------QPSIWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSASIVILKMIYQIKIFQTFNWLTNCS---QYGNFANSSMEII----------DNAKWLGLEKLENFQLHILKWTAILVGCAVWHIVRYHQMQFYKLNLDQKPKTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNV-LWLPYMIFLGILLPVQYVICVGLPPGLCIEYP--LNVIPKLRQWLYLPNYKVSPVPGKILADFVQYIFVVLQYQVFQMEKRK-----KSDSHKLVKQRLLEGFQKSIHK---DFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCINPMSWEIRGIHGKNADKQCSSVA---SGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSS 4101
            ++ G  GII PSL + VY   +L + T+W+      T  F+ M + + +YSA H+ ++++ Q +F Q  +       R+ G+  +  +NC    ++ + ++++   +VSP ++L +YY  A   R+WL+E        + + PA     V    F +T ++++ E +N     R     SN  +++  +  +  P ++F   P     Q   ST   E+   K+ E  +N +K++ +  ++ + + ++  S+I   +AMMAWS+ Y SW +F+FL+ SC LW++   R   + +SP +V Y  L+I++QY + F   +    F +                 P   L++ M  ++ FWL LR  +T+    +K   + + +  +  Q             Q + H FG++  A   K           YWI+ C     FVS  G+IV+++I+YM++ +  + ++ + + +WRR +K FW +V+ Y +  L  +Y FQF         +  +  E L D+GL++F  S L   +FIP  FL++ I+ + YFH  FL+LT ++      +S   R+      + D    S  +    + +V          +F  +  LKS + L                   Q  IW L E H  K +   I+ + + +V  +N + ++      P+ +   +  +   V +  I++ KM+YQ+K      +  +CS   Q G +    +  +          D   W GL+K E+   ++     +L   A    +  HQ+ F   N    P   +IF ++            +KY +N+ F K GLE   +  V V   R+D Y++++   L+  +  +R      +W  Y  FL  +L  QY +C+G+PP  C +YP        + +WLY+P++   P P  ++ DF+  +   +Q QVF+ E +        D+ ++ +   L+    S+H    DFI  + SY+D LK ++F + +W  L IIFITG   I++F +GYL+  F +L  G  +L+   K ++   + ++ YN  VI  K I  ++ C +++ L     CW++ LF++ C       I+G   K A      +    +G+ WD +CF F++LQR +F +  FL V  D+     F+S
Sbjct:  197 ILLGMTGIILPSLTSFVYFSIFLFLCTWWSLCRTFNTLIFSCMCVLMAIYSAGHIIVLYLYQFQFFQESVSPQDEYIRVFGISPIVQSNCSCTWKLSVHSDRKWYHFVSPIMLLVLYYTLATLIRLWLQEPIDHLMVSSADTPAEHQLNVPFLLFGNTCAFIT-ETLNVISDDRQNGPTSNGTSLDFMATENGPPCLNFYSTPQYKMDQPGDST---EDSAAKETEDEENDIKKKGVGAMVKVFHFVMKQSYICALIAMMAWSITYVSWLTFVFLMWSCILWMVRDRRRYAMMSSPFMVAYGNLIIVLQYFWSFERAKPVAGFFVEKKN-------------PFHSLSSKMLCMLSFWLLLRQTLTERQEKQKEESAGLSDVHVEDQKKKEEEESKEEEEQDIMHVFGSMVMAVLVK-----------YWIYICGGMFFFVSFEGNIVMYKIIYMMMFLSCVALYQVHFEYWRRILKYFWMSVVIYTMLVLTVVYTFQFDGSKDFWSGMLNVKNESLNDLGLEQFSVSTLFTRIFIPTSFLLVCILHLHYFHDHFLQLTDLQAVIAKEQSTIYRLVDQDGSLPDLTMLSASSVEGVLSEVRLSFLSKLGFLFLLSIDLKSKWHLVVDRLTVLFLKFLEYFHKLQLFIWWLLEIHIIKIVSCYIILLTLYEVSLLNFVFLVCWAFALPYSQYRPLASSICTVWTCVIIVCKMLYQLKTINPPPF--DCSYVEQSGKYTGDRVSEVKESLLYKIPGDPGNWWGLKKTEDLLGYLRNNLLMLALLAFEVTIYRHQLYFRLRNKLSPPAAPIIFHDITRQHLDMGITYFIKYFINYFFYKFGLETCLLLVVNVIGQRMDFYAMLHAFALIAVMYRRRRKAIAEIWSKYCFFLACMLTFQYFVCIGIPPAACKDYPWSFTTDSNVIKWLYIPDFYKKPDPLFLIYDFMLLLCASMQRQVFEDENKAAVRLIAGDNVEICRD--LDAASFSVHNPVPDFIHCR-SYLDMLKVIMFSYLFWFVLTIIFITGTTRISIFCMGYLVACFYFLLFGGELLLKPIKKILHYWDFLIAYNIFVITMKNILSILACGYIDSLMENN-CWLIQLFSLSC------TIKGYVIKLASSDTCDIPKNEAGIIWDSICFAFLLLQRRVFMSYYFLHVVADIRASGSFAS 1328          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Medaka
Match: ENSORLT00000004626.2 (pep primary_assembly:ASM223467v1:7:7477416:7483305:1 gene:ENSORLG00000003710.2 transcript:ENSORLT00000004626.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 327.791 bits (839), Expect = 2.553e-97
Identity = 211/597 (35.34%), Postives = 321/597 (53.77%), Query Frame = 1
Query: 5758 PIKQLKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSK-DYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIP---RASLKINMQAVCERPS--TDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAMMWWEVNEIIQGQSYCPNPDSPAKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQHWKS 7527
            PI+Q   F+  + + + +   DVYA+MFL +    ++ I GY++FG  + +     + +  ++ P  F+ M++ QF  +I+DRAL+L+K + GK VFQ+  V  IH W+FF LP +T+R+FN     QL YF+KC+YF LS+YQ++ GYP RILGNFLT+NYNY NL  F+ +  +PFL ELR VMDW+WTD++++   W+ VEDI++ IFVLKCWR  E  +P   G+ ++ VVKY +G  I+      IW PL+  S +     V   P+E S  +++  Y PLF  S++E N+                F L S   +L ++E +D     I   +  +W I+P     + E+LSI     AS+ +N++AV E      D    + IV   +       ++ +L  L               F R ++   +  S A+    +Q                  WW V E        P   S   K   + I +FN+++S +  G + + +GI+G+Y +   V+ +F+R F++ IS  I  EELP VDR+ KL  +I++VRE  ++ LEE L  KLIFLYRS ETMIK T+   S
Sbjct:   25 PIRQ---FFYDIIHPEYSPVCDVYALMFLIDVVNFIVTIYGYWAFGKYS-AVADITESLSEDQVPEAFLVMLLMQFGTMIVDRALYLKKSLLGKCVFQVVLVFGIHFWMFFILPGVTERRFNRNPIAQLWYFVKCIYFGLSAYQIKCGYPNRILGNFLTKNYNYLNLFLFQGFRMVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYANIFVLKCWRESEKKYPHPPGQKKKKVVKYGMGGFIIFALISIIWFPLLFMSLVQSAAGVTNQPVEVSIQLSIAGYEPLFTMSAQEQNLV------------ASLFLLQSAMQFLMNYEAEDIIVAKIKSDASLLWSISPASRAAMIEELSISSHLNASISMNVEAVGEHTVKFNDKALKDGIVSMLKGNSSKPSDRPDLQAL--------------AFFRPMSIKLQQASGASDKEADQ------------------WWVVEEC------SPVLTSSEPKCHSIEIVVFNDKVSPSSLGFL-AGHGIVGLYMSVVLVIGKFVREFFNGISRSIMFEELPCVDRVLKLCTDIFVVRETGEMELEETLFEKLIFLYRSPETMIKMTREKDS 566          
BLAST of Piezo-type mechanosensitive ion channel component vs. Planmine SMEST
Match: SMESG000010240.1 (SMESG000010240.1)

HSP 1 Score: 4754.12 bits (12330), Expect = 0.000e+0
Identity = 2502/2519 (99.33%), Postives = 2509/2519 (99.60%), Query Frame = 1
Query:  100 MSLIYVYIQRFLLRAFLPFILLGCAVARLNGFSFVYXXXXXXXXXXRYHNQPGGQRPVKXXXXXXXXXXXXXXXXNAAVNVSVIFRPDLLANCTDGLTAASHQLGIVNLHGIKYSLLTRXXXXXXXXXXXXXXXXXXXXKMKLESTDVKCKNQIIEEKFPCGISLIKPCEDDPENEATKVEVIIQRSSLSNLKNENQNRNSIPMKPIKSHCSRKVQPTDNYMRKALGIDELHNTKLRHWATQSLFAFFNIVITGFAGIISPXXXXXXXXXXXXXXXTFWACGNNVMTSNFARMRLFLLLYSAAHVCLIFIVQLEFMQLYIPTGQRLSRLLGLYLMFDTNCKNRGEIIFNNQRSIDYVSPFIILYVYYLSAIETRIWLEERKRINKERPAVDKETFIHTESYLSGEEINQEESQRISNSFNVEIGSNVSDGPYIDFTDVPHVLDAQNSRSTLFIEEDITKDMEKNQVKERPLLLSIINTMISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNLPELPTIFRISSSEMQSSEIGLHKSLIPTGPLAAMMSFLVVFWLTLRLFMTDEKINKSKICNEKISTQQKLEHYFGNVDNATYEKFVKCLKEKCENYWIFSCCFAMLFVSVNGSIVLFRIXXXXXXXXXXXXXXXSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIIQVRYFHSRFLELTSMKQTQVCVESERERVKSSKDEMDKNKFSVKNTVEFIRDVNNMVFTATEKLKSLYTLTQPSIWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSASIVILKMIYQIKIFQTFNWLTNCSQYGNFANSSMEIIDNAKWLGLEKLENFQLHILKWTAILVGCAVWHIVRYHQMQFYKLNLDQKPKTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNVLWLPYMIFLGILLPVQYVICVGLPPGLCIEYPLNVIPKLRQWLYLPNYKVSPVPGKILADFVQYIFVVLQYQVFQMEKRKKSDSHKLVKQRLLEGFQKSIHKDFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCINPMSWEIRGIHGKNADKQCSSVASGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLXXXXXXXXXXXXXXXXLNRIERKIKKIEQRQAQHGKPELNEHYLVMRSGDYYLFXXXXXXXXXXXXXXXXXXMVGSNTISLESNLPTSSVGKDISVSTDSQRHLEDDSNSLDRHTNENKRKSIGIILEKNEQEDEKSGDDDLSLIGTLNPLQLINAVVKEGPKQAIRQYKRXXXXXXXXXXLRVNLDMLPNEYESCCIENPDVSPSEEVRENSFRSSTVHDNSTNFPQYHNLHLHTPIPSENETRYQSSHNTAIVNTGTESSVDPVSNGNQRLESSWENFKNVIKLCVCFIGSTMASLTVLFNEWTREYYRNIRKLEEEKKLVKSHVLSTFIEIDEKLGQEIEKFVKDGRKSVSEDKEEKNKQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLPVPEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLWRDHSEFYKDIKISNEEEVNHIQPLKPQSAMRTGIKFRNPIKQLKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAMMWWEVNEIIQGQSYCPNPDSPAKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQHWKSTLEANQVERVSADDADNGLSMISVDNTSRESFVSLVNDHSVKT 7656
            MSLIYVYIQRFLLRAFLPFILLGCAV RLNGFSFVYLLMLLVCPLLRYHNQPGGQRPVKIFLIALILISSLFVFSNAAVNVSVIFRPDLLANCTDGLTAASHQLGIVNLHGIKYSLLTRIILPDLVALVIAVILLVLLIKMKLESTDVKCKNQIIEEKFPCGISLIKPCEDDPENEATKVEVIIQRSS SNLKNENQNRNSIPMKPIKSHCSRKVQPTDNYMRKALGIDELHNTKLRHWATQSLFAFFNIVITGFAGI+SPSLLNLVYLLSYLGVGTFWACGNNVMTSNFARMRLFLLLYSAAHVCLIFIVQLEFMQLYIPTGQRLSRLLGLYLMFDTNCKNRGEIIFNNQRSIDYVSPFIILYVYYLSAIETRIWLEERKRINKERPAVDKETFIHTESYLSGE INQEESQRISNSFNVEIGSNVSDGPYIDFTDVPHVLDAQNSRSTLFIEEDITKD+EKNQVKERPLLLSIINTMISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNLPELP IFRISSSEMQSSEIGLHK LIPTGPLAAMMSFLVVFWLTLRLFMTDEKINKSKICNEKISTQQKLEHYFGNVDNATYEKFVKCLKEKCENYWIFSCCFAMLFVSVNGSIVLFRIVYMVLLVYFLLVFMLSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILI+QVRYFHSRFLELTSMKQTQVCVESERERVKSSKDEMDKNKFSVKNTVEFIRDVNN+VFTATEKLKSLYTLTQ SIWR WECHFTKFLVILIVYVCIIDVHAMNIILILIIVIGFPFPRLHTVMVTALFVCSASIVILKMIYQIKIFQTFNWLTNCSQYGNFANSSMEIIDNAKWLGLEKLENFQLHILKWTAILVGCAVWHIVRYHQMQFYKLNLDQKPKTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSLVYLLMLLLFLILKRDLCNVLWLPYMIFLGILLPVQYVICVGLPPGLCIEYPLNVIPKLRQWLYLPNYKVSPVPGKILADFVQYIFVVLQ+QVFQMEKRKKSDSHKLVKQRLLEGFQKSIHKDFISKKSSYVDYLKHVVFYWSYWLTLAIIF TGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCINPMSWEIRGIHG+NADKQCSSVASGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLEIMKSIEKQKKSEEKELNRIERKIKKIEQRQAQHGKPELNEHYLVMRSGDYYLFEEDSEDEDREDGEESSLSMVGSNTISLESNLPTSSVGKDISVSTDSQRHLEDDSNSLDRHTNENKRKSIGIILEKNEQEDEKSGDDDLSLIGTLNPLQLINAVVKEGPKQAIRQYKRSFSSVHSSSHLRVNLDMLPNEYESCC ENPDVSPSEEVRENSFRSSTVHDNSTNFPQYHNLHLHTPIPSENETRYQSSHNTAIVNTGTESSVDPVSNGNQRLESSWENFKNVIKLCVCFIGSTMASLTVLFNEWTREYYRNIRKLEEEKKLVKSHVLSTFIEIDEKLGQEIEKFVKDGRKSVSEDKEEKNKQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLPVPEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLWRDHSE YKDIKISNEEEVNHIQPLKPQSAMRTGIKFRNPIKQLKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPFIAMIITQFIFIIIDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGILILIFFFFCIWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAMMWWEVNEIIQGQSYCPNPDSP+KKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQHWKSTLEANQVERVSADDADNGLSMISVDNTSRESFVSLVNDHSVKT
Sbjct:    1 MSLIYVYIQRFLLRAFLPFILLGCAVIRLNGFSFVYLLMLLVCPLLRYHNQPGGQRPVKIFLIALILISSLFVFSNAAVNVSVIFRPDLLANCTDGLTAASHQLGIVNLHGIKYSLLTRIILPDLVALVIAVILLVLLIKMKLESTDVKCKNQIIEEKFPCGISLIKPCEDDPENEATKVEVIIQRSSFSNLKNENQNRNSIPMKPIKSHCSRKVQPTDNYMRKALGIDELHNTKLRHWATQSLFAFFNIVITGFAGILSPSLLNLVYLLSYLGVGTFWACGNNVMTSNFARMRLFLLLYSAAHVCLIFIVQLEFMQLYIPTGQRLSRLLGLYLMFDTNCKNRGEIIFNNQRSIDYVSPFIILYVYYLSAIETRIWLEERKRINKERPAVDKETFIHTESYLSGEGINQEESQRISNSFNVEIGSNVSDGPYIDFTDVPHVLDAQNSRSTLFIEEDITKDVEKNQVKERPLLLSIINTMISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNLPELPMIFRISSSEMQSSEIGLHKWLIPTGPLAAMMSFLVVFWLTLRLFMTDEKINKSKICNEKISTQQKLEHYFGNVDNATYEKFVKCLKEKCENYWIFSCCFAMLFVSVNGSIVLFRIVYMVLLVYFLLVFMLSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIVQVRYFHSRFLELTSMKQTQVCVESERERVKSSKDEMDKNKFSVKNTVEFIRDVNNVVFTATEKLKSLYTLTQSSIWRFWECHFTKFLVILIVYVCIIDVHAMNIILILIIVIGFPFPRLHTVMVTALFVCSASIVILKMIYQIKIFQTFNWLTNCSQYGNFANSSMEIIDNAKWLGLEKLENFQLHILKWTAILVGCAVWHIVRYHQMQFYKLNLDQKPKTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSLVYLLMLLLFLILKRDLCNVLWLPYMIFLGILLPVQYVICVGLPPGLCIEYPLNVIPKLRQWLYLPNYKVSPVPGKILADFVQYIFVVLQFQVFQMEKRKKSDSHKLVKQRLLEGFQKSIHKDFISKKSSYVDYLKHVVFYWSYWLTLAIIFTTGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCINPMSWEIRGIHGQNADKQCSSVASGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLEIMKSIEKQKKSEEKELNRIERKIKKIEQRQAQHGKPELNEHYLVMRSGDYYLFEEDSEDEDREDGEESSLSMVGSNTISLESNLPTSSVGKDISVSTDSQRHLEDDSNSLDRHTNENKRKSIGIILEKNEQEDEKSGDDDLSLIGTLNPLQLINAVVKEGPKQAIRQYKRSFSSVHSSSHLRVNLDMLPNEYESCCPENPDVSPSEEVRENSFRSSTVHDNSTNFPQYHNLHLHTPIPSENETRYQSSHNTAIVNTGTESSVDPVSNGNQRLESSWENFKNVIKLCVCFIGSTMASLTVLFNEWTREYYRNIRKLEEEKKLVKSHVLSTFIEIDEKLGQEIEKFVKDGRKSVSEDKEEKNKQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLPVPEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLWRDHSELYKDIKISNEEEVNHIQPLKPQSAMRTGIKFRNPIKQLKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPFIAMIITQFIFIIIDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGILILIFFFFCIWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAMMWWEVNEIIQGQSYCPNPDSPSKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQHWKSTLEANQVERVSADDADNGLSMISVDNTSRESFVSLVNDHSVKT 2519          
BLAST of Piezo-type mechanosensitive ion channel component vs. Planmine SMEST
Match: SMESG000010240.1 (SMESG000010240.1)

HSP 1 Score: 4736.01 bits (12283), Expect = 0.000e+0
Identity = 2502/2545 (98.31%), Postives = 2509/2545 (98.59%), Query Frame = 1
Query:  100 MSLIYVYIQRFLLRAFLPFILLGCAVARLNGFSFVYXXXXXXXXXXRYHNQPGGQRPVKXXXXXXXXXXXXXXXXNAAVNVSVIFRPDLLANCTDGLTAASHQLGIVN--------------------------LHGIKYSLLTRXXXXXXXXXXXXXXXXXXXXKMKLESTDVKCKNQIIEEKFPCGISLIKPCEDDPENEATKVEVIIQRSSLSNLKNENQNRNSIPMKPIKSHCSRKVQPTDNYMRKALGIDELHNTKLRHWATQSLFAFFNIVITGFAGIISPXXXXXXXXXXXXXXXTFWACGNNVMTSNFARMRLFLLLYSAAHVCLIFIVQLEFMQLYIPTGQRLSRLLGLYLMFDTNCKNRGEIIFNNQRSIDYVSPFIILYVYYLSAIETRIWLEERKRINKERPAVDKETFIHTESYLSGEEINQEESQRISNSFNVEIGSNVSDGPYIDFTDVPHVLDAQNSRSTLFIEEDITKDMEKNQVKERPLLLSIINTMISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNLPELPTIFRISSSEMQSSEIGLHKSLIPTGPLAAMMSFLVVFWLTLRLFMTDEKINKSKICNEKISTQQKLEHYFGNVDNATYEKFVKCLKEKCENYWIFSCCFAMLFVSVNGSIVLFRIXXXXXXXXXXXXXXXSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIIQVRYFHSRFLELTSMKQTQVCVESERERVKSSKDEMDKNKFSVKNTVEFIRDVNNMVFTATEKLKSLYTLTQPSIWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSASIVILKMIYQIKIFQTFNWLTNCSQYGNFANSSMEIIDNAKWLGLEKLENFQLHILKWTAILVGCAVWHIVRYHQMQFYKLNLDQKPKTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNVLWLPYMIFLGILLPVQYVICVGLPPGLCIEYPLNVIPKLRQWLYLPNYKVSPVPGKILADFVQYIFVVLQYQVFQMEKRKKSDSHKLVKQRLLEGFQKSIHKDFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCINPMSWEIRGIHGKNADKQCSSVASGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLXXXXXXXXXXXXXXXXLNRIERKIKKIEQRQAQHGKPELNEHYLVMRSGDYYLFXXXXXXXXXXXXXXXXXXMVGSNTISLESNLPTSSVGKDISVSTDSQRHLEDDSNSLDRHTNENKRKSIGIILEKNEQEDEKSGDDDLSLIGTLNPLQLINAVVKEGPKQAIRQYKRXXXXXXXXXXLRVNLDMLPNEYESCCIENPDVSPSEEVRENSFRSSTVHDNSTNFPQYHNLHLHTPIPSENETRYQSSHNTAIVNTGTESSVDPVSNGNQRLESSWENFKNVIKLCVCFIGSTMASLTVLFNEWTREYYRNIRKLEEEKKLVKSHVLSTFIEIDEKLGQEIEKFVKDGRKSVSEDKEEKNKQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLPVPEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLWRDHSEFYKDIKISNEEEVNHIQPLKPQSAMRTGIKFRNPIKQLKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAMMWWEVNEIIQGQSYCPNPDSPAKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQHWKSTLEANQVERVSADDADNGLSMISVDNTSRESFVSLVNDHSVKT 7656
            MSLIYVYIQRFLLRAFLPFILLGCAV RLNGFSFVYLLMLLVCPLLRYHNQPGGQRPVKIFLIALILISSLFVFSNAAVNVSVIFRPDLLANCTDGLTAASHQLGIVN                          LHGIKYSLLTRIILPDLVALVIAVILLVLLIKMKLESTDVKCKNQIIEEKFPCGISLIKPCEDDPENEATKVEVIIQRSS SNLKNENQNRNSIPMKPIKSHCSRKVQPTDNYMRKALGIDELHNTKLRHWATQSLFAFFNIVITGFAGI+SPSLLNLVYLLSYLGVGTFWACGNNVMTSNFARMRLFLLLYSAAHVCLIFIVQLEFMQLYIPTGQRLSRLLGLYLMFDTNCKNRGEIIFNNQRSIDYVSPFIILYVYYLSAIETRIWLEERKRINKERPAVDKETFIHTESYLSGE INQEESQRISNSFNVEIGSNVSDGPYIDFTDVPHVLDAQNSRSTLFIEEDITKD+EKNQVKERPLLLSIINTMISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNLPELP IFRISSSEMQSSEIGLHK LIPTGPLAAMMSFLVVFWLTLRLFMTDEKINKSKICNEKISTQQKLEHYFGNVDNATYEKFVKCLKEKCENYWIFSCCFAMLFVSVNGSIVLFRIVYMVLLVYFLLVFMLSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILI+QVRYFHSRFLELTSMKQTQVCVESERERVKSSKDEMDKNKFSVKNTVEFIRDVNN+VFTATEKLKSLYTLTQ SIWR WECHFTKFLVILIVYVCIIDVHAMNIILILIIVIGFPFPRLHTVMVTALFVCSASIVILKMIYQIKIFQTFNWLTNCSQYGNFANSSMEIIDNAKWLGLEKLENFQLHILKWTAILVGCAVWHIVRYHQMQFYKLNLDQKPKTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSLVYLLMLLLFLILKRDLCNVLWLPYMIFLGILLPVQYVICVGLPPGLCIEYPLNVIPKLRQWLYLPNYKVSPVPGKILADFVQYIFVVLQ+QVFQMEKRKKSDSHKLVKQRLLEGFQKSIHKDFISKKSSYVDYLKHVVFYWSYWLTLAIIF TGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCINPMSWEIRGIHG+NADKQCSSVASGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLEIMKSIEKQKKSEEKELNRIERKIKKIEQRQAQHGKPELNEHYLVMRSGDYYLFEEDSEDEDREDGEESSLSMVGSNTISLESNLPTSSVGKDISVSTDSQRHLEDDSNSLDRHTNENKRKSIGIILEKNEQEDEKSGDDDLSLIGTLNPLQLINAVVKEGPKQAIRQYKRSFSSVHSSSHLRVNLDMLPNEYESCC ENPDVSPSEEVRENSFRSSTVHDNSTNFPQYHNLHLHTPIPSENETRYQSSHNTAIVNTGTESSVDPVSNGNQRLESSWENFKNVIKLCVCFIGSTMASLTVLFNEWTREYYRNIRKLEEEKKLVKSHVLSTFIEIDEKLGQEIEKFVKDGRKSVSEDKEEKNKQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLPVPEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLWRDHSE YKDIKISNEEEVNHIQPLKPQSAMRTGIKFRNPIKQLKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPFIAMIITQFIFIIIDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGILILIFFFFCIWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAMMWWEVNEIIQGQSYCPNPDSP+KKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQHWKSTLEANQVERVSADDADNGLSMISVDNTSRESFVSLVNDHSVKT
Sbjct:    1 MSLIYVYIQRFLLRAFLPFILLGCAVIRLNGFSFVYLLMLLVCPLLRYHNQPGGQRPVKIFLIALILISSLFVFSNAAVNVSVIFRPDLLANCTDGLTAASHQLGIVNDSNGNFTGTRCYCTREPHSANHIVCFLHGIKYSLLTRIILPDLVALVIAVILLVLLIKMKLESTDVKCKNQIIEEKFPCGISLIKPCEDDPENEATKVEVIIQRSSFSNLKNENQNRNSIPMKPIKSHCSRKVQPTDNYMRKALGIDELHNTKLRHWATQSLFAFFNIVITGFAGILSPSLLNLVYLLSYLGVGTFWACGNNVMTSNFARMRLFLLLYSAAHVCLIFIVQLEFMQLYIPTGQRLSRLLGLYLMFDTNCKNRGEIIFNNQRSIDYVSPFIILYVYYLSAIETRIWLEERKRINKERPAVDKETFIHTESYLSGEGINQEESQRISNSFNVEIGSNVSDGPYIDFTDVPHVLDAQNSRSTLFIEEDITKDVEKNQVKERPLLLSIINTMISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNLPELPMIFRISSSEMQSSEIGLHKWLIPTGPLAAMMSFLVVFWLTLRLFMTDEKINKSKICNEKISTQQKLEHYFGNVDNATYEKFVKCLKEKCENYWIFSCCFAMLFVSVNGSIVLFRIVYMVLLVYFLLVFMLSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIVQVRYFHSRFLELTSMKQTQVCVESERERVKSSKDEMDKNKFSVKNTVEFIRDVNNVVFTATEKLKSLYTLTQSSIWRFWECHFTKFLVILIVYVCIIDVHAMNIILILIIVIGFPFPRLHTVMVTALFVCSASIVILKMIYQIKIFQTFNWLTNCSQYGNFANSSMEIIDNAKWLGLEKLENFQLHILKWTAILVGCAVWHIVRYHQMQFYKLNLDQKPKTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSLVYLLMLLLFLILKRDLCNVLWLPYMIFLGILLPVQYVICVGLPPGLCIEYPLNVIPKLRQWLYLPNYKVSPVPGKILADFVQYIFVVLQFQVFQMEKRKKSDSHKLVKQRLLEGFQKSIHKDFISKKSSYVDYLKHVVFYWSYWLTLAIIFTTGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCINPMSWEIRGIHGQNADKQCSSVASGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLEIMKSIEKQKKSEEKELNRIERKIKKIEQRQAQHGKPELNEHYLVMRSGDYYLFEEDSEDEDREDGEESSLSMVGSNTISLESNLPTSSVGKDISVSTDSQRHLEDDSNSLDRHTNENKRKSIGIILEKNEQEDEKSGDDDLSLIGTLNPLQLINAVVKEGPKQAIRQYKRSFSSVHSSSHLRVNLDMLPNEYESCCPENPDVSPSEEVRENSFRSSTVHDNSTNFPQYHNLHLHTPIPSENETRYQSSHNTAIVNTGTESSVDPVSNGNQRLESSWENFKNVIKLCVCFIGSTMASLTVLFNEWTREYYRNIRKLEEEKKLVKSHVLSTFIEIDEKLGQEIEKFVKDGRKSVSEDKEEKNKQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLPVPEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLWRDHSELYKDIKISNEEEVNHIQPLKPQSAMRTGIKFRNPIKQLKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPFIAMIITQFIFIIIDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGILILIFFFFCIWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAMMWWEVNEIIQGQSYCPNPDSPSKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQHWKSTLEANQVERVSADDADNGLSMISVDNTSRESFVSLVNDHSVKT 2545          
BLAST of Piezo-type mechanosensitive ion channel component vs. Planmine SMEST
Match: SMESG000010240.1 (SMESG000010240.1)

HSP 1 Score: 4733.32 bits (12276), Expect = 0.000e+0
Identity = 2502/2548 (98.19%), Postives = 2509/2548 (98.47%), Query Frame = 1
Query:  100 MSLIYVYIQRFLLRAFLPFILLGCAVARLNGFSFVYXXXXXXXXXXRYHNQPGGQRPVKXXXXXXXXXXXXXXXXNAAVNVSVIFRPDLLANCTDGLTAASHQLGIVNLHGIKYSLLTRXXXXXXXXXXXXXXXXXXXXKMKLESTDVKCKNQIIEEKFPCGISLIKPCEDDPENEATKVEVIIQRSSLSNLKNENQNRNSIPMKPIKSHCSRKVQPTDNYMRKALGIDELHNTKLRHWATQSLFAFFNIVITGFAGIISPXXXXXXXXXXXXXXXTFWACGNNVMTSNFARMRLFLLLYSAAHVCLIFIVQLEFMQLYIPTGQRLSRLLGLYLMFDTNCKNRGEIIFNNQRSIDYVSPFIILYVYYLSAIETRIWLEERKRINKERPAVDKETFIHTESYLSGEEINQEESQRISNSFNVEIGSNVSDGPYIDFTDVPHVLDAQNSRSTLFIEEDITKDMEKNQVKERPLLLSIINTMISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNLPELPTIFRISSSEMQSSEIGLHKSLIPTGPLAAMMSFLVVFWLTLRLFMTDEKINKSKICNEKISTQQKLEHYFGNVDNATYEKFVKCLKEKCENYWIFSCCFAMLFVSVNGSIVLFRIXXXXXXXXXXXXXXXSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIIQVRYFHSRFLELTSMKQTQVCVESERERVKSSKDEMDKNKFSVKNTVEFIRDVNNMVFTATEKLKSLYTLTQPSIWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSASIVILKMIYQIKIFQTFNWLTNCSQYGNFANSSMEIIDNAKWLGLEKLENFQLHILKWTAILVGCAVWHIVRYHQMQFYKLNLDQKPKTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNVLWLPYMIFLGILLPVQYVICVGLPPGLCIEYPLNVIPKLRQWLYLPNYKVSPVPGKILADFVQYIFVVLQYQVFQMEKRKKSDSHKLVKQRLLEGFQKSIHKDFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCINPMSWEIRGIHGKNADKQCSSVASGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLXXXXXXXXXXXXXXXXLNRIERKIKKIEQRQAQHGKPELNEHYLVMRSGDYYLFXXXXXXXXXXXXXXXXXXMVGSNTISLESNLPTSSVGKDISVSTDSQRHLEDDSNSLDRHTNENKRKSIGIILEKNEQEDEKSGDDDLSLIGTLNPLQLINAVVKEGPKQAIRQYKRXXXXXXXXXXLRVNLDMLPNEYESCCIENPDVSPSEEVRENSFRSSTVHDNSTNFPQYHNLHLHTPIPSENETRYQSSHNTAIVNTGTESSVDPVSNGNQRLESSWENFKNVIKLCVCFIGSTMASLTVLFNEWTREYYRNIRKLEEEKKLVKSHVLSTFIEIDEKLGQEIEKFVKDGRKSVSEDKEEKNKQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLPVPEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLWRDHSEFYKDIKISNEEEVNHIQPLKPQSAMRTGIKFRNPIKQLKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCER-----------------------------PSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAMMWWEVNEIIQGQSYCPNPDSPAKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQHWKSTLEANQVERVSADDADNGLSMISVDNTSRESFVSLVNDHSVKT 7656
            MSLIYVYIQRFLLRAFLPFILLGCAV RLNGFSFVYLLMLLVCPLLRYHNQPGGQRPVKIFLIALILISSLFVFSNAAVNVSVIFRPDLLANCTDGLTAASHQLGIVNLHGIKYSLLTRIILPDLVALVIAVILLVLLIKMKLESTDVKCKNQIIEEKFPCGISLIKPCEDDPENEATKVEVIIQRSS SNLKNENQNRNSIPMKPIKSHCSRKVQPTDNYMRKALGIDELHNTKLRHWATQSLFAFFNIVITGFAGI+SPSLLNLVYLLSYLGVGTFWACGNNVMTSNFARMRLFLLLYSAAHVCLIFIVQLEFMQLYIPTGQRLSRLLGLYLMFDTNCKNRGEIIFNNQRSIDYVSPFIILYVYYLSAIETRIWLEERKRINKERPAVDKETFIHTESYLSGE INQEESQRISNSFNVEIGSNVSDGPYIDFTDVPHVLDAQNSRSTLFIEEDITKD+EKNQVKERPLLLSIINTMISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNLPELP IFRISSSEMQSSEIGLHK LIPTGPLAAMMSFLVVFWLTLRLFMTDEKINKSKICNEKISTQQKLEHYFGNVDNATYEKFVKCLKEKCENYWIFSCCFAMLFVSVNGSIVLFRIVYMVLLVYFLLVFMLSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILI+QVRYFHSRFLELTSMKQTQVCVESERERVKSSKDEMDKNKFSVKNTVEFIRDVNN+VFTATEKLKSLYTLTQ SIWR WECHFTKFLVILIVYVCIIDVHAMNIILILIIVIGFPFPRLHTVMVTALFVCSASIVILKMIYQIKIFQTFNWLTNCSQYGNFANSSMEIIDNAKWLGLEKLENFQLHILKWTAILVGCAVWHIVRYHQMQFYKLNLDQKPKTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSLVYLLMLLLFLILKRDLCNVLWLPYMIFLGILLPVQYVICVGLPPGLCIEYPLNVIPKLRQWLYLPNYKVSPVPGKILADFVQYIFVVLQ+QVFQMEKRKKSDSHKLVKQRLLEGFQKSIHKDFISKKSSYVDYLKHVVFYWSYWLTLAIIF TGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCINPMSWEIRGIHG+NADKQCSSVASGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLEIMKSIEKQKKSEEKELNRIERKIKKIEQRQAQHGKPELNEHYLVMRSGDYYLFEEDSEDEDREDGEESSLSMVGSNTISLESNLPTSSVGKDISVSTDSQRHLEDDSNSLDRHTNENKRKSIGIILEKNEQEDEKSGDDDLSLIGTLNPLQLINAVVKEGPKQAIRQYKRSFSSVHSSSHLRVNLDMLPNEYESCC ENPDVSPSEEVRENSFRSSTVHDNSTNFPQYHNLHLHTPIPSENETRYQSSHNTAIVNTGTESSVDPVSNGNQRLESSWENFKNVIKLCVCFIGSTMASLTVLFNEWTREYYRNIRKLEEEKKLVKSHVLSTFIEIDEKLGQEIEKFVKDGRKSVSEDKEEKNKQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLPVPEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLWRDHSE YKDIKISNEEEVNHIQPLKPQSAMRTGIKFRNPIKQLKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPFIAMIITQFIFIIIDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGILILIFFFFCIWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCER                             PSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAMMWWEVNEIIQGQSYCPNPDSP+KKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQHWKSTLEANQVERVSADDADNGLSMISVDNTSRESFVSLVNDHSVKT
Sbjct:    1 MSLIYVYIQRFLLRAFLPFILLGCAVIRLNGFSFVYLLMLLVCPLLRYHNQPGGQRPVKIFLIALILISSLFVFSNAAVNVSVIFRPDLLANCTDGLTAASHQLGIVNLHGIKYSLLTRIILPDLVALVIAVILLVLLIKMKLESTDVKCKNQIIEEKFPCGISLIKPCEDDPENEATKVEVIIQRSSFSNLKNENQNRNSIPMKPIKSHCSRKVQPTDNYMRKALGIDELHNTKLRHWATQSLFAFFNIVITGFAGILSPSLLNLVYLLSYLGVGTFWACGNNVMTSNFARMRLFLLLYSAAHVCLIFIVQLEFMQLYIPTGQRLSRLLGLYLMFDTNCKNRGEIIFNNQRSIDYVSPFIILYVYYLSAIETRIWLEERKRINKERPAVDKETFIHTESYLSGEGINQEESQRISNSFNVEIGSNVSDGPYIDFTDVPHVLDAQNSRSTLFIEEDITKDVEKNQVKERPLLLSIINTMISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNLPELPMIFRISSSEMQSSEIGLHKWLIPTGPLAAMMSFLVVFWLTLRLFMTDEKINKSKICNEKISTQQKLEHYFGNVDNATYEKFVKCLKEKCENYWIFSCCFAMLFVSVNGSIVLFRIVYMVLLVYFLLVFMLSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIVQVRYFHSRFLELTSMKQTQVCVESERERVKSSKDEMDKNKFSVKNTVEFIRDVNNVVFTATEKLKSLYTLTQSSIWRFWECHFTKFLVILIVYVCIIDVHAMNIILILIIVIGFPFPRLHTVMVTALFVCSASIVILKMIYQIKIFQTFNWLTNCSQYGNFANSSMEIIDNAKWLGLEKLENFQLHILKWTAILVGCAVWHIVRYHQMQFYKLNLDQKPKTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSLVYLLMLLLFLILKRDLCNVLWLPYMIFLGILLPVQYVICVGLPPGLCIEYPLNVIPKLRQWLYLPNYKVSPVPGKILADFVQYIFVVLQFQVFQMEKRKKSDSHKLVKQRLLEGFQKSIHKDFISKKSSYVDYLKHVVFYWSYWLTLAIIFTTGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCINPMSWEIRGIHGQNADKQCSSVASGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLEIMKSIEKQKKSEEKELNRIERKIKKIEQRQAQHGKPELNEHYLVMRSGDYYLFEEDSEDEDREDGEESSLSMVGSNTISLESNLPTSSVGKDISVSTDSQRHLEDDSNSLDRHTNENKRKSIGIILEKNEQEDEKSGDDDLSLIGTLNPLQLINAVVKEGPKQAIRQYKRSFSSVHSSSHLRVNLDMLPNEYESCCPENPDVSPSEEVRENSFRSSTVHDNSTNFPQYHNLHLHTPIPSENETRYQSSHNTAIVNTGTESSVDPVSNGNQRLESSWENFKNVIKLCVCFIGSTMASLTVLFNEWTREYYRNIRKLEEEKKLVKSHVLSTFIEIDEKLGQEIEKFVKDGRKSVSEDKEEKNKQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLPVPEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLWRDHSELYKDIKISNEEEVNHIQPLKPQSAMRTGIKFRNPIKQLKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPFIAMIITQFIFIIIDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGILILIFFFFCIWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERYLLNSLVIFENHLYSPLQINCGSPISLAQPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAMMWWEVNEIIQGQSYCPNPDSPSKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQHWKSTLEANQVERVSADDADNGLSMISVDNTSRESFVSLVNDHSVKT 2548          
BLAST of Piezo-type mechanosensitive ion channel component vs. Planmine SMEST
Match: SMESG000051188.1 (SMESG000051188.1)

HSP 1 Score: 2342.38 bits (6069), Expect = 0.000e+0
Identity = 1370/2606 (52.57%), Postives = 1747/2606 (67.04%), Query Frame = 1
Query:  112 YVYIQRFLLRAFLPFILLGCAVARLNGFSFVYXXXXXXXXXXRYHNQPGGQRPVKXXXXXXXXXXXXXXXXNAAVNVSVIFRPDLLANCTDGLTAASHQLGIVNLHGIKYSLLTRXXXXXXXXXXXXXXXXXXXXKMKLESTDVKC---------KNQIIEEKFPCGISLI----KPCEDDPENEATKVEVIIQRSSLSNLKNENQNRNSIPMKPIKSHCSRKVQPTDNYMRKALGIDELHNTKLRHWATQSLFAFFNIVITGFAGIISPXXXXXXXXXXXXXXXTFWACGNNVMTSNFARMRLFLLLYSAAHVCLIFIVQLEFMQLYIPTGQRLSRLLGLYLMFDTNCKNRGEIIFNNQRSIDYVSPFIILYVYYLSAIETRIWLEER-------------------KRINKERPAV-----DKETFIHTESYLSGEEINQEESQRISNSFNVEIGSNVSDGPYIDFTDV----PHVLDAQNSRSTLFIEEDITKDMEKNQVKERPLLLSIINTMISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNLPELPTI-FRISSSEMQSSEIGLHKSLIPTGPLAAMMSFLVVFWLTLRLFMTDEKINKSK---ICNEKI---STQQKLEHYFGNVDNATYEKFVKCLKEKCENYWIFSCCFAMLFVSVNGSIVLFRIXXXXXXXXXXXXXXXSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIIQVRYFHSRFLELTSMKQTQVCVESERERVKSSKDEMD--KNKFSVKNTVEFIRDVNNMVFTATEKLKSLYTLTQPSIWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSASIVILKMIYQIKIFQTFNWLTNCSQYGNFANSSMEIIDNAKWLGLEKLENFQLHILKWTAILVGCAVWHIVRYHQMQFYKLNLDQKPKTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNVLWLPYMIFLGILLPVQYVICVGLPPGLCIEYPLNVIPK-LRQWLYLPNYKVSPVPGKILADFVQYIFVVLQYQVFQMEKRKKSDSHKLVKQR--LLEGFQKSIHKDFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCINPMSWE-----IRGIHGKNADKQCSSVASGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLXXXXXXXXXXXXXXXXLNRIERKIKKIEQRQAQHGKPELNEHYLVMRSGDYYLFXXXXXXXXXXXXXXXXXXMVGSNTISLE-----------------SNLPTSSVGKDISVSTDSQRHL------EDDSNSLDRHTNENKRKSIGIILEKNEQEDEKSGDDD---LSLIGTLNPLQLINAVVKEGPKQAIRQYKRXXX-----------------XXXXXXXLRVNLDMLPNEYESCCIENPDVSPSEEVRENSFRSSTVHDNS-TNFPQYHNLHLHTPIPSENETRYQSSHNTAIVNTGTESSVDPVSNG--------NQRLESSWENFKNVIKLCVCFIGSTMASLTVLFNEWTREYYRNIRKLEEEKKLVKSHVLSTFI-EIDEKLGQE--IEKFVKDGRKSV--SEDKEEKNKQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLPVPEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLWRDHSEFYKDIKISNEEE--VNHIQPLKPQSAMRTGIKFRNPIKQLKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAMMWWEVNEIIQGQSYCPNPDSPAKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQHWKSTLEANQVERVSADDADN 7578
            +V     LLR FLP  LLG  + R NGFSF+YLL+LLVCP +RY N+   + P++IFLI LI +S LF  S +  ++ +IF P  L+NCTD LT+ SHQ+GI NL G+ +  + R++LPD V L+ +++LL+   K   +S  V            N +I +      SL+    +P +   E+  T+   +   S   N+ +EN   +         H SRK+    NY+   LGID L     R WA QSLF FFN+V+TGFAGIISPS+LN VYL  +LG+ TFWACGN V+T+NFA MR+FLL+YSA HVCL+++VQ+EF+Q Y+P     SRLLGLY + +T+C+ RGE+ F   R IDY+SP II+YVYYL A ETR W E+                    K+ N+  P +     DKE    T S L+       E Q I    N  + S  +     D T+V      + D Q     +  ++ I   +      ERPLLLSIINT I NSF+ TF+AMMAWSV YKSW SFI LL +CYLW++P SR  CLY SP+IV YAT+LI+IQYIYGFNL ELP   +  S S +  SEIG HK  IPTGPLA M+SFLV+FWLTLRLFMTD  +N SK   I N+     S+    E YFGNVDN  Y+K V  L   CE YWI  CCFAMLFVS+   +V+FRIVYM+LLVYFL+ FM SYSFWR+QM VFWW VI Y+V  LL IY +QF +     +N TGLSEEIL+DIGLK ++ASDL + L  P +FLV++I+QVRYFH  FL+L+SM +    +  +   V   +D ++   +  S  N   FI DVN+      EKLK  + +    +WR +ECHFTK +V  IV  CI + +A NI+LI+++VIGFPF +LHT++VT  F   +  V++KMIYQ+K    FNW TNCS Y    N SM+ IDNAKW+GLEK+ NFQ HI KWTA+LV CA+WH+V+YHQ QFYK     KP+T +IF E  + S  ++  +L K+ +NF F K+GLELSFI TV+V+CLR+DVYSLVYL++LL+FL  +R +C+ +WLPYM+FLG+LLP++Y ICVGLPPGLC +YPL  + + L++WL+LP+Y+  P   KI+ADF Q++FV LQY+VF +E     +++   + R  L     K+I KDF+S K SYVDYLKH +FYWSYWL+LAI+F TGVFWITLF LGY+++AFIYLWMGQ +++ K+ +LI S NVI+YYNF VIL+KC  QL+GC +M+ + +K  CWM+ LF +QCINPMSW+     +  +HG      CSSV SGLHWDV CF FIILQR IF    F  V LDL+VQN+F+SRGAYLIN ++M SI +QK  EE  L++I+ KI KI QRQAQHGKPELNEHYLV+RSGD YLFE DS+++D +   +   S     T++ E                  +L +  +   ++V T   R+L         S    R + +N+ K I  I +K+ ++ + S +DD   L +  T+NPL LIN  +++GP+ AIR++KR+ S                 S   S      L  LP+ Y +     P    SE   E+SF S+ + DN  TN      L L++    E+E +Y +       N  + S  + +SN         +   ES W  FK  I +   FI +T  +L VL N WT+EY R  R L+ EK+LVK  VLS    E+D ++  E  + + V DG  +   S+++EE  K+  FRRSRS+FF L IS G VAIIYSEF CYFLLI+NH+LSGNL SLPYP +VF W MLSVPRPSKNFWI LITYTE+VIV KYI QFN I  N       R+DPL +PLI+GIEKS+ YAI+D+IQLLF+FLHR YLK NGLWRDH+EF +D++I ++E+   N I+    +S+  +     NPI ++++FY KMTN K NK+VDVY  MFLCEF A LIII GY SFGPGTDS  +A DFIKTNK PVPFI MIITQF+FIIIDRALFLRKQVKGKF+FQIFHV+LIHAWLFFALP+ITK+KFNSQ  PQLLYF+KC+YFALS+YQM+SGYP+RILGNFLTR++NY NL  FK YM +PFLYELRNVMDWMWTD+SVA +HWMEVED+F KIFVLKCWR  E  +PT RG  RRL  KYS+G L+L FFF C WGPL +SSFIG TFVK PPIEC+FSI+VG YSPLF F SRENN++ L K TF++MKEC+K   P  DYL SFE  D TQI ID +SD+VW ITPP L+KLK KL     SLKINMQA+CER S+DSK+TEK+VR T ++ L   +K NLL  I    +S  V +  IFPRFLTAYKRTLSEA +L ++ N TYLN++LSMK +N   WWE+ EI+ G++YC N   P + +  LT+FIF+ER+SDN+FGH+FS+YGI+G+YAAY FV HR LR FYS+ISYII  EELP+VDRI  LL+EIYLVRENK  RLEEQLIAKLIFLYRS+ETMIKWT+H KS L  N +E+  +D  DN
Sbjct:    3 WVTFDYILLRGFLPVCLLGSTITRYNGFSFIYLLLLLVCPFIRY-NRIHIRIPIQIFLIILITVSGLFSLSISLFHIPLIFNPLFLSNCTDKLTSISHQIGITNLKGVLFYRVVRLVLPDYVTLITSIVLLIYFRKYTTKSYQVPIHDKQSQEDNHNNVISDDGHTPDSLLPGPSRPLKRLTEDTTTETSFLQHES--GNILSENNAEH---------HQSRKIHDNHNYLHDTLGIDRLQKKIWRAWAMQSLFVFFNVVVTGFAGIISPSILNSVYLFGFLGICTFWACGNKVITTNFAYMRIFLLMYSAIHVCLLYLVQIEFVQYYLPNNNFSSRLLGLYYLVNTSCQTRGEVNFYTHRWIDYLSPCIIMYVYYLCATETRRWFEKGRESVPRVRSYKEDIKMSSLKQSNEHDPELQQLIPDKEAVNQTGSLLTSSVSKHGEYQTIFRP-NQTLDSKAAG----DITNVGNEFSELRDNQGPSMAVLDDDRIKSPLLIPTPTERPLLLSIINTAIRNSFVFTFIAMMAWSVTYKSWMSFILLLSACYLWMMPDSRKACLYMSPLIVFYATVLIIIQYIYGFNLTELPEFSYTASGSTVDLSEIGFHKWAIPTGPLAVMISFLVIFWLTLRLFMTDTLLNASKQNEILNDSKFDQSSNADSEAYFGNVDNMIYKKIVSFLNGICEKYWILVCCFAMLFVSIQEPVVVFRIVYMLLLVYFLMTFMFSYSFWRKQMYVFWWFVIVYSVIVLLCIYTYQFNQFPYLWKNKTGLSEEILQDIGLKTYEASDLFKGLLTPVVFLVVIIVQVRYFHKPFLKLSSMNRF---LYGDSREVGPFEDNLNISTSSSSTSNVSAFIEDVNSAFQIIIEKLKQFFEVIYAKVWRFFECHFTKIVVFCIVSACINEENACNIVLIILVVIGFPFHKLHTILVTGSFFWCSLTVLMKMIYQLKTVNKFNWSTNCSLYTTNFNKSMDQIDNAKWIGLEKVNNFQDHIWKWTAVLVVCALWHVVKYHQRQFYKCPNATKPETGIIFPETTVQSIDDSLINLFKFCINFAFYKLGLELSFIVTVIVACLRVDVYSLVYLILLLIFLCTQRKICSKIWLPYMLFLGVLLPIEYAICVGLPPGLCQKYPLTSLKENLQRWLFLPSYEYPPSAKKIMADFFQFVFVALQYRVFIIENSLTVNNYGGGRNRPILCNELPKTIDKDFVSTKDSYVDYLKHAIFYWSYWLSLAIVFTTGVFWITLFCLGYMILAFIYLWMGQNIMLRKRSNLIASWNVIIYYNFFVILSKCTLQLIGCAYMDWMISKRFCWMIPLFGVQCINPMSWDRNMLAVNRMHG----DPCSSVKSGLHWDVTCFLFIILQRKIFMTKNFCHVVLDLNVQNRFASRGAYLINRKMMASIREQKLKEECVLDKIKMKIDKIIQRQAQHGKPELNEHYLVVRSGDKYLFEGDSDEDDEDVEGDIDESCSKKMTVTSEDTFDKNTSNNQNKKCSVDSLDSQGLFNAVNVVTSHSRNLLKPISESRCSTESSRKSLDNQNKIIKEINKKDAKDSDSSEEDDANPLQVQNTINPLHLINRAMEQGPRSAIREFKRTQSECKENLPSNRRSSVHLGSRLESMSEHDELSSLPDAYNT----PPPAHISETTTEDSFHSAAIQDNQLTNDQAQLTLDLYSANTPESE-KYLNPLIYRDTNISSNSVPELISNDETDKKIEKSAHPESCWSKFKASILIVYYFIQTTTDNLIVLINTWTKEYRRIRRTLDNEKRLVKLKVLSKISNEVDGRIELEAIVVEIVGDGSHNFVNSKNQEEYLKEQEFRRSRSRFFLLAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFN--ETTNDRVDPLWIPLIIGIEKSKNYAILDLIQLLFIFLHRGYLKNNGLWRDHTEFAQDLEIVDKEQDGRNKIKSSYEESSPTSNKWSCNPIYKMRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDTSVALFHWMEVEDVFCKIFVLKCWRRSELEYPTVRGNTRRLASKYSVGGLLLAFFFICFWGPLTLSSFIGTTFVKNPPIECTFSISVGGYSPLFYFISRENNLKSLPKDTFDKMKECYKNFSPPTDYLMSFEAGDVTQISIDGSSDDVWTITPPSLEKLKVKLR-STESLKINMQAICERRSSDSKTTEKMVRHTNTKQLDENDKKNLLKAIEANQSSYVVQIDAIFPRFLTAYKRTLSEATALLKDHNQTYLNLTLSMKKENEARWWEIQEIVAGETYCSNEKIPKQSHSNLTVFIFSERVSDNLFGHLFSNYGIIGMYAAYIFVAHRVLRAFYSDISYIIRCEELPHVDRILNLLNEIYLVRENKMFRLEEQLIAKLIFLYRSTETMIKWTRHNKSILSKN-MEKTKSDAIDN 2575          
BLAST of Piezo-type mechanosensitive ion channel component vs. Planmine SMEST
Match: SMESG000051188.1 (SMESG000051188.1)

HSP 1 Score: 2342 bits (6068), Expect = 0.000e+0
Identity = 1369/2602 (52.61%), Postives = 1751/2602 (67.29%), Query Frame = 1
Query:  112 YVYIQRFLLRAFLPFILLGCAVARLNGFSFVYXXXXXXXXXXRYHNQPGGQRPVKXXXXXXXXXXXXXXXXNAAVNVSVIFRPDLLANCTDGLTAASHQLGIVNLHGIKYSLLTRXXXXXXXXXXXXXXXXXXXXKMKLESTDVKC---------KNQIIEEKFPCGISLI----KPCEDDPENEATKVEVIIQRSSLSNLKNENQNRNSIPMKPIKSHCSRKVQPTDNYMRKALGIDELHNTKLRHWATQSLFAFFNIVITGFAGIISPXXXXXXXXXXXXXXXTFWACGNNVMTSNFARMRLFLLLYSAAHVCLIFIVQLEFMQLYIPTGQRLSRLLGLYLMFDTNCKNRGEIIFNNQRSIDYVSPFIILYVYYLSAIETRIWLEE-RKRINKERPAVDKETFIHTESYLSGEEINQEESQRISNSFNVE-----IGSNVSD-GPYIDFTDVPHVLDAQNSRSTLFIEED--ITKDMEKNQVKERPLLLSIINTMISNSFILTFMAMMAWSVAYKSWASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNLPELPTI-FRISSSEMQSSEIGLHKSLIPTGPLAAMMSFLVVFWLTLRLFMTDEKINKSK---ICNEKI---STQQKLEHYFGNVDNATYEKFVKCLKEKCENYWIFSCCFAMLFVSVNGSIVLFRIXXXXXXXXXXXXXXXSYSFWRRQMKVFWWTVIGYNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLFIPAIFLVILIIQVRYFHSRFLELTSMKQTQVCVESERERVKSSKDEMD--KNKFSVKNTVEFIRDVNNMVFTATEKLKSLYTLTQPSIWRLWECHFTKFLVILIVYVCIIDVHAMNXXXXXXXXXGFPFPRLHTVMVTALFVCSASIVILKMIYQIKIFQTFNWLTNCSQYGNFANSSMEIIDNAKWLGLEKLENFQLHILKWTAILVGCAVWHIVRYHQMQFYKLNLDQKPKTSVIFQEVEIHSSIENFCDLLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSXXXXXXXXXXXXXXXXXCNVLWLPYMIFLGILLPVQYVICVGLPPGLCIEYPLNVIPK-LRQWLYLPNYKVSPVPGKILADFVQYIFVVLQYQVFQMEKRKKSDSHKLVKQR--LLEGFQKSIHKDFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGYLLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVFMNLLKTKGLCWMVSLFAIQCINPMSWE-----IRGIHGKNADKQCSSVASGLHWDVVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLXXXXXXXXXXXXXXXXLNRIERKIKKIEQRQAQHGKPELNEHYLVMRSGDYYLFXXXXXXXXXXXXXXXXXXMVGSNTISLE-----------------SNLPTSSVGKDISVSTDSQRHL------EDDSNSLDRHTNENKRKSIGIILEKNEQEDEKSGDDD---LSLIGTLNPLQLINAVVKEGPKQAIRQYKRXXXX----------------XXXXXXLRVNLDM----------------LPNEYESCCIENPDVSPSEEVRENSFRSSTVHDNS-TNFPQYHNLHLHTPIPSENETRYQSSHNTAIVNTGTESSVDPVSNG--------NQRLESSWENFKNVIKLCVCFIGSTMASLTVLFNEWTREYYRNIRKLEEEKKLVKSHVLSTFI-EIDEKLGQE--IEKFVKDGRKSV--SEDKEEKNKQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLSLPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVLPVPEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLWRDHSEFYKDIKISNEEE--VNHIQPLKPQSAMRTGIKFRNPIKQLKKFYGKMTNRKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKTPVPXXXXXXXXXXXXXXDRALFLRKQVKGKFVFQIFHVILIHAWLFFALPYITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNYGNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAMMWWEVNEIIQGQSYCPNPDSPAKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQHWKSTLEANQVERVSADDADN 7578
            +V     LLR FLP  LLG  + R NGFSF+YLL+LLVCP +RY N+   + P++IFLI LI +S LF  S +  ++ +IF P  L+NCTD LT+ SHQ+GI NL G+ +  + R++LPD V L+ +++LL+   K   +S  V            N +I +      SL+    +P +   E+  T+   +   S   N+ +EN   +         H SRK+    NY+   LGID L     R WA QSLF FFN+V+TGFAGIISPS+LN VYL  +LG+ TFWACGN V+T+NFA MR+FLL+YSA HVCL+++VQ+EF+Q Y+P     SRLLGLY + +T+C+ RGE+ F   R IDY+SP II+YVYYL A ETR W E+ R+ + + R   +    I   S     E + E  Q I +   V      + S+VS  G Y         LD++ +  ++ + +D  I   +      ERPLLLSIINT I NSF+ TF+AMMAWSV YKSW SFI LL +CYLW++P SR  CLY SP+IV YAT+LI+IQYIYGFNL ELP   +  S S +  SEIG HK  IPTGPLA M+SFLV+FWLTLRLFMTD  +N SK   I N+     S+    E YFGNVDN  Y+K V  L   CE YWI  CCFAMLFVS+   +V+FRIVYM+LLVYFL+ FM SYSFWR+QM VFWW VI Y+V  LL IY +QF +     +N TGLSEEIL+DIGLK ++ASDL + L  P +FLV++I+QVRYFH  FL+L+SM +    +  +   V   +D ++   +  S  N   FI DVN+      EKLK  + +    +WR +ECHFTK +V  IV  CI + +A NI+LI+++VIGFPF +LHT++VT  F   +  V++KMIYQ+K    FNW TNCS Y    N SM+ IDNAKW+GLEK+ NFQ HI KWTA+LV CA+WH+V+YHQ QFYK     KP+T +IF E  + S  ++  +L K+ +NF F K+GLELSFI TV+V+CLR+DVYSLVYL++LL+FL  +R +C+ +WLPYM+FLG+LLP++Y ICVGLPPGLC +YPL  + + L++WL+LP+Y+  P   KI+ADF Q++FV LQY+VF +E     +++   + R  L     K+I KDF+S K SYVDYLKH +FYWSYWL+LAI+F TGVFWITLF LGY+++AFIYLWMGQ +++ K+ +LI S NVI+YYNF VIL+KC  QL+GC +M+ + +K  CWM+ LF +QCINPMSW+     +  +HG      CSSV SGLHWDV CF FIILQR IF    F  V LDL+VQN+F+SRGAYLIN ++M SI +QK  EE  L++I+ KI KI QRQAQHGKPELNEHYLV+RSGD YLFE DS+++D +   +   S     T++ E                  +L +  +   ++V T   R+L         S    R + +N+ K I  I +K+ ++ + S +DD   L +  T+NPL LIN  +++GP+ AIR++KR+ S                     S   V LD+                LP+ Y +     P    SE   E+SF S+ + DN  TN      L L++    E+E +Y +       N  + S  + +SN         +   ES W  FK  I +   FI +T  +L VL N WT+EY R  R L+ EK+LVK  VLS    E+D ++  E  + + V DG  +   S+++EE  K+  FRRSRS+FF L IS G VAIIYSEF CYFLLI+NH+LSGNL SLPYP +VF W MLSVPRPSKNFWI LITYTE+VIV KYI QFN I  N       R+DPL +PLI+GIEKS+ YAI+D+IQLLF+FLHR YLK NGLWRDH+EF +D++I ++E+   N I+    +S+  +     NPI ++++FY KMTN K NK+VDVY  MFLCEF A LIII GY SFGPGTDS  +A DFIKTNK PVPFI MIITQF+FIIIDRALFLRKQVKGKF+FQIFHV+LIHAWLFFALP+ITK+KFNSQ  PQLLYF+KC+YFALS+YQM+SGYP+RILGNFLTR++NY NL  FK YM +PFLYELRNVMDWMWTD+SVA +HWMEVED+F KIFVLKCWR  E  +PT RG  RRL  KYS+G L+L FFF C WGPL +SSFIG TFVK PPIEC+FSI+VG YSPLF F SRENN++ L K TF++MKEC+K   P  DYL SFE  D TQI ID +SD+VW ITPP L+KLK KL     SLKINMQA+CER S+DSK+TEK+VR T ++ L   +K NLL  I    +S  V +  IFPRFLTAYKRTLSEA +L ++ N TYLN++LSMK +N   WWE+ EI+ G++YC N   P + +  LT+FIF+ER+SDN+FGH+FS+YGI+G+YAAY FV HR LR FYS+ISYII  EELP+VDRI  LL+EIYLVRENK  RLEEQLIAKLIFLYRS+ETMIKWT+H KS L  N +E+  +D  DN
Sbjct:    3 WVTFDYILLRGFLPVCLLGSTITRYNGFSFIYLLLLLVCPFIRY-NRIHIRIPIQIFLIILITVSGLFSLSISLFHIPLIFNPLFLSNCTDKLTSISHQIGITNLKGVLFYRVVRLVLPDYVTLITSIVLLIYFRKYTTKSYQVPIHDKQSQEDNHNNVISDDGHTPDSLLPGPSRPLKRLTEDTTTETSFLQHES--GNILSENNAEH---------HQSRKIHDNHNYLHDTLGIDRLQKKIWRAWAMQSLFVFFNVVVTGFAGIISPSILNSVYLFGFLGICTFWACGNKVITTNFAYMRIFLLMYSAIHVCLLYLVQIEFVQYYLPNNNFSSRLLGLYYLVNTSCQTRGEVNFYTHRWIDYLSPCIIMYVYYLCATETRRWFEKGRESVPRVRSYKED---IKMSSLKQSNEHDPELQQLIPDKEAVNQTGSLLTSSVSKHGEYQTIFRPNQTLDSKAAGPSMAVLDDDRIKSPLLIPTPTERPLLLSIINTAIRNSFVFTFIAMMAWSVTYKSWMSFILLLSACYLWMMPDSRKACLYMSPLIVFYATVLIIIQYIYGFNLTELPEFSYTASGSTVDLSEIGFHKWAIPTGPLAVMISFLVIFWLTLRLFMTDTLLNASKQNEILNDSKFDQSSNADSEAYFGNVDNMIYKKIVSFLNGICEKYWILVCCFAMLFVSIQEPVVVFRIVYMLLLVYFLMTFMFSYSFWRKQMYVFWWFVIVYSVIVLLCIYTYQFNQFPYLWKNKTGLSEEILQDIGLKTYEASDLFKGLLTPVVFLVVIIVQVRYFHKPFLKLSSMNRF---LYGDSREVGPFEDNLNISTSSSSTSNVSAFIEDVNSAFQIIIEKLKQFFEVIYAKVWRFFECHFTKIVVFCIVSACINEENACNIVLIILVVIGFPFHKLHTILVTGSFFWCSLTVLMKMIYQLKTVNKFNWSTNCSLYTTNFNKSMDQIDNAKWIGLEKVNNFQDHIWKWTAVLVVCALWHVVKYHQRQFYKCPNATKPETGIIFPETTVQSIDDSLINLFKFCINFAFYKLGLELSFIVTVIVACLRVDVYSLVYLILLLIFLCTQRKICSKIWLPYMLFLGVLLPIEYAICVGLPPGLCQKYPLTSLKENLQRWLFLPSYEYPPSAKKIMADFFQFVFVALQYRVFIIENSLTVNNYGGGRNRPILCNELPKTIDKDFVSTKDSYVDYLKHAIFYWSYWLSLAIVFTTGVFWITLFCLGYMILAFIYLWMGQNIMLRKRSNLIASWNVIIYYNFFVILSKCTLQLIGCAYMDWMISKRFCWMIPLFGVQCINPMSWDRNMLAVNRMHG----DPCSSVKSGLHWDVTCFLFIILQRKIFMTKNFCHVVLDLNVQNRFASRGAYLINRKMMASIREQKLKEECVLDKIKMKIDKIIQRQAQHGKPELNEHYLVVRSGDKYLFEGDSDEDDEDVEGDIDESCSKKMTVTSEDTFDKNTSNNQNKKCSVDSLDSQGLFNAVNVVTSHSRNLLKPISESRCSTESSRKSLDNQNKIIKEINKKDAKDSDSSEEDDANPLQVQNTINPLHLINRAMEQGPRSAIREFKRTQSECKENLPSNRRSSVHLGSRLESMSSVGLDIHGSRQTRRSEHDELSSLPDAYNT----PPPAHISETTTEDSFHSAAIQDNQLTNDQAQLTLDLYSANTPESE-KYLNPLIYRDTNISSNSVPELISNDETDKKIEKSAHPESCWSKFKASILIVYYFIQTTTDNLIVLINTWTKEYRRIRRTLDNEKRLVKLKVLSKISNEVDGRIELEAIVVEIVGDGSHNFVNSKNQEEYLKEQEFRRSRSRFFLLAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFN--ETTNDRVDPLWIPLIIGIEKSKNYAILDLIQLLFIFLHRGYLKNNGLWRDHTEFAQDLEIVDKEQDGRNKIKSSYEESSPTSNKWSCNPIYKMRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDTSVALFHWMEVEDVFCKIFVLKCWRRSELEYPTVRGNTRRLASKYSVGGLLLAFFFICFWGPLTLSSFIGTTFVKNPPIECTFSISVGGYSPLFYFISRENNLKSLPKDTFDKMKECYKNFSPPTDYLMSFEAGDVTQISIDGSSDDVWTITPPSLEKLKVKLR-STESLKINMQAICERRSSDSKTTEKMVRHTNTKQLDENDKKNLLKAIEANQSSYVVQIDAIFPRFLTAYKRTLSEATALLKDHNQTYLNLTLSMKKENEARWWEIQEIVAGETYCSNEKIPKQSHSNLTVFIFSERVSDNLFGHLFSNYGIIGMYAAYIFVAHRVLRAFYSDISYIIRCEELPHVDRILNLLNEIYLVRENKMFRLEEQLIAKLIFLYRSTETMIKWTRHNKSILSKN-MEKTKSDAIDN 2573          
The following BLAST results are available for this feature:
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PIEZO16.279e-11627.20piezo type mechanosensitive ion channel component ... [more]
PIEZO21.279e-10737.14piezo type mechanosensitive ion channel component ... [more]
PIEZO21.608e-10737.14piezo type mechanosensitive ion channel component ... [more]
PIEZO22.054e-10737.14piezo type mechanosensitive ion channel component ... [more]
PIEZO21.242e-5246.36piezo type mechanosensitive ion channel component ... [more]
back to top
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pezo-16.864e-9827.83Piezo-type mechanosensitive ion channel component ... [more]
pezo-11.510e-9427.85Piezo-type mechanosensitive ion channel component ... [more]
pezo-11.510e-9427.85Piezo-type mechanosensitive ion channel component ... [more]
pezo-11.865e-9427.85Piezo-type mechanosensitive ion channel component ... [more]
pezo-12.030e-9427.85Piezo-type mechanosensitive ion channel component ... [more]
back to top
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Piezo2.028e-11831.21gene:FBgn0264953 transcript:FBtr0335183[more]
Piezo1.318e-11630.71gene:FBgn0264953 transcript:FBtr0335181[more]
Piezo4.592e-11231.81gene:FBgn0264953 transcript:FBtr0335182[more]
Piezo5.217e-11231.81gene:FBgn0264953 transcript:FBtr0335179[more]
Piezo7.089e-11231.93gene:FBgn0264953 transcript:FBtr0335177[more]
back to top
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LO018508.12.257e-11537.23pep chromosome:GRCz11:2:54327160:54353625:1 gene:E... [more]
piezo2a.21.675e-11235.76piezo-type mechanosensitive ion channel component ... [more]
piezo14.331e-10926.74piezo-type mechanosensitive ion channel component ... [more]
piezo2a.22.485e-10535.76piezo-type mechanosensitive ion channel component ... [more]
CU179656.12.540e-8724.14pep chromosome:GRCz11:2:54086436:54270366:1 gene:E... [more]
back to top
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PIEZO23.542e-13234.39piezo-type mechanosensitive ion channel component ... [more]
PIEZO24.504e-13234.35piezo-type mechanosensitive ion channel component ... [more]
PIEZO29.662e-13235.46piezo-type mechanosensitive ion channel component ... [more]
chordc14.333e-12534.59cysteine and histidine rich domain containing 1 [S... [more]
chordc15.243e-12534.59cysteine and histidine rich domain containing 1 [S... [more]
back to top
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Piezo11.003e-11127.61piezo-type mechanosensitive ion channel component ... [more]
Piezo11.054e-11127.61piezo-type mechanosensitive ion channel component ... [more]
Piezo23.180e-10536.97piezo-type mechanosensitive ion channel component ... [more]
Piezo23.182e-10537.12piezo-type mechanosensitive ion channel component ... [more]
Piezo23.778e-10537.12piezo-type mechanosensitive ion channel component ... [more]
back to top
BLAST of Piezo-type mechanosensitive ion channel component vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q92508|PIEZ1_HUMAN3.015e-11527.20Piezo-type mechanosensitive ion channel component ... [more]
sp|M9MSG8|PIEZO_DROME5.229e-11131.81Piezo-type mechanosensitive ion channel component ... [more]
sp|E2JF22|PIEZ1_MOUSE8.314e-11127.53Piezo-type mechanosensitive ion channel component ... [more]
sp|Q0KL00|PIEZ1_RAT1.621e-11027.62Piezo-type mechanosensitive ion channel component ... [more]
sp|Q9H5I5|PIEZ2_HUMAN6.142e-10737.14Piezo-type mechanosensitive ion channel component ... [more]
back to top
BLAST of Piezo-type mechanosensitive ion channel component vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0L8GDG70.000e+033.09Piezo-type mechanosensitive ion channel component ... [more]
A0A0L8GDH10.000e+032.92Piezo-type mechanosensitive ion channel component ... [more]
A0A0L8GD910.000e+032.92Piezo-type mechanosensitive ion channel component ... [more]
A0A0L8GD760.000e+032.92Piezo-type mechanosensitive ion channel component ... [more]
A0A0L8GD870.000e+032.98Piezo-type mechanosensitive ion channel component ... [more]
back to top
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
piezo2a.25.263e-10736.08piezo-type mechanosensitive ion channel component ... [more]
PIEZO26.348e-10736.95piezo type mechanosensitive ion channel component ... [more]
piezo2a.24.072e-10636.73piezo-type mechanosensitive ion channel component ... [more]
piezo12.848e-9926.52piezo-type mechanosensitive ion channel component ... [more]
piezo15.005e-1122.34piezo-type mechanosensitive ion channel component ... [more]
back to top
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000009619.11.032e-3147.29pep scaffold:Pmarinus_7.0:GL484020:1370:4517:1 gen... [more]
back to top
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO302923.093e-5235.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO473711.427e-4129.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO473702.444e-2931.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO473691.008e-2249.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO473721.353e-1930.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
piezo16.400e-11735.10piezo type mechanosensitive ion channel component ... [more]
PIEZO22.780e-10225.52piezo type mechanosensitive ion channel component ... [more]
PIEZO26.273e-10225.57piezo type mechanosensitive ion channel component ... [more]
PIEZO21.800e-10125.94piezo type mechanosensitive ion channel component ... [more]
ENSORLT00000004626.22.553e-9735.34pep primary_assembly:ASM223467v1:7:7477416:7483305... [more]
back to top
BLAST of Piezo-type mechanosensitive ion channel component vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000010240.10.000e+099.33SMESG000010240.1[more]
SMESG000010240.10.000e+098.31SMESG000010240.1[more]
SMESG000010240.10.000e+098.19SMESG000010240.1[more]
SMESG000051188.10.000e+052.57SMESG000051188.1[more]
SMESG000051188.10.000e+052.61SMESG000051188.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011204 ID=SMED30011204|Name=Piezo-type mechanosensitive ion channel component|organism=Schmidtea mediterranea sexual|type=transcript|length=7801bp
CCGATCTTTAAATATGAAATTGTTACTGTTTTTTCTTGGTTCGATTATCG
AAAGATAAATTAAAACGCATTCAATTTCCTCAATCGATCGAGCACATAAA
TGAGTTTGATTTATGTTTATATTCAACGTTTTCTTTTGAGAGCATTTCTT
CCATTTATCTTGCTAGGATGTGCAGTAGCTCGACTGAATGGATTTTCATT
TGTCTACTTGCTGATGCTGTTGGTTTGTCCGCTGTTACGGTACCACAATC
AGCCAGGTGGTCAGAGGCCGGTTAAGATTTTTCTGATTGCTCTCATATTG
ATCAGTAGTTTATTTGTTTTTTCAAATGCCGCAGTCAATGTCTCGGTTAT
TTTCCGCCCGGACTTGCTTGCCAATTGCACGGACGGACTCACTGCCGCAT
CTCACCAACTGGGAATCGTCAATCTCCATGGAATAAAATACAGTTTACTT
ACAAGAATAATTTTGCCTGACCTAGTAGCCCTGGTCATTGCTGTAATATT
ATTAGTTCTATTAATTAAAATGAAATTGGAAAGCACGGATGTAAAATGTA
AAAACCAGATCATTGAGGAGAAATTCCCATGCGGCATTAGCCTAATCAAA
CCGTGTGAGGATGATCCAGAAAATGAAGCCACAAAAGTGGAAGTTATCAT
TCAAAGATCCAGCCTTTCCAATCTAAAAAACGAAAATCAAAACCGGAATA
GTATCCCGATGAAACCAATCAAATCTCACTGTAGCAGAAAAGTCCAACCC
ACCGACAATTACATGAGGAAGGCCCTCGGAATTGACGAATTACATAATAC
CAAATTGAGGCATTGGGCTACGCAGAGTCTTTTTGCCTTTTTCAATATAG
TCATTACTGGATTCGCGGGAATCATTTCGCCATCGCTTCTGAACTTGGTT
TATCTATTAAGCTATCTGGGAGTCGGGACATTTTGGGCTTGTGGAAACAA
TGTCATGACGTCGAACTTCGCTCGAATGCGTCTATTTCTTCTTCTATATT
CCGCTGCCCATGTCTGCCTTATCTTCATCGTCCAGCTGGAATTTATGCAA
CTTTACATTCCAACTGGTCAGCGGTTGTCAAGGCTTCTTGGCTTGTATTT
AATGTTTGATACGAATTGCAAAAATAGAGGGGAAATTATTTTTAACAACC
AGAGATCCATTGATTACGTGTCCCCCTTTATCATTCTTTATGTTTACTAC
CTCTCTGCCATTGAAACGAGGATATGGCTTGAAGAACGCAAAAGGATCAA
TAAGGAAAGGCCTGCGGTGGACAAGGAGACTTTTATCCACACGGAAAGTT
ATCTCTCAGGAGAGGAAATAAATCAAGAAGAATCTCAAAGAATCAGTAAC
TCTTTCAATGTGGAGATCGGATCAAATGTCTCTGATGGTCCTTACATTGA
TTTTACGGACGTTCCTCACGTTTTGGACGCACAAAACTCAAGATCAACTC
TTTTCATCGAAGAAGACATCACCAAAGACATGGAAAAGAACCAAGTGAAA
GAGCGTCCTCTCTTACTCAGCATAATCAACACAATGATTTCCAATAGTTT
CATTTTAACCTTTATGGCGATGATGGCTTGGAGTGTGGCATATAAATCAT
GGGCTTCGTTTATATTCCTTCTGTGCTCGTGCTACCTGTGGATAATTCCC
CACTCGAGAGTCATGTGCCTCTATGCAAGCCCGGTGATTGTCACCTATGC
AACGCTGTTGATTCTCATTCAATACATTTACGGTTTTAATCTCCCAGAAC
TGCCAACGATATTTAGAATCTCCTCTTCAGAAATGCAATCTTCTGAAATC
GGTCTCCATAAATCGTTGATTCCCACCGGTCCTCTAGCTGCTATGATGAG
TTTTCTGGTGGTGTTTTGGCTTACGCTTCGGTTGTTCATGACAGACGAAA
AGATCAACAAAAGTAAAATTTGCAACGAGAAAATTTCTACTCAACAAAAA
CTGGAACATTATTTTGGCAATGTTGATAACGCAACTTATGAAAAATTTGT
TAAATGTTTGAAAGAAAAATGTGAAAATTATTGGATATTTTCATGTTGTT
TTGCAATGCTTTTTGTATCAGTCAACGGATCTATTGTCTTATTCAGAATC
GTCTATATGGTCCTGTTGGTGTACTTCCTGTTGGTTTTCATGTTATCGTA
TTCCTTTTGGCGGCGGCAGATGAAAGTGTTTTGGTGGACAGTTATTGGAT
ACAATGTGTTCGGATTGCTGTCAATTTATGTCTTCCAGTTTCAAAGGATA
TCAATGAAAGTTCAAAATATAACTGGTCTGTCCGAAGAAATATTAAGAGA
CATCGGATTAAAACGCTTCCAAGCCTCAGATTTGCTACAAAGTCTCTTTA
TTCCGGCGATATTTTTAGTGATATTAATAATCCAAGTTCGCTATTTCCAC
AGTCGATTCCTGGAGCTGACATCCATGAAGCAAACTCAAGTTTGCGTGGA
AAGTGAAAGAGAACGAGTGAAAAGCAGTAAAGATGAAATGGATAAAAATA
AGTTTTCAGTAAAAAATACCGTCGAATTCATCAGAGATGTCAACAATATG
GTCTTTACCGCTACAGAAAAACTAAAATCGCTTTATACGCTAACTCAGCC
TTCAATTTGGCGGCTTTGGGAGTGCCATTTCACCAAGTTCTTGGTCATTT
TGATCGTTTATGTGTGTATCATTGATGTCCATGCGATGAACATAATATTA
ATCCTGATTATTGTTATTGGGTTTCCATTTCCTCGCCTCCATACGGTCAT
GGTGACTGCGCTGTTCGTTTGCAGCGCTTCGATTGTCATACTGAAAATGA
TCTACCAAATCAAGATCTTTCAGACATTTAACTGGTTGACAAATTGTTCG
CAATATGGAAACTTTGCCAATTCTTCAATGGAGATCATCGACAATGCCAA
GTGGCTTGGTTTAGAAAAACTGGAGAATTTTCAGCTACATATTTTGAAGT
GGACAGCCATTCTGGTGGGATGTGCAGTCTGGCACATTGTGAGATATCAT
CAGATGCAGTTTTACAAGCTTAACCTCGATCAAAAGCCGAAGACTAGCGT
TATATTTCAGGAAGTCGAAATTCACAGCTCCATTGAAAACTTTTGCGATT
TACTGAAATATTCTTTGAATTTCGGTTTCCAAAAAATAGGACTGGAACTT
AGTTTCATTTGTACAGTTGTCGTGTCTTGTTTACGGATTGACGTGTATTC
GCTCGTGTACCTTTTAATGCTTCTTCTATTCCTCATTTTGAAGCGAGACT
TATGCAATGTTCTTTGGCTTCCATATATGATATTTCTTGGTATTTTATTA
CCAGTCCAATACGTTATTTGTGTCGGTTTGCCGCCAGGATTGTGTATTGA
ATATCCTCTAAATGTGATACCCAAACTCCGACAATGGCTTTATTTGCCAA
ATTATAAAGTTTCCCCTGTGCCGGGGAAAATATTGGCTGACTTTGTGCAA
TATATTTTTGTCGTTCTTCAATATCAAGTATTCCAAATGGAAAAACGTAA
AAAGTCCGACAGCCATAAATTGGTCAAACAACGGTTGTTGGAAGGCTTTC
AAAAGTCCATTCATAAGGATTTTATCAGTAAAAAAAGCTCATATGTCGAT
TATTTGAAGCACGTCGTGTTCTACTGGTCATATTGGCTTACTCTGGCCAT
TATCTTCATCACAGGGGTATTTTGGATAACTCTTTTTGGACTAGGCTACC
TTCTGATTGCATTCATTTATTTATGGATGGGACAGATTGTACTGATAGGA
AAGCAAAAAAGTCTGATTAGATCGTGTAACGTAATTCTTTACTATAATTT
TCTCGTCATCCTCACAAAATGTATTTTCCAATTGATGGGATGTGTCTTTA
TGAATTTATTAAAAACCAAAGGCCTATGTTGGATGGTGTCATTATTCGCC
ATTCAGTGCATCAACCCCATGTCTTGGGAGATTCGTGGGATACACGGAAA
AAATGCGGATAAACAGTGCTCTTCAGTTGCGAGTGGTCTACATTGGGATG
TTGTTTGTTTCTTTTTTATTATTCTTCAAAGAATGATTTTCACGGCTGAT
CCTTTTCTTTTGGTGAAACTGGATCTTCATGTTCAAAATAAATTTTCGTC
GAGAGGAGCATATTTGATCAATCTGGAAATCATGAAGTCTATAGAAAAAC
AGAAAAAATCGGAAGAAAAAGAATTAAATAGAATTGAAAGGAAAATTAAA
AAAATTGAACAACGTCAAGCGCAGCATGGAAAACCAGAATTAAATGAGCA
TTATTTGGTAATGCGTTCCGGGGATTATTACTTGTTTGAAGAGGATTCTG
AGGATGAAGATCGTGAAGATGGAGAAGAATCTAGTTTGAGTATGGTCGGT
TCAAATACAATATCTTTGGAAAGCAATCTGCCTACCAGTTCTGTGGGAAA
AGATATTTCAGTTTCAACAGATTCTCAAAGACATTTAGAAGATGATTCGA
ATTCTTTAGACAGGCACACAAATGAGAATAAGCGAAAATCCATAGGAATA
ATCTTGGAGAAAAATGAACAAGAAGATGAAAAGTCAGGAGATGATGATCT
TTCACTGATTGGGACTCTTAATCCCTTACAATTAATAAATGCTGTTGTAA
AGGAAGGCCCTAAACAAGCCATTCGGCAATACAAAAGGTCTTTTTCTAGT
GTCCATTCTAGTAGCCATTTGCGTGTAAACCTCGATATGCTGCCGAACGA
ATACGAATCATGCTGCATTGAAAATCCTGATGTATCCCCATCAGAAGAGG
TTCGTGAAAATTCCTTCCGTTCATCTACCGTCCATGATAACTCAACCAAT
TTCCCTCAATATCATAATCTACATCTCCATACTCCAATACCTTCAGAAAA
TGAAACGCGTTACCAATCGTCGCATAATACAGCGATTGTCAACACAGGCA
CCGAATCATCCGTCGATCCAGTCTCAAATGGCAACCAAAGATTAGAAAGC
AGTTGGGAGAATTTCAAAAATGTCATCAAATTGTGCGTTTGTTTTATCGG
ATCAACAATGGCGAGCTTGACAGTTTTATTCAACGAATGGACGCGAGAAT
ATTACAGAAATATCCGGAAATTGGAAGAGGAAAAGAAACTAGTCAAGTCT
CATGTTCTGTCGACATTTATCGAAATCGACGAGAAATTGGGGCAAGAAAT
TGAAAAATTCGTCAAAGATGGAAGAAAGTCTGTGTCGGAGGATAAAGAAG
AGAAAAATAAGCAAGATGTTTTTCGTCGTTCGAGATCTAAATTTTTCTCT
TTACTCATTTCATTTGGGAAAGTTGCAATAATTTATTCGGAATTCGGATG
CTACTTTCTGCTGATTATGAATCATTTGCTGTCGGGAAATTTGCTTTCCT
TACCTTATCCTTTTCTTGTTTTCTTTTGGGGAATGCTTTCGGTGCCACGT
CCATCAAAGAACTTTTGGATTGTTCTCATCACGTATACTGAGCTGGTAAT
CGTGTTTAAATATATTTGTCAATTCAATTTAATAAAGCTCAACGTCCTCC
CCGTCCCGGAGCACCGAATAGATCCCTTGGCTCTGCCTTTGATTCTGGGA
ATTGAGAAATCTAGAACTTATGCTATCATTGATGTTATCCAACTGCTTTT
CTTATTTTTACATCGAAGCTACTTAAAAGGCAACGGACTTTGGCGAGATC
ATTCAGAATTTTACAAAGATATCAAAATTTCCAATGAGGAAGAAGTCAAT
CATATCCAGCCATTGAAGCCCCAATCCGCAATGAGAACCGGAATAAAATT
CCGTAATCCGATCAAACAGTTGAAAAAGTTTTACGGAAAGATGACGAACC
GGAAGTTGAACAAACGAGTCGATGTATACGCAATTATGTTTTTGTGTGAA
TTCACAGCGATGTTGATAATCATTCTTGGATATTTTTCGTTCGGTCCAGG
GACCGACTCTGGGGGTCACGCGATTGATTTCATTAAAACAAATAAGACTC
CGGTGCCTTTTATTGCTATGATAATAACACAATTTATCTTCATTATAATC
GACCGAGCACTTTTCCTCAGGAAACAGGTCAAGGGGAAATTTGTCTTTCA
AATATTCCATGTGATTCTCATTCACGCCTGGCTATTTTTTGCGCTGCCTT
ACATCACCAAGAGGAAGTTCAATTCACAGTTTCCTCCTCAATTATTGTAT
TTCATCAAATGCGTTTATTTTGCACTCTCCTCTTACCAAATGAGATCTGG
CTACCCTATGAGAATTCTCGGGAACTTTTTGACGCGGAATTATAACTATG
GAAACTTGATTTTTTTCAAAATATATATGGGCATTCCGTTCCTTTATGAA
TTGAGGAACGTCATGGACTGGATGTGGACTGATTCTTCCGTTGCCTTCTA
TCACTGGATGGAAGTTGAGGACATCTTCAGTAAGATTTTCGTTCTCAAAT
GTTGGCGATATGGCGAAACGATTTGGCCGACAGAAAGAGGAAGAAATCGA
CGATTAGTCGTCAAATATTCACTTGGAATATTAATATTAATATTTTTCTT
TTTCTGCATTTGGGGGCCCCTGATGATTAGCAGCTTTATTGGGATCACCT
TTGTCAAATATCCACCGATTGAATGCTCATTCTCTATTAATGTTGGTGAT
TATAGCCCTTTATTCGTATTCAGCTCTCGGGAGAACAACATGAGACCCTT
GACTAAAAAAACGTTTGAGGAAATGAAAGAATGCCATAAATTTCATTTGC
CGTCAAAGGATTACTTGCAAAGTTTTGAACCGGATGATGCCACGCAAATC
ATTATTGACTACGCATCGGATAACGTTTGGCTGATAACCCCTCCCGGTTT
GAAGAAGCTAAAAGAAAAATTATCAATTCCAAGAGCTTCATTGAAGATAA
ATATGCAAGCAGTTTGTGAAAGGCCGTCCACAGATTCAAAATCCACTGAG
AAAATTGTCCGATTTACGCAATCGAGATTCCTAACGAATCCTGAGAAAGC
AAATTTGTTGCATTTGATAAATACCAAATTCAACTCAACAAATGTTTATC
TGCCCACAATTTTCCCGAGATTTCTCACGGCCTATAAGCGAACTCTCTCC
GAGGCCAATTCTCTGCATCAGAATCAAAATAATACGTATTTGAACATTAG
CTTATCAATGAAAACCGACAACGCAATGATGTGGTGGGAGGTCAATGAGA
TCATCCAAGGTCAGTCATATTGCCCAAATCCCGACAGCCCAGCCAAGAAA
TATTTGTTTCTTACAATTTTCATCTTCAATGAACGCATATCCGATAATAT
TTTCGGACATATATTTAGTAGTTATGGAATATTAGGAATCTATGCGGCGT
ACTTTTTTGTGGTTCATCGGTTTCTGCGGACCTTTTATTCCAACATCTCC
TACATCATACCAGCAGAGGAATTGCCAAATGTCGATCGGATCCACAAATT
GCTCCACGAGATTTATTTAGTGCGAGAAAATAAAAAGCTTCGACTGGAAG
AACAATTGATAGCGAAGTTGATATTTCTGTACCGGTCATCAGAAACTATG
ATCAAGTGGACGCAGCACTGGAAGTCCACCCTTGAAGCTAATCAGGTGGA
ACGGGTCAGTGCTGATGATGCTGACAACGGGCTGTCTATGATTTCTGTGG
ACAACACCAGTCGAGAGAGCTTTGTCAGTCTTGTCAATGATCATTCCGTG
AAAACTTAGTTTAATAAAACAATTCATCTATTGTTTTAATCAACTGTAAA
TTGTCTCATGTGATCAATTGAAATATTTTATTTTCTAGGAATATTTTTAC
TTTGACGAGAAACTTTACAAATTTTATTATTAGATTTTTCCATATCCTAT
C
back to top

protein sequence of SMED30011204-orf-1

>SMED30011204-orf-1 ID=SMED30011204-orf-1|Name=SMED30011204-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2520bp
MSLIYVYIQRFLLRAFLPFILLGCAVARLNGFSFVYLLMLLVCPLLRYHN
QPGGQRPVKIFLIALILISSLFVFSNAAVNVSVIFRPDLLANCTDGLTAA
SHQLGIVNLHGIKYSLLTRIILPDLVALVIAVILLVLLIKMKLESTDVKC
KNQIIEEKFPCGISLIKPCEDDPENEATKVEVIIQRSSLSNLKNENQNRN
SIPMKPIKSHCSRKVQPTDNYMRKALGIDELHNTKLRHWATQSLFAFFNI
VITGFAGIISPSLLNLVYLLSYLGVGTFWACGNNVMTSNFARMRLFLLLY
SAAHVCLIFIVQLEFMQLYIPTGQRLSRLLGLYLMFDTNCKNRGEIIFNN
QRSIDYVSPFIILYVYYLSAIETRIWLEERKRINKERPAVDKETFIHTES
YLSGEEINQEESQRISNSFNVEIGSNVSDGPYIDFTDVPHVLDAQNSRST
LFIEEDITKDMEKNQVKERPLLLSIINTMISNSFILTFMAMMAWSVAYKS
WASFIFLLCSCYLWIIPHSRVMCLYASPVIVTYATLLILIQYIYGFNLPE
LPTIFRISSSEMQSSEIGLHKSLIPTGPLAAMMSFLVVFWLTLRLFMTDE
KINKSKICNEKISTQQKLEHYFGNVDNATYEKFVKCLKEKCENYWIFSCC
FAMLFVSVNGSIVLFRIVYMVLLVYFLLVFMLSYSFWRRQMKVFWWTVIG
YNVFGLLSIYVFQFQRISMKVQNITGLSEEILRDIGLKRFQASDLLQSLF
IPAIFLVILIIQVRYFHSRFLELTSMKQTQVCVESERERVKSSKDEMDKN
KFSVKNTVEFIRDVNNMVFTATEKLKSLYTLTQPSIWRLWECHFTKFLVI
LIVYVCIIDVHAMNIILILIIVIGFPFPRLHTVMVTALFVCSASIVILKM
IYQIKIFQTFNWLTNCSQYGNFANSSMEIIDNAKWLGLEKLENFQLHILK
WTAILVGCAVWHIVRYHQMQFYKLNLDQKPKTSVIFQEVEIHSSIENFCD
LLKYSLNFGFQKIGLELSFICTVVVSCLRIDVYSLVYLLMLLLFLILKRD
LCNVLWLPYMIFLGILLPVQYVICVGLPPGLCIEYPLNVIPKLRQWLYLP
NYKVSPVPGKILADFVQYIFVVLQYQVFQMEKRKKSDSHKLVKQRLLEGF
QKSIHKDFISKKSSYVDYLKHVVFYWSYWLTLAIIFITGVFWITLFGLGY
LLIAFIYLWMGQIVLIGKQKSLIRSCNVILYYNFLVILTKCIFQLMGCVF
MNLLKTKGLCWMVSLFAIQCINPMSWEIRGIHGKNADKQCSSVASGLHWD
VVCFFFIILQRMIFTADPFLLVKLDLHVQNKFSSRGAYLINLEIMKSIEK
QKKSEEKELNRIERKIKKIEQRQAQHGKPELNEHYLVMRSGDYYLFEEDS
EDEDREDGEESSLSMVGSNTISLESNLPTSSVGKDISVSTDSQRHLEDDS
NSLDRHTNENKRKSIGIILEKNEQEDEKSGDDDLSLIGTLNPLQLINAVV
KEGPKQAIRQYKRSFSSVHSSSHLRVNLDMLPNEYESCCIENPDVSPSEE
VRENSFRSSTVHDNSTNFPQYHNLHLHTPIPSENETRYQSSHNTAIVNTG
TESSVDPVSNGNQRLESSWENFKNVIKLCVCFIGSTMASLTVLFNEWTRE
YYRNIRKLEEEKKLVKSHVLSTFIEIDEKLGQEIEKFVKDGRKSVSEDKE
EKNKQDVFRRSRSKFFSLLISFGKVAIIYSEFGCYFLLIMNHLLSGNLLS
LPYPFLVFFWGMLSVPRPSKNFWIVLITYTELVIVFKYICQFNLIKLNVL
PVPEHRIDPLALPLILGIEKSRTYAIIDVIQLLFLFLHRSYLKGNGLWRD
HSEFYKDIKISNEEEVNHIQPLKPQSAMRTGIKFRNPIKQLKKFYGKMTN
RKLNKRVDVYAIMFLCEFTAMLIIILGYFSFGPGTDSGGHAIDFIKTNKT
PVPFIAMIITQFIFIIIDRALFLRKQVKGKFVFQIFHVILIHAWLFFALP
YITKRKFNSQFPPQLLYFIKCVYFALSSYQMRSGYPMRILGNFLTRNYNY
GNLIFFKIYMGIPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLK
CWRYGETIWPTERGRNRRLVVKYSLGILILIFFFFCIWGPLMISSFIGIT
FVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHL
PSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKI
NMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVY
LPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAMMWWEVNE
IIQGQSYCPNPDSPAKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAA
YFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLE
EQLIAKLIFLYRSSETMIKWTQHWKSTLEANQVERVSADDADNGLSMISV
DNTSRESFVSLVNDHSVKT*
back to top

protein sequence of SMED30011204-orf-2

>SMED30011204-orf-2 ID=SMED30011204-orf-2|Name=SMED30011204-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=138bp
MLFCNAFCISQRIYCLIQNRLYGPVGVLPVGFHVIVFLLAAADESVLVDS
YWIQCVRIAVNLCLPVSKDINESSKYNWSVRRNIKRHRIKTLPSLRFATK
SLYSGDIFSDINNPSSLFPQSIPGADIHEANSSLRGK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR027272Piezo
IPR007087Znf_C2H2
IPR031334Piezo_RRas-bd_dom
IPR031805Piezo_dom
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0008381mechanically-gated ion channel activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0034220ion transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1345..1372
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1398..1459
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1412..1439
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1440..1459
NoneNo IPR availableTMHMMTMhelixcoord: 745..767
NoneNo IPR availableTMHMMTMhelixcoord: 1980..2002
NoneNo IPR availableTMHMMTMhelixcoord: 2012..2029
NoneNo IPR availableTMHMMTMhelixcoord: 1054..1076
NoneNo IPR availableTMHMMTMhelixcoord: 1229..1251
NoneNo IPR availableTMHMMTMhelixcoord: 667..686
NoneNo IPR availableTMHMMTMhelixcoord: 1909..1931
NoneNo IPR availableTMHMMTMhelixcoord: 574..596
NoneNo IPR availableTMHMMTMhelixcoord: 15..37
NoneNo IPR availableTMHMMTMhelixcoord: 243..260
NoneNo IPR availableTMHMMTMhelixcoord: 1025..1047
NoneNo IPR availableTMHMMTMhelixcoord: 1172..1194
NoneNo IPR availableTMHMMTMhelixcoord: 58..80
NoneNo IPR availableTMHMMTMhelixcoord: 1111..1128
NoneNo IPR availableTMHMMTMhelixcoord: 523..545
NoneNo IPR availableTMHMMTMhelixcoord: 117..139
NoneNo IPR availableTMHMMTMhelixcoord: 1198..1217
NoneNo IPR availableTMHMMTMhelixcoord: 1743..1762
NoneNo IPR availableTMHMMTMhelixcoord: 296..318
NoneNo IPR availableTMHMMTMhelixcoord: 693..715
NoneNo IPR availableTMHMMTMhelixcoord: 644..663
NoneNo IPR availableTMHMMTMhelixcoord: 2383..2405
NoneNo IPR availableTMHMMTMhelixcoord: 1772..1789
NoneNo IPR availableTMHMMTMhelixcoord: 1716..1738
NoneNo IPR availableTMHMMTMhelixcoord: 880..902
NoneNo IPR availableTMHMMTMhelixcoord: 947..964
NoneNo IPR availableTMHMMTMhelixcoord: 848..870
NoneNo IPR availableTMHMMTMhelixcoord: 497..516
NoneNo IPR availableTMHMMTMhelixcoord: 2119..2141
NoneNo IPR availableTMHMMTMhelixcoord: 264..283
NoneNo IPR availableTMHMMTMhelixcoord: 356..378
NoneNo IPR availableTMHMMTMhelixcoord: 1951..1973
NoneNo IPR availableTMHMMTMhelixcoord: 471..493
IPR031334Piezo non-specific cation channel, R-Ras-binding domainPFAMPF12166Piezo_RRas_bdgcoord: 2062..2472
e-value: 5.5E-112
score: 375.2
IPR031805Piezo domainPFAMPF15917PIEZOcoord: 1246..1378
e-value: 6.2E-25
score: 88.0
IPR027272Piezo familyPANTHERPTHR13167UNCHARACTERIZEDcoord: 249..2474