Serine/threonine-protein kinase greatwall

Overview
NameSerine/threonine-protein kinase greatwall
Smed IDSMED30011184
Length (bp)1663
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/threonine-protein kinase greatwall (SMED30011184) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/threonine-protein kinase greatwall (SMED30011184) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011184

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30011184SMESG000009373.1 Contig6234_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Human
Match: MASTL (microtubule associated serine/threonine kinase like [Source:HGNC Symbol;Acc:HGNC:19042])

HSP 1 Score: 72.7886 bits (177), Expect = 1.007e-12
Identity = 59/176 (33.52%), Postives = 85/176 (48.30%), Query Frame = 1
Query:  343 IGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCIC-DLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            I +GAFG VY G+     K++A+K VVK+ DM    ++    +  E+  L  L+KS F V L  + Q   N   +LVMEY I  D+  L+               ++ GY   E               +  +Y+ E+   + YL R  I+H DLK DN+LI   GHIK+ DFGL+
Sbjct:   41 ISRGAFGKVYLGQ--KGGKLYAVK-VVKKADM--INKNMTHQVQAERDALA-LSKSPFIVHLYYSLQSANN--VYLVMEYLIGGDVKSLL---------------HIYGYFDEE---------------MAVKYISEVALALDYLHRHGIIHRDLKPDNMLISNEGHIKLTDFGLS 178          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Human
Match: CDK5 (cyclin dependent kinase 5 [Source:HGNC Symbol;Acc:HGNC:1774])

HSP 1 Score: 70.4774 bits (171), Expect = 1.075e-12
Identity = 56/183 (30.60%), Postives = 87/183 (47.54%), Query Frame = 1
Query:  319 ERLKSLTLIGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCICDLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            ++ + L  IG+G +G V+K ++  T ++ ALK+V   +D +    S +++I L    L EL K    VRL        +    LV E+C  DL K   +               NG L  E+               V  +LF+LL G+ +   R+++H DLK  N+LI +NG +K+ DFGLA
Sbjct:    2 QKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICL----LKEL-KHKNIVRLHDVLH--SDKKLTLVFEFCDQDLKKYFDS--------------CNGDLDPEI---------------VKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLA 148          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Human
Match: MASTL (microtubule associated serine/threonine kinase like [Source:HGNC Symbol;Acc:HGNC:19042])

HSP 1 Score: 72.4034 bits (176), Expect = 1.267e-12
Identity = 59/176 (33.52%), Postives = 85/176 (48.30%), Query Frame = 1
Query:  343 IGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCIC-DLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            I +GAFG VY G+     K++A+K VVK+ DM    ++    +  E+  L  L+KS F V L  + Q   N   +LVMEY I  D+  L+               ++ GY   E               +  +Y+ E+   + YL R  I+H DLK DN+LI   GHIK+ DFGL+
Sbjct:   41 ISRGAFGKVYLGQ--KGGKLYAVK-VVKKADM--INKNMTHQVQAERDALA-LSKSPFIVHLYYSLQSANN--VYLVMEYLIGGDVKSLL---------------HIYGYFDEE---------------MAVKYISEVALALDYLHRHGIIHRDLKPDNMLISNEGHIKLTDFGLS 178          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Human
Match: MASTL (microtubule associated serine/threonine kinase like [Source:HGNC Symbol;Acc:HGNC:19042])

HSP 1 Score: 72.4034 bits (176), Expect = 1.313e-12
Identity = 59/176 (33.52%), Postives = 85/176 (48.30%), Query Frame = 1
Query:  343 IGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCIC-DLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            I +GAFG VY G+     K++A+K VVK+ DM    ++    +  E+  L  L+KS F V L  + Q   N   +LVMEY I  D+  L+               ++ GY   E               +  +Y+ E+   + YL R  I+H DLK DN+LI   GHIK+ DFGL+
Sbjct:   41 ISRGAFGKVYLGQ--KGGKLYAVK-VVKKADM--INKNMTHQVQAERDALA-LSKSPFIVHLYYSLQSANN--VYLVMEYLIGGDVKSLL---------------HIYGYFDEE---------------MAVKYISEVALALDYLHRHGIIHRDLKPDNMLISNEGHIKLTDFGLS 178          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Human
Match: CDK1 (cyclin dependent kinase 1 [Source:HGNC Symbol;Acc:HGNC:1722])

HSP 1 Score: 67.0106 bits (162), Expect = 2.946e-12
Identity = 51/179 (28.49%), Postives = 81/179 (45.25%), Query Frame = 1
Query:  343 IGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQE--MGNGAYWLVMEYCICDLTKLVKAFP--QYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            IG+G +G VYKG  + T ++ A+KK+    + +    + I++I L    L EL   +       + Q+  M +   +L+ E+   DL K + + P  QY D                               LV  YL+++L G+ +   R ++H DLK  N+LI   G IK+ DFGLA
Sbjct:   10 IGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISL----LKELRHPNIV-----SLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSS-----------------------------LVKSYLYQILQGIVFCHSRRVLHRDLKPQNLLIDDKGTIKLADFGLA 150          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Celegans
Match: pkc-2 (Protein kinase C-like 2 [Source:UniProtKB/Swiss-Prot;Acc:P90980])

HSP 1 Score: 73.559 bits (179), Expect = 2.338e-13
Identity = 58/189 (30.69%), Postives = 94/189 (49.74%), Query Frame = 1
Query:  304 VIKWSERLKSLTLIGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCICDLTKLVKAFPQYKDDEYLTNEYVNGY-LLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            VIK S+    LT++G+G+FG V  GE + TK++FA+K V+K++ +    +  ++  + EK  L    K SF V L   FQ M                           D  Y   E+VNG  L++++ +      G   + +   Y  E+  G+ +L  + I++ DLK DNV++ ++GHIKI DFG+ 
Sbjct:  482 VIKASD-FNFLTVLGKGSFGKVLLGEQKTTKELFAIK-VLKKDVI--IQDDDVECTMTEKRVLALPEKPSFLVALHSCFQTM---------------------------DRLYFVMEFVNGGDLMYQIQQV-----GKFKEPVAVFYAAEIAVGLFFLHSKGIIYRDLKLDNVMLERDGHIKITDFGMC 634          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Celegans
Match: pkc-2 (Protein kinase C-like 2 [Source:UniProtKB/Swiss-Prot;Acc:P90980])

HSP 1 Score: 73.1738 bits (178), Expect = 2.791e-13
Identity = 58/189 (30.69%), Postives = 94/189 (49.74%), Query Frame = 1
Query:  304 VIKWSERLKSLTLIGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCICDLTKLVKAFPQYKDDEYLTNEYVNGY-LLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            VIK S+    LT++G+G+FG V  GE + TK++FA+K V+K++ +    +  ++  + EK  L    K SF V L   FQ M                           D  Y   E+VNG  L++++ +      G   + +   Y  E+  G+ +L  + I++ DLK DNV++ ++GHIKI DFG+ 
Sbjct:  387 VIKASD-FNFLTVLGKGSFGKVLLGEQKTTKELFAIK-VLKKDVI--IQDDDVECTMTEKRVLALPEKPSFLVALHSCFQTM---------------------------DRLYFVMEFVNGGDLMYQIQQV-----GKFKEPVAVFYAAEIAVGLFFLHSKGIIYRDLKLDNVMLERDGHIKITDFGMC 539          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Celegans
Match: pkc-2 (Protein kinase C-like 2 [Source:UniProtKB/Swiss-Prot;Acc:P90980])

HSP 1 Score: 72.7886 bits (177), Expect = 3.330e-13
Identity = 58/189 (30.69%), Postives = 94/189 (49.74%), Query Frame = 1
Query:  304 VIKWSERLKSLTLIGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCICDLTKLVKAFPQYKDDEYLTNEYVNGY-LLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            VIK S+    LT++G+G+FG V  GE + TK++FA+K V+K++ +    +  ++  + EK  L    K SF V L   FQ M                           D  Y   E+VNG  L++++ +      G   + +   Y  E+  G+ +L  + I++ DLK DNV++ ++GHIKI DFG+ 
Sbjct:  342 VIKASD-FNFLTVLGKGSFGKVLLGEQKTTKELFAIK-VLKKDVI--IQDDDVECTMTEKRVLALPEKPSFLVALHSCFQTM---------------------------DRLYFVMEFVNGGDLMYQIQQV-----GKFKEPVAVFYAAEIAVGLFFLHSKGIIYRDLKLDNVMLERDGHIKITDFGMC 494          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Celegans
Match: pkc-2 (Protein kinase C-like 2 [Source:UniProtKB/Swiss-Prot;Acc:P90980])

HSP 1 Score: 72.7886 bits (177), Expect = 3.440e-13
Identity = 58/189 (30.69%), Postives = 94/189 (49.74%), Query Frame = 1
Query:  304 VIKWSERLKSLTLIGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCICDLTKLVKAFPQYKDDEYLTNEYVNGY-LLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            VIK S+    LT++G+G+FG V  GE + TK++FA+K V+K++ +    +  ++  + EK  L    K SF V L   FQ M                           D  Y   E+VNG  L++++ +      G   + +   Y  E+  G+ +L  + I++ DLK DNV++ ++GHIKI DFG+ 
Sbjct:  342 VIKASD-FNFLTVLGKGSFGKVLLGEQKTTKELFAIK-VLKKDVI--IQDDDVECTMTEKRVLALPEKPSFLVALHSCFQTM---------------------------DRLYFVMEFVNGGDLMYQIQQV-----GKFKEPVAVFYAAEIAVGLFFLHSKGIIYRDLKLDNVMLERDGHIKITDFGMC 494          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Celegans
Match: wts-1 (Serine/threonine-protein kinase WARTS homolog [Source:UniProtKB/Swiss-Prot;Acc:O45797])

HSP 1 Score: 70.4774 bits (171), Expect = 2.153e-12
Identity = 55/185 (29.73%), Postives = 83/185 (44.86%), Query Frame = 1
Query:  334 LTLIGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCICDLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLAFNDSWFH 888
            ++ IG GAFG V      +T+K++A+K +   E  D   +     +  E+  L E + S + VRL  +FQ+  +   + +MEY                  + +T       LL +   F  D        L   Y+ EL C + Y+     +H DLK DN+LI Q+GHIK+ DFGL     W H
Sbjct:  505 ISHIGVGAFGKVSLVRKNDTRKVYAMKSL---EKADVIMKQQAAHVKAERDILAEAD-SPWIVRLFFSFQD--DACLYFIMEYV--------------PGGDMMT-------LLIQKGIFEED--------LARFYIAELACAIEYVHNVGFIHRDLKPDNILIDQHGHIKLTDFGLCTGLRWTH 654          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Fly
Match: Tie (gene:FBgn0014073 transcript:FBtr0073323)

HSP 1 Score: 70.0922 bits (170), Expect = 3.314e-12
Identity = 54/186 (29.03%), Postives = 87/186 (46.77%), Query Frame = 1
Query:  322 RLKSLTLIGQGAFGDVYKGEDENTKKMFALKKVVKREDMDY-YAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCI-CDLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLAFN 873
            RLKSL  +G+G FG V+K E ++    F   ++V  + +    A+  +KD   E   + +L      V L+GA  E  +  + L+MEY +   L  L++A         L      G  L  ++            + +  +  ++ CGM Y++ R IVH DL   NVL+  NG  KI DFG++ +
Sbjct:  855 RLKSL--LGEGNFGQVWKAEADDLSGHFGATRIVAVKTIRACSAQVSLKD---EANIMRKLGSHQNVVTLLGACVE--SEPHMLIMEYAMRGRLLSLLRA--ARSATNILPASVPGGRSLAPLSP-----------RTLAGFALDIACGMEYIAGRRIVHRDLAARNVLLDHNGMCKICDFGMSID 1020          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Fly
Match: gwl (gene:FBgn0260399 transcript:FBtr0331352)

HSP 1 Score: 69.3218 bits (168), Expect = 5.026e-12
Identity = 52/177 (29.38%), Postives = 90/177 (50.85%), Query Frame = 1
Query:  343 IGQGAFGDVYKG-EDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCIC-DLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            I +GAFG V+ G ++ ++K++FA+K V+++ +M    ++ +  ++ E+  L  L++S F V L  + Q +     +LVMEY +  DL  L+  F               GY       F               Y+ E++  + YL +  IVH D+K DN+L+  +GH+K+ DFGL+
Sbjct:   63 ISRGAFGKVFLGYKNNDSKRLFAIK-VMRKSEM--INKNMVSQVITERNALA-LSRSQFCVSLFYSLQSLS--YVYLVMEYMVGGDLKSLLAMF---------------GYFDEPTARF---------------YVAEMVMALQYLHQHGIVHRDIKPDNMLLSSSGHVKLTDFGLS 203          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Fly
Match: gwl (gene:FBgn0260399 transcript:FBtr0083674)

HSP 1 Score: 69.3218 bits (168), Expect = 5.620e-12
Identity = 62/232 (26.72%), Postives = 110/232 (47.41%), Query Frame = 1
Query:  178 TKPQIWALLTLEEFYYQNSCLTVYHEFHHEFNMSRILRDSRLVIKWSERLKSLTLIGQGAFGDVYKG-EDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCIC-DLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            T  +  +L+  E+   + + LT   E H +      ++D   VI        +  I +GAFG V+ G ++ ++K++FA+K V+++ +M    ++ +  ++ E+  L  L++S F V L  + Q +     +LVMEY +  DL  L+  F               GY       F               Y+ E++  + YL +  IVH D+K DN+L+  +GH+K+ DFGL+
Sbjct:   18 TPKKTHSLIDSEQLLDKINILTTKPENHSQNAKLPTIKD--FVI--------IKPISRGAFGKVFLGYKNNDSKRLFAIK-VMRKSEM--INKNMVSQVITERNALA-LSRSQFCVSLFYSLQSLS--YVYLVMEYMVGGDLKSLLAMF---------------GYFDEPTARF---------------YVAEMVMALQYLHQHGIVHRDIKPDNMLLSSSGHVKLTDFGLS 203          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Fly
Match: Cdk4 (gene:FBgn0016131 transcript:FBtr0087102)

HSP 1 Score: 67.0106 bits (162), Expect = 9.838e-12
Identity = 58/185 (31.35%), Postives = 84/185 (45.41%), Query Frame = 1
Query:  328 KSLTLIGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSF--FVRL--VGAFQEM-GNGAYWLVMEYCICDLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            + L +IG+GA+G VY+  D  T  + ALKKV    + +    S +++I L    L +LN S+    V+L  V  F E  G     LV E+   DL+ L+   P+                       MS          + +   ELL G+ +L    I+H DLK  N+L+   GH+KI DFGLA
Sbjct:   27 QELNIIGEGAYGTVYRARDVITGNIVALKKVRISLNENGVPMSTLREISL----LKQLNASNHANIVKLYEVCQFLERDGQLLILLVFEHVEQDLSDLIDRLPK---------------------SGMS-------PPTIQRLSRELLTGVDFLHSHRIIHRDLKPQNLLVSSQGHLKIADFGLA 179          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Fly
Match: Cdk4 (gene:FBgn0016131 transcript:FBtr0087103)

HSP 1 Score: 67.0106 bits (162), Expect = 9.838e-12
Identity = 58/185 (31.35%), Postives = 84/185 (45.41%), Query Frame = 1
Query:  328 KSLTLIGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSF--FVRL--VGAFQEM-GNGAYWLVMEYCICDLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            + L +IG+GA+G VY+  D  T  + ALKKV    + +    S +++I L    L +LN S+    V+L  V  F E  G     LV E+   DL+ L+   P+                       MS          + +   ELL G+ +L    I+H DLK  N+L+   GH+KI DFGLA
Sbjct:   27 QELNIIGEGAYGTVYRARDVITGNIVALKKVRISLNENGVPMSTLREISL----LKQLNASNHANIVKLYEVCQFLERDGQLLILLVFEHVEQDLSDLIDRLPK---------------------SGMS-------PPTIQRLSRELLTGVDFLHSHRIIHRDLKPQNLLVSSQGHLKIADFGLA 179          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Zebrafish
Match: cdk1 (cyclin-dependent kinase 1 [Source:ZFIN;Acc:ZDB-GENE-010320-1])

HSP 1 Score: 70.0922 bits (170), Expect = 9.074e-13
Identity = 53/175 (30.29%), Postives = 82/175 (46.86%), Query Frame = 1
Query:  343 IGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCICDLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            IG+G +G VYKG ++ T ++ A+KK+    + +    + +++I L    L EL   +  VRL+     M     +LV E+   DL K + + P                      EFM          LV  YL+++L G+ +   R ++H DLK  N+LI   G IK+ DFGLA
Sbjct:   10 IGEGTYGVVYKGRNKTTGQVVAMKKIRLESEEEGVPSTAVREISL----LKELQHPNV-VRLLDVL--MQESKLYLVFEFLSMDLKKYLDSIPS--------------------GEFMDPM-------LVKSYLYQILEGILFCHCRRVLHRDLKPQNLLIDNKGVIKLADFGLA 150          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Zebrafish
Match: cdk1 (cyclin-dependent kinase 1 [Source:ZFIN;Acc:ZDB-GENE-010320-1])

HSP 1 Score: 70.0922 bits (170), Expect = 9.074e-13
Identity = 53/175 (30.29%), Postives = 82/175 (46.86%), Query Frame = 1
Query:  343 IGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCICDLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            IG+G +G VYKG ++ T ++ A+KK+    + +    + +++I L    L EL   +  VRL+     M     +LV E+   DL K + + P                      EFM          LV  YL+++L G+ +   R ++H DLK  N+LI   G IK+ DFGLA
Sbjct:   10 IGEGTYGVVYKGRNKTTGQVVAMKKIRLESEEEGVPSTAVREISL----LKELQHPNV-VRLLDVL--MQESKLYLVFEFLSMDLKKYLDSIPS--------------------GEFMDPM-------LVKSYLYQILEGILFCHCRRVLHRDLKPQNLLIDNKGVIKLADFGLA 150          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Zebrafish
Match: cdk5 (cyclin-dependent kinase 5 [Source:ZFIN;Acc:ZDB-GENE-010131-2])

HSP 1 Score: 69.707 bits (169), Expect = 1.065e-12
Identity = 55/183 (30.05%), Postives = 87/183 (47.54%), Query Frame = 1
Query:  319 ERLKSLTLIGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCICDLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            ++ + L  IG+G +G V+K ++  T ++ ALK+V   +D +    S +++I L    L EL K    VRL        +    LV EYC  DL K   +               NG L  E+               V  ++++LL G+ +   R+++H DLK  N+LI +NG +K+ DFGLA
Sbjct:    2 QKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICL----LKEL-KHKNIVRLHDVLH--SDKKLTLVFEYCDQDLKKYFDS--------------CNGDLDPEI---------------VKSFMYQLLKGLAFCHSRNVLHRDLKPQNLLINRNGELKLADFGLA 148          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Zebrafish
Match: cdk20 (cyclin-dependent kinase 20 [Source:NCBI gene;Acc:494112])

HSP 1 Score: 70.0922 bits (170), Expect = 1.273e-12
Identity = 54/178 (30.34%), Postives = 79/178 (44.38%), Query Frame = 1
Query:  334 LTLIGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCICDLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            L  IG+GA G V+K +   T +  ALKKV  R   D      +++I      L E+  + + V+L   F   G G + LV EY + DL+++++          LT   V  Y++                         LL G+ +     I+H DLK  N+LI   GH+KI DFGLA
Sbjct:    7 LGRIGEGAHGIVFKAKHIETGETVALKKVALRRLEDGIPNQALREI----KALQEIEDNQYVVKLKDVFPH-GTG-FVLVFEYMLSDLSEVIR-----NSQRPLTASQVKSYMMM------------------------LLKGVAFCHENSIMHRDLKPANLLISSTGHLKIADFGLA 149          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Zebrafish
Match: mastl (microtubule associated serine/threonine kinase-like [Source:NCBI gene;Acc:445215])

HSP 1 Score: 71.633 bits (174), Expect = 1.297e-12
Identity = 58/176 (32.95%), Postives = 85/176 (48.30%), Query Frame = 1
Query:  343 IGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCIC-DLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            I +GAFG VY    +   K++A+K V K E +D   ++  + +  E+  L  L+KS F V L  + Q       +LVMEY I  D+  L+               ++ GY     +E MS            +Y+ E+   + YL R  I+H DLK DN+LI   GHIK+ DFGL+
Sbjct:   29 ISRGAFGKVYLARKKCNSKLYAIKVVKKAEMVD---KNMTEQMRAERDALA-LSKSPFIVHLFYSLQTATK--VYLVMEYLIGGDVKSLL---------------HIYGYF----DEDMS-----------LKYISEVALALDYLHRHSIIHRDLKPDNMLISNEGHIKLTDFGLS 168          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Xenopus
Match: cachd1 (cache domain containing 1 [Source:Xenbase;Acc:XB-GENE-1010398])

HSP 1 Score: 79.337 bits (194), Expect = 8.074e-15
Identity = 59/176 (33.52%), Postives = 87/176 (49.43%), Query Frame = 1
Query:  343 IGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCIC-DLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            I +GAFG VY    +N  K+FA+K VVK+ DM    ++ ++ +  E+  L  L+KS F V L  + Q   N   +L+MEY I  D+  L+               ++ GY   E               +  +Y+ E+   + YL R  I+H DLK DN+LI   GHIK+ DFGL+
Sbjct:   39 ISRGAFGKVYLARRKNNNKLFAVK-VVKKADM--INKNMVQQVQAERDALA-LSKSPFIVHLYYSLQSANN--IYLIMEYLIGGDVKSLL---------------HIYGYFDEE---------------MAVKYISEVALALDYLHRHGIIHRDLKPDNMLISNEGHIKLTDFGLS 178          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Xenopus
Match: ankrd2 (ankyrin repeat domain 2 (stretch responsive muscle) [Source:Xenbase;Acc:XB-GENE-1016694])

HSP 1 Score: 71.2478 bits (173), Expect = 3.138e-12
Identity = 56/198 (28.28%), Postives = 91/198 (45.96%), Query Frame = 1
Query:  307 IKWSERLKS----LTLIGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFF-VRLVGAFQEMG------NGAYWLVMEYCICDLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            I W +R       + +IG+G +G VYK +D++T +M ALKKV     +D   E F    + E   L +LN  S   ++ +   +E         GA++LV EY   DL  L+++                G + F  +   S             ++ +L+ G+ Y  +R+ +H D+K  N+L+   G IK+ DFGLA
Sbjct:  373 IDWGKRCVDKFDIIGIIGEGTYGQVYKAKDKDTGEMVALKKV----RLDNEKEGFPITAIREIKILRQLNHQSIINMKEIVTDKEDALDFKKDKGAFYLVFEYMDHDLMGLLES----------------GLVHFNEHHIKS-------------FMRQLMEGLDYCHKRNFLHRDIKCSNILLNNRGQIKLADFGLA 537          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Xenopus
Match: ankrd2 (ankyrin repeat domain 2 (stretch responsive muscle) [Source:Xenbase;Acc:XB-GENE-1016694])

HSP 1 Score: 70.8626 bits (172), Expect = 3.444e-12
Identity = 56/198 (28.28%), Postives = 91/198 (45.96%), Query Frame = 1
Query:  307 IKWSERLKS----LTLIGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFF-VRLVGAFQEMG------NGAYWLVMEYCICDLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            I W +R       + +IG+G +G VYK +D++T +M ALKKV     +D   E F    + E   L +LN  S   ++ +   +E         GA++LV EY   DL  L+++                G + F  +   S             ++ +L+ G+ Y  +R+ +H D+K  N+L+   G IK+ DFGLA
Sbjct:  373 IDWGKRCVDKFDIIGIIGEGTYGQVYKAKDKDTGEMVALKKV----RLDNEKEGFPITAIREIKILRQLNHQSIINMKEIVTDKEDALDFKKDKGAFYLVFEYMDHDLMGLLES----------------GLVHFNEHHIKS-------------FMRQLMEGLDYCHKRNFLHRDIKCSNILLNNRGQIKLADFGLA 537          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Xenopus
Match: ankrd2 (ankyrin repeat domain 2 (stretch responsive muscle) [Source:Xenbase;Acc:XB-GENE-1016694])

HSP 1 Score: 70.4774 bits (171), Expect = 5.041e-12
Identity = 56/198 (28.28%), Postives = 91/198 (45.96%), Query Frame = 1
Query:  307 IKWSERLKS----LTLIGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFF-VRLVGAFQEMG------NGAYWLVMEYCICDLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            I W +R       + +IG+G +G VYK +D++T +M ALKKV     +D   E F    + E   L +LN  S   ++ +   +E         GA++LV EY   DL  L+++                G + F  +   S             ++ +L+ G+ Y  +R+ +H D+K  N+L+   G IK+ DFGLA
Sbjct:  588 IDWGKRCVDKFDIIGIIGEGTYGQVYKAKDKDTGEMVALKKVR----LDNEKEGFPITAIREIKILRQLNHQSIINMKEIVTDKEDALDFKKDKGAFYLVFEYMDHDLMGLLES----------------GLVHFNEHHIKS-------------FMRQLMEGLDYCHKRNFLHRDIKCSNILLNNRGQIKLADFGLA 752          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Xenopus
Match: cdk2 (cyclin-dependent kinase 2 [Source:NCBI gene;Acc:493498])

HSP 1 Score: 66.6254 bits (161), Expect = 1.418e-11
Identity = 53/183 (28.96%), Postives = 82/183 (44.81%), Query Frame = 1
Query:  319 ERLKSLTLIGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCICDLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            E  + +  IG+G +G VYK  +  T ++ ALKK+    + +    + I++I L    L ELN  +  V+L+           +LV E+   DL K            ++    ++G  L                 LV  YLF+LL G+ +     ++H DLK  N+LI   G IK+ DFGLA
Sbjct:    2 ENFQKVEKIGEGTYGVVYKARNRETGEIVALKKIRLDTETEGVPSTAIREISL----LKELNHPN-IVKLLDVIHT--ENKLYLVFEFLNQDLKK------------FMDGSNISGISL----------------ALVKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINSEGAIKLADFGLA 149          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Mouse
Match: Mastl (microtubule associated serine/threonine kinase-like [Source:MGI Symbol;Acc:MGI:1914371])

HSP 1 Score: 73.9442 bits (180), Expect = 3.216e-13
Identity = 61/195 (31.28%), Postives = 93/195 (47.69%), Query Frame = 1
Query:  295 SRLVIKWSERLKSLTL---IGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCIC-DLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            SR+ +     ++  T+   I +GAFG VY G+     K++A+K VVK+ DM    ++    +  E+  L  L+KS F V L  + Q   N   +L+MEY I  D+  L+               ++ GY   E               +  +Y+ E+   + YL R  I+H DLK DN+LI   GHIK+ DFGL+
Sbjct:   21 SRIPVPRPPSIEEFTIVKPISRGAFGKVYLGQ--KGGKLYAVK-VVKKADM--INKNMTHQVQAERDALA-LSKSPFVVHLYYSLQSASN--IYLIMEYLIGGDVKSLL---------------HIYGYFDEE---------------MAIKYISEVALALDYLHRHGIIHRDLKPDNMLISNEGHIKLTDFGLS 177          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Mouse
Match: Cdk5 (cyclin-dependent kinase 5 [Source:MGI Symbol;Acc:MGI:101765])

HSP 1 Score: 70.4774 bits (171), Expect = 8.096e-13
Identity = 56/183 (30.60%), Postives = 87/183 (47.54%), Query Frame = 1
Query:  319 ERLKSLTLIGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCICDLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            ++ + L  IG+G +G V+K ++  T ++ ALK+V   +D +    S +++I L    L EL K    VRL        +    LV E+C  DL K   +               NG L  E+               V  +LF+LL G+ +   R+++H DLK  N+LI +NG +K+ DFGLA
Sbjct:    2 QKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICL----LKEL-KHKNIVRLHDVLH--SDKKLTLVFEFCDQDLKKYFDS--------------CNGDLDPEI---------------VKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLA 148          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Mouse
Match: Cdk13 (cyclin-dependent kinase 13 [Source:MGI Symbol;Acc:MGI:1916812])

HSP 1 Score: 70.8626 bits (172), Expect = 3.361e-12
Identity = 51/194 (26.29%), Postives = 90/194 (46.39%), Query Frame = 1
Query:  307 IKWSER----LKSLTLIGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYE--LNKSSFFVRLVGAFQ-EMGNGAYWLVMEYCICDLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            I W +R       + +IG+G +G VYK  D++T +M ALKKV    + + +  + I++I + +   ++  +N          A   +   GA++LV EY   DL  L+++                G + F  N   S             ++ +L+ G+ Y  +++ +H D+K  N+L+   G IK+ DFGLA
Sbjct:  695 IDWGKRCVDKFDIIGIIGEGTYGQVYKARDKDTGEMVALKKVRLDNEKEGFPITAIREIKILRQLTHQSIINMKEIVTDKEDALDFKKDKGAFYLVFEYMDHDLMGLLES----------------GLVHFNENHIKS-------------FMRQLMEGLDYCHKKNFLHRDIKCSNILLNNRGQIKLADFGLA 859          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Mouse
Match: Cdk13 (cyclin-dependent kinase 13 [Source:MGI Symbol;Acc:MGI:1916812])

HSP 1 Score: 68.1662 bits (165), Expect = 1.560e-11
Identity = 51/194 (26.29%), Postives = 90/194 (46.39%), Query Frame = 1
Query:  307 IKWSERLKS----LTLIGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYE--LNKSSFFVRLVGAFQ-EMGNGAYWLVMEYCICDLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            I W +R       + +IG+G +G VYK  D++T +M ALKKV    + + +  + I++I + +   ++  +N          A   +   GA++LV EY   DL  L+++                G + F  N   S             ++ +L+ G+ Y  +++ +H D+K  N+L+   G IK+ DFGLA
Sbjct:   81 IDWGKRCVDKFDIIGIIGEGTYGQVYKARDKDTGEMVALKKVRLDNEKEGFPITAIREIKILRQLTHQSIINMKEIVTDKEDALDFKKDKGAFYLVFEYMDHDLMGLLES----------------GLVHFNENHIKS-------------FMRQLMEGLDYCHKKNFLHRDIKCSNILLNNRGQIKLADFGLA 245          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Mouse
Match: Cdk9 (cyclin-dependent kinase 9 (CDC2-related kinase) [Source:MGI Symbol;Acc:MGI:1328368])

HSP 1 Score: 67.0106 bits (162), Expect = 1.655e-11
Identity = 53/184 (28.80%), Postives = 86/184 (46.74%), Query Frame = 1
Query:  334 LTLIGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGN------GAYWLVMEYCICDLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            L  IGQG FG+V+K +   T +  ALKKV+   + + +  + +++I      + +L K    V L+   +   +      G+ +LV ++C  DL  L            L+N  V  + L E+   M                  LL G++Y+ R  I+H D+K  NVLI ++G +K+ DFGLA
Sbjct:   22 LAKIGQGTFGEVFKAKHRQTGQKVALKKVLMENEKEGFPITALREI-----KILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGL------------LSNVLVK-FTLSEIKRVMQ----------------MLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLA 171          
BLAST of Serine/threonine-protein kinase greatwall vs. UniProt/SwissProt
Match: sp|Q6NTJ3|GWL_XENLA (Serine/threonine-protein kinase greatwall OS=Xenopus laevis OX=8355 GN=mastl PE=1 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 1.390e-14
Identity = 60/176 (34.09%), Postives = 87/176 (49.43%), Query Frame = 1
Query:  343 IGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCI-CDLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            I +GAFG VY    +N  K+FA+ KVVK+ DM    ++ ++ +  E+  L  L+KS F V L  + Q   N   +LVMEY I  D+  L+               ++ GY   E               +  +Y+ E+   + YL R  I+H DLK DN+LI   GHIK+ DFGL+
Sbjct:   38 ISRGAFGKVYLARRKNNSKLFAV-KVVKKADM--INKNMVQQVQAERDALA-LSKSPFIVHLYYSLQSANN--IYLVMEYLIGGDVKSLL---------------HIYGYFDEE---------------MAVKYISEVAMALDYLHRHGIIHRDLKPDNMLISNKGHIKLTDFGLS 177          
BLAST of Serine/threonine-protein kinase greatwall vs. UniProt/SwissProt
Match: sp|B1WAR9|GWL_XENTR (Serine/threonine-protein kinase greatwall OS=Xenopus tropicalis OX=8364 GN=mastl PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 3.955e-14
Identity = 59/176 (33.52%), Postives = 87/176 (49.43%), Query Frame = 1
Query:  343 IGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCIC-DLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            I +GAFG VY    +N  K+FA+K VVK+ DM    ++ ++ +  E+  L  L+KS F V L  + Q   N   +L+MEY I  D+  L+               ++ GY   E               +  +Y+ E+   + YL R  I+H DLK DN+LI   GHIK+ DFGL+
Sbjct:   39 ISRGAFGKVYLARRKNNNKLFAVK-VVKKADM--INKNMVQQVQAERDALA-LSKSPFIVHLYYSLQSANN--IYLIMEYLIGGDVKSLL---------------HIYGYFDEE---------------MAVKYISEVALALDYLHRHGIIHRDLKPDNMLISNEGHIKLTDFGLS 178          
BLAST of Serine/threonine-protein kinase greatwall vs. UniProt/SwissProt
Match: sp|E1BFR5|GWL_BOVIN (Serine/threonine-protein kinase greatwall OS=Bos taurus OX=9913 GN=MASTL PE=3 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 1.087e-12
Identity = 61/195 (31.28%), Postives = 94/195 (48.21%), Query Frame = 1
Query:  295 SRLVIKWSERLKSLTL---IGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCIC-DLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            +R+ +     ++  T+   I +GAFG VY G+  N  +++A+K VVK+ DM    ++    +  E+  L  L+KS F V L  + Q   N   +LVMEY I  D+  L+               ++ GY   E               +  +Y+ E+   + YL R  I+H DLK DN+LI   GHIK+ DFGL+
Sbjct:   22 NRIPVPRPPSIEEFTIVKPISRGAFGKVYLGQKGN--RLYAVK-VVKKADM--INKNMTHQVQAERDALA-LSKSPFIVHLYYSLQSANN--VYLVMEYLIGGDVKSLL---------------HIYGYFDEE---------------MAVKYISEVALALDYLHRHGIIHRDLKPDNMLISNEGHIKLTDFGLS 178          
BLAST of Serine/threonine-protein kinase greatwall vs. UniProt/SwissProt
Match: sp|Q9DGA2|CDK1_ORYJA (Cyclin-dependent kinase 1 OS=Oryzias javanicus OX=123683 GN=cdk1 PE=2 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.693e-12
Identity = 53/177 (29.94%), Postives = 84/177 (47.46%), Query Frame = 1
Query:  343 IGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCICDLTKLVKAFP--QYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            IG+G +G VYKG  ++T ++ A+KK+    + +    + ++++ L    L EL K    VRL+     M     +L+ E+   DL K + + P  QY D                               LV  YL+++L G+++  RR ++H DLK  N+LI   G IK+ DFGLA
Sbjct:   10 IGEGTYGVVYKGRHKSTGQVVAMKKIRLESEEEGVPSTAVREVSL----LQEL-KHPNVVRLLDVL--MQESRLYLIFEFLSMDLKKYLDSIPSGQYMD-----------------------------PMLVKSYLYQILEGIYFCHRRRVLHRDLKPQNLLIDNKGVIKLADFGLA 150          
BLAST of Serine/threonine-protein kinase greatwall vs. UniProt/SwissProt
Match: sp|Q9DGD3|CDK1_ORYLA (Cyclin-dependent kinase 1 OS=Oryzias latipes OX=8090 GN=cdk1 PE=2 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.773e-12
Identity = 53/177 (29.94%), Postives = 84/177 (47.46%), Query Frame = 1
Query:  343 IGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCICDLTKLVKAFP--QYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            IG+G +G VYKG  ++T ++ A+KK+    + +    + ++++ L    L EL K    VRL+     M     +L+ E+   DL K + + P  QY D                               LV  YL+++L G+++  RR ++H DLK  N+LI   G IK+ DFGLA
Sbjct:   10 IGEGTYGVVYKGRHKSTGQVVAMKKIRLESEEEGVPSTAVREVSL----LQEL-KHPNVVRLLDVL--MQESRLYLIFEFLSMDLKKYLDSIPSGQYMD-----------------------------PMLVKSYLYQILEGIYFCHRRRVLHRDLKPQNLLIDNKGVIKLADFGLA 150          
BLAST of Serine/threonine-protein kinase greatwall vs. TrEMBL
Match: A0A1J4JXW0 (Cyclin-dependent kinase 2 OS=Tritrichomonas foetus OX=1144522 GN=cdk2 PE=3 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.535e-13
Identity = 57/184 (30.98%), Postives = 88/184 (47.83%), Query Frame = 1
Query:  343 IGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKS-----SFFVRLVGAFQEMGNGAYWLVMEYCICDLTKLVKAFPQYKDD--EYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLAFN 873
            IG+G +G VYK  ++ T  ++ALKK+ K +D      SF +    E   L+E+ KS     +  ++L    +   N  ++LV+E C CDL  ++K +   +DD  E+ T   +   L F+                +  Y+ ++L GM  L     VH D+K  N+LI     IKI DFGL  N
Sbjct:   22 IGKGGYGSVYKAREKETGSIYALKKINKFDDRQATPPSFFR----ETECLHEIAKSDAKGANNILKLHKIIRCHQNNCFFLVLEMCDCDLGDIIKLYSSCEDDFDEHQTPNQICPNLSFDQ---------------IKNYMVQILQGMTTLHDHGFVHRDIKPPNILIKNGTDIKICDFGLTRN 186          
BLAST of Serine/threonine-protein kinase greatwall vs. TrEMBL
Match: A0A131XDP8 (Putative serine/threonine kinase (Fragment) OS=Hyalomma excavatum OX=257692 PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 1.811e-13
Identity = 63/175 (36.00%), Postives = 89/175 (50.86%), Query Frame = 1
Query:  343 IGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCICDLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            IG+G +G VYKG+D+ T K+ ALKK+    + +    + I++I L    L EL +    VRL     E G    +LV EY   DL K                 Y++G   FE NE +SD        LV  YL ++L  + +  +R ++H DLK  N+LI +NG IK+ DFGLA
Sbjct:   14 IGEGTYGIVYKGKDKRTGKIVALKKIRLESEDEGVPSTAIREIAL----LKEL-RHKHIVRLEDVLME-GCEKIYLVFEYLSMDLKK-----------------YLDG---FEKNEKLSD-------TLVKSYLKQILEAILFCHQRRVLHRDLKPQNLLIDENGTIKVADFGLA 155          
BLAST of Serine/threonine-protein kinase greatwall vs. TrEMBL
Match: A0A195DUA0 (Cell division protein kinase 6 OS=Trachymyrmex cornetzi OX=471704 GN=ALC57_11301 PE=3 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 2.065e-13
Identity = 61/196 (31.12%), Postives = 90/196 (45.92%), Query Frame = 1
Query:  328 KSLTLIGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQ-------EMGNGAY---------WLVMEYCICDLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            ++L++IG GA+G VYK  D+N+ +  ALK+V      D   +S +++I+  K    E  +    VRL+   Q         G+G +         WLV E+   DL              Y+ N Y N      +  +           LV Q L E+LCG+ +L    I+H DLK  N+L+ + G IKI DFGLA
Sbjct:  190 ENLSVIGNGAYGTVYKATDKNSGQTVALKRVRIPLTEDGLPQSTLREIVALKS--LEQYEHPHIVRLLDTCQGGDYLDVSSGDGTFERPERDITFWLVFEHVERDLAS------------YIAN-YRNSSPRLSIPPY-----------LVRQMLKEILCGVEFLHSHRIIHRDLKPQNLLVTREGRIKIADFGLA 359          
BLAST of Serine/threonine-protein kinase greatwall vs. TrEMBL
Match: A0A4P9Y6L8 (Kinase-like domain-containing protein (Fragment) OS=Piptocephalis cylindrospora OX=1907219 GN=BJ684DRAFT_951 PE=4 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 2.086e-13
Identity = 61/181 (33.70%), Postives = 89/181 (49.17%), Query Frame = 1
Query:  328 KSLTLIGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYC-ICDLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            K +  I +GAFG V+  +   T + FALK V+++ DM   A++ +K++  E+  L     S + VRL  +FQ     + +LVMEY    D   L+K+  Q  +D                                  YL E++CG+ YL  R IVH DLK DN+LI  NGH+K+ DFGL+
Sbjct:    7 KIIKPISKGAFGSVFLAKRRATGEYFALK-VLRKSDM--VAKNQVKNVKAERMILMMQEDSPWVVRLYYSFQS--KDSLYLVMEYLNGGDCATLIKSLGQLDED------------------------------WARSYLAEVVCGLEYLHGRGIVHRDLKPDNLLIDANGHLKLTDFGLS 152          
BLAST of Serine/threonine-protein kinase greatwall vs. TrEMBL
Match: A0A1Y2ARW3 (Kinase-like protein (Fragment) OS=Neocallimastix californiae OX=1754190 GN=LY90DRAFT_427926 PE=4 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 5.076e-13
Identity = 63/176 (35.80%), Postives = 92/176 (52.27%), Query Frame = 1
Query:  343 IGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCI-CDLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            I +GAFG VY  + + T   FA+ KV+K+ DM   A++ +K+I  E+  L +++ S + V+L  +FQ   N   +LVMEY    D   L+KA  Q                             LD +K   QY+ E+  G+ +L  R I+H DLK DN+LI QNGH+K+ DFGL+
Sbjct:  175 ISKGAFGAVYLAKKKTTGDYFAI-KVLKKADM--IAKNQVKNIRAERLILSQID-SPYVVKLYFSFQSHDN--LYLVMEYLNGGDCAALIKAMGQ-----------------------------LD-EKWAKQYISEVTLGLEFLHSRGIIHRDLKPDNLLIDQNGHVKLTDFGLS 314          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Cavefish
Match: cdk20 (cyclin dependent kinase 20 [Source:NCBI gene;Acc:103031389])

HSP 1 Score: 74.7146 bits (182), Expect = 2.903e-14
Identity = 55/178 (30.90%), Postives = 81/178 (45.51%), Query Frame = 1
Query:  334 LTLIGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCICDLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            L  IG+GA G V+K +   T +  ALKKV  R+  D      +++I      L E+  + + V+L   F   G G + LV EY + DL+++++          LT   V GY++                         LL G+ +     I+H DLK  N+LI   GH+KI DFGLA
Sbjct:    7 LGRIGEGAHGIVFKAKHIETGETVALKKVALRKLEDGIPNQALREI----KALQEIEDNQYVVKLTDVFPH-GTG-FVLVFEYMLSDLSEVIR-----NSQRPLTESQVKGYMMM------------------------LLKGVAFCHENSIMHRDLKPANLLISSTGHLKIADFGLA 149          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Cavefish
Match: cdk20 (cyclin dependent kinase 20 [Source:NCBI gene;Acc:103031389])

HSP 1 Score: 74.3294 bits (181), Expect = 5.086e-14
Identity = 55/178 (30.90%), Postives = 81/178 (45.51%), Query Frame = 1
Query:  334 LTLIGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCICDLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            L  IG+GA G V+K +   T +  ALKKV  R+  D      +++I      L E+  + + V+L   F   G G + LV EY + DL+++++          LT   V GY++                         LL G+ +     I+H DLK  N+LI   GH+KI DFGLA
Sbjct:    7 LGRIGEGAHGIVFKAKHIETGETVALKKVALRKLEDGIPNQALREI----KALQEIEDNQYVVKLTDVFPH-GTG-FVLVFEYMLSDLSEVIR-----NSQRPLTESQVKGYMMM------------------------LLKGVAFCHENSIMHRDLKPANLLISSTGHLKIADFGLA 149          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Cavefish
Match: mastl (microtubule associated serine/threonine kinase like [Source:NCBI gene;Acc:103045715])

HSP 1 Score: 73.1738 bits (178), Expect = 3.753e-13
Identity = 58/176 (32.95%), Postives = 87/176 (49.43%), Query Frame = 1
Query:  343 IGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCIC-DLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            I +GAFG V+    ++  +++A+K VVK+ DM    +  + D +  +     L+KS F VRL  + Q       +LVMEY I  D+  L+               ++ GY  FE  E MS            +Y+ E+   + YL R  I+H DLK DN+L+   GHIK+ DFGL+
Sbjct:   32 ISRGAFGKVFLARKKSNSRLYAVK-VVKKADM---VDKNMSDQMRAERDALALSKSPFIVRLFYSLQTATK--VYLVMEYLIGGDVKSLL---------------HIYGY--FE--EDMS-----------LKYISEVALALDYLHRHGIIHRDLKPDNMLVSNEGHIKLTDFGLS 171          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Cavefish
Match: cdk5 (cyclin dependent kinase 5 [Source:NCBI gene;Acc:103032107])

HSP 1 Score: 69.707 bits (169), Expect = 8.945e-13
Identity = 55/183 (30.05%), Postives = 87/183 (47.54%), Query Frame = 1
Query:  319 ERLKSLTLIGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCICDLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            ++ + L  IG+G +G V+K ++  T ++ ALK+V   +D +    S +++I L    L EL K    VRL        +    LV EYC  DL K   +               NG L  E+               V  ++++LL G+ +   R+++H DLK  N+LI +NG +K+ DFGLA
Sbjct:    2 QKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICL----LKEL-KHKNIVRLHDVLH--SDKKLTLVFEYCDQDLKKYFDS--------------CNGDLDPEI---------------VKSFMYQLLKGLAFCHSRNVLHRDLKPQNLLINRNGELKLADFGLA 148          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Cavefish
Match: cdk1 (cyclin dependent kinase 1 [Source:NCBI gene;Acc:103047431])

HSP 1 Score: 67.781 bits (164), Expect = 4.167e-12
Identity = 54/177 (30.51%), Postives = 82/177 (46.33%), Query Frame = 1
Query:  343 IGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCICDLTKLVKAFP--QYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            IG+G +G VYKG  ++T ++ ALKK+    + +    + +++I L    L EL   +  VRL+     M     +LV E+   DL K + + P  QY D                               LV  YL+++L G+ +   R ++H DLK  N+LI   G IK+ DFGLA
Sbjct:   10 IGEGTYGVVYKGRHKSTGQVVALKKIRLESEEEGVPSTAVREISL----LKELQHPNV-VRLLDVL--MQESKLYLVFEFLSMDLKKYLDSIPSGQYMD-----------------------------PMLVKSYLYQILEGILFCHCRRVLHRDLKPQNLLIDNKGVIKLADFGLA 150          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000855.1 (pep scaffold:Pmarinus_7.0:GL480767:13986:34488:-1 gene:ENSPMAG00000000768.1 transcript:ENSPMAT00000000855.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.0182 bits (175), Expect = 2.179e-13
Identity = 52/185 (28.11%), Postives = 88/185 (47.57%), Query Frame = 1
Query:  334 LTLIGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFF-VRLVGAFQEMG------NGAYWLVMEYCICDLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            + +IG+G +G VYK +D++T ++ ALKKV     +D   E F    + E   L +LN  S   ++ +   +E         GA++LV +Y   DL  L+++                G + F  +   S             ++ +L+ G+ Y  R++ +H D+K  N+L+   GHIK+ DFGLA
Sbjct:  601 IGIIGEGTYGQVYKAKDKDTGELVALKKVR----LDNEKEGFPITAIREIKILRQLNHRSIINMKEIVTDKEDAIDFKKDKGAFYLVFDYMDHDLMGLLES----------------GLVSFSEDHIKS-------------FMKQLMEGLDYCHRKNFLHRDIKCSNILLNNRGHIKLADFGLA 752          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000850.1 (pep scaffold:Pmarinus_7.0:GL480767:12801:33146:-1 gene:ENSPMAG00000000768.1 transcript:ENSPMAT00000000850.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.633 bits (174), Expect = 2.989e-13
Identity = 52/185 (28.11%), Postives = 88/185 (47.57%), Query Frame = 1
Query:  334 LTLIGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFF-VRLVGAFQEMG------NGAYWLVMEYCICDLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            + +IG+G +G VYK +D++T ++ ALKKV     +D   E F    + E   L +LN  S   ++ +   +E         GA++LV +Y   DL  L+++                G + F  +   S             ++ +L+ G+ Y  R++ +H D+K  N+L+   GHIK+ DFGLA
Sbjct:  558 IGIIGEGTYGQVYKAKDKDTGELVALKKVR----LDNEKEGFPITAIREIKILRQLNHRSIINMKEIVTDKEDAIDFKKDKGAFYLVFDYMDHDLMGLLES----------------GLVSFSEDHIKS-------------FMKQLMEGLDYCHRKNFLHRDIKCSNILLNNRGHIKLADFGLA 709          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000851.1 (pep scaffold:Pmarinus_7.0:GL480767:12807:33146:-1 gene:ENSPMAG00000000768.1 transcript:ENSPMAT00000000851.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.2478 bits (173), Expect = 4.093e-13
Identity = 52/185 (28.11%), Postives = 88/185 (47.57%), Query Frame = 1
Query:  334 LTLIGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFF-VRLVGAFQEMG------NGAYWLVMEYCICDLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            + +IG+G +G VYK +D++T ++ ALKKV     +D   E F    + E   L +LN  S   ++ +   +E         GA++LV +Y   DL  L+++                G + F  +   S             ++ +L+ G+ Y  R++ +H D+K  N+L+   GHIK+ DFGLA
Sbjct:  559 IGIIGEGTYGQVYKAKDKDTGELVALKKVR----LDNEKEGFPITAIREIKILRQLNHRSIINMKEIVTDKEDAIDFKKDKGAFYLVFDYMDHDLMGLLES----------------GLVSFSEDHIKS-------------FMKQLMEGLDYCHRKNFLHRDIKCSNILLNNRGHIKLADFGLA 710          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Sea Lamprey
Match: cdk1 (cyclin-dependent kinase 1 [Source:ZFIN;Acc:ZDB-GENE-010320-1])

HSP 1 Score: 64.3142 bits (155), Expect = 1.156e-11
Identity = 48/172 (27.91%), Postives = 78/172 (45.35%), Query Frame = 1
Query:  352 GAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCICDLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            G++G VYKG ++ T  + ALKK+    + +    + I++I L    L EL   +  VRL      + +   +L+ EY   DL + + A P       +    + G                        YL ++L  + +   R ++H DLK  N+LI ++GHIK+ DFGLA
Sbjct:    1 GSYGVVYKGRNKGTGDLVALKKIRLEHEEEGVPATAIREIAL----LRELRHPNI-VRLQDVL--LQSARLYLIFEYLPMDLKRYLDAIPA---GHCMEPPLIQGQ----------------------SYLHQILQAVVFCHSRRVLHRDLKPQNLLIDRHGHIKLADFGLA 140          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Sea Lamprey
Match: cdk2 (cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2741])

HSP 1 Score: 63.1586 bits (152), Expect = 3.137e-11
Identity = 54/175 (30.86%), Postives = 78/175 (44.57%), Query Frame = 1
Query:  343 IGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCICDLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            IG+G +G VYK  ++ T +  ALKK+    + +    + I++I L    L ELN  +  VRL+           +LV E    DL K            ++ N   +G  L                 LV  YL++LL G+ +     I+H DLK  N+LI   G IK+ DFGLA
Sbjct:   10 IGEGTYGVVYKARNKLTGEAVALKKIRLDTETEGVPSTAIREISL----LRELNHPN-IVRLLTIIH--SEKKLYLVFELLDQDLKK------------FMDNATPSGIPL----------------PLVKSYLYQLLQGIAFCHSHRILHRDLKPQNLLINAEGAIKLADFGLA 149          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Yeast
Match: SPS1 (Putative protein serine/threonine kinase; localizes to the nucleus and cytoplasm; required for efficient spore packaging, prospore membrane development and closure and localization of enzymes involved in spore wall synthesis; interacts with and required for Ssp1p phosphorylation and turnover; member of the GCKIII subfamily of STE20 kinases; multiply phosphorylated on S/T residues; interacts with 14-3-3 proteins, Bmh1p and Bmh2p; expressed at the end of meiosis [Source:SGD;Acc:S000002931])

HSP 1 Score: 69.707 bits (169), Expect = 3.498e-13
Identity = 54/177 (30.51%), Postives = 82/177 (46.33%), Query Frame = 1
Query:  337 TLIGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCICDLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            + IG+G FGDVYK  D  T+++ A+K VV  E  D   E   ++I      L EL KS      +    E  + + W+VMEYC                 + L   YVNG               L  +K+ F  + E+  G+ YL  +  +H D+K  N+L+ + G +K+GDFG++
Sbjct:   22 SCIGRGNFGDVYKAVDRVTQEIVAIK-VVNLEHSDEDIELLAQEIFF----LAEL-KSPLITNYIATMLE--DVSMWIVMEYCGGGSC-----------SDLLKRSYVNG---------------LPEEKVSF-IIHEVTLGLKYLHEQRKIHRDIKAANILLNEEGMVKLGDFGVS 163          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Yeast
Match: RIM15 (Protein kinase involved in cell proliferation in response to nutrients; glucose-repressible; involved in signal transduction during cell proliferation in response to nutrients, specifically the establishment of stationary phase; identified as a regulator of IME2; phosphorylates Igo1p and Igo2p; substrate of Pho80p-Pho85p kinase [Source:SGD;Acc:S000001861])

HSP 1 Score: 70.8626 bits (172), Expect = 3.557e-13
Identity = 52/179 (29.05%), Postives = 86/179 (48.04%), Query Frame = 1
Query:  334 LTLIGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCIC-DLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            L  I +GA+G VY    + T   FA+K V+++ DM   A++ + ++  E+  +   +   +  RL  +FQ   N   +LVMEY    DL  L+K         YL +++                          QYL E++ G++ + +  I+H DLK +N+LI   GH+K+ DFGL+
Sbjct:  797 LKPISKGAYGSVYLARKKLTGDYFAIK-VLRKSDM--IAKNQVTNVKSERAIMMVQSDKPYVARLFASFQNKDN--LFLVMEYLPGGDLATLIKMM------GYLPDQWAK------------------------QYLTEIVVGVNDMHQNGIIHHDLKPENLLIDNAGHVKLTDFGLS 940          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Yeast
Match: MKK1 (MAPKK involved in the protein kinase C signaling pathway; involved in control of cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk2p; MKK1 has a paralog, MKK2, that arose from the whole genome duplication [Source:SGD;Acc:S000005757])

HSP 1 Score: 66.2402 bits (160), Expect = 5.290e-12
Identity = 43/183 (23.50%), Postives = 87/183 (47.54%), Query Frame = 1
Query:  319 ERLKSLTLIGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCICDLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            +R+++L ++G+GA G V K + +N  K+FALK +        Y +   +++   +       +S + VR  G F +  N + ++ M                         EY+ G  L  + + + +  G   +K++ +    +L G+ YL  + ++H D+K  N+L+ +NG +K+ DFG++
Sbjct:  219 DRIETLGILGEGAGGSVSKCKLKNGSKIFALKVINTLNTDPEYQKQIFRELQFNRSF-----QSEYIVRYYGMFTDDENSSIYIAM-------------------------EYMGGRSLDAIYKNLLERGGRISEKVLGKIAEAVLRGLSYLHEKKVIHRDIKPQNILLNENGQVKLCDFGVS 371          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Yeast
Match: CTK1 (Catalytic (alpha) subunit of C-terminal domain kinase I (CTDK-I); phosphorylates both RNA pol II subunit Rpo21p to affect transcription and pre-mRNA 3' end processing, and ribosomal protein Rps2p to increase translational fidelity; required for H3K36 trimethylation but not dimethylation by Set2p; suggested stimulatory role in 80S formation during translation initiation; similar to the Drosophila dCDK12 and human CDK12 and probably CDK13 [Source:SGD;Acc:S000001622])

HSP 1 Score: 61.6178 bits (148), Expect = 1.528e-10
Identity = 52/179 (29.05%), Postives = 83/179 (46.37%), Query Frame = 1
Query:  343 IGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEM---GNGAYWLVMEYCICDLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLF-ELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            +G+G +G VYK ++ NT+K+ ALKK+  + + + +  + I++I L +         SF    V   +E+        +++ EY   DL+ L+                    L  EV    S            ++LF +LL GM YL    I+H D+K  N+LI   G++KI DFGLA
Sbjct:  189 VGEGTYGKVYKAKNTNTEKLVALKKLRLQGEREGFPITSIREIKLLQ---------SFDHPNVSTIKEIMVESQKTVYMIFEYADNDLSGLL--------------------LNKEVQISHSQ----------CKHLFKQLLLGMEYLHDNKILHRDVKGSNILIDNQGNLKITDFGLA 328          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Yeast
Match: MKK2 (MAPKK involved in the protein kinase C signaling pathway; involved in control of cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk1p; MKK2 has a paralog, MKK1, that arose from the whole genome duplication [Source:SGD;Acc:S000006061])

HSP 1 Score: 61.2326 bits (147), Expect = 1.866e-10
Identity = 43/183 (23.50%), Postives = 82/183 (44.81%), Query Frame = 1
Query:  319 ERLKSLTLIGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCICDLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            + + +L ++G+GA G V K   +N KK+FALK +        Y +   +++   K       KS + V+  G F +  + + ++ MEY                         + G  L    + +    G   ++++ +    +L G+ YL  R ++H D+K  N+L+ + G IK+ DFG++
Sbjct:  212 DEITTLGILGEGAGGSVAKCRLKNGKKVFALKTINTMNTDPEYQKQIFRELQFNKSF-----KSDYIVQYYGMFTDEQSSSIYIAMEY-------------------------MGGKSLEATYKNLLKRGGRISERVIGKIAESVLRGLSYLHERKVIHRDIKPQNILLNEKGEIKLCDFGVS 364          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Nematostella
Match: EDO49865 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7REX1])

HSP 1 Score: 74.3294 bits (181), Expect = 1.803e-14
Identity = 56/178 (31.46%), Postives = 85/178 (47.75%), Query Frame = 1
Query:  334 LTLIGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCICDLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            L  IG+GA G V+K +   + ++ ALKKV  R   D    + +++I     +L E  ++ + V+L+  F   G G + LV EY   DL+++++       +  LT   + GYLL                         LL G+ Y   + I+H DLK  N+LI   GH+KI DFGLA
Sbjct:   10 LGRIGEGAHGIVFKAKHIESGEIVALKKVPLRRLEDGIPNTALREI----KSLQENEENPYVVKLIDVFPH-GTG-FVLVFEYMWSDLSEVLR-----NSERPLTEAQIKGYLLM------------------------LLKGVAYCHNKGIMHRDLKPANLLISSTGHLKIADFGLA 152          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Nematostella
Match: EDO41403 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4F0])

HSP 1 Score: 71.633 bits (174), Expect = 8.414e-14
Identity = 54/183 (29.51%), Postives = 81/183 (44.26%), Query Frame = 1
Query:  319 ERLKSLTLIGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCICDLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            E  + +  IG+G +G VYK  D+ T +M ALKK+     +D  +E      + E   L ELN  +  V L+         + +LV E+   DL K +   P                             G+    L+  Y+++LL G+ Y     ++H DLK  N+LI +NG IK+ DFGLA
Sbjct:    2 ENFEKVEKIGEGTYGVVYKARDKTTGRMVALKKI----RLDTESEGVPSTAIREISLLKELNHPN-VVSLLDVVH--NQKSLYLVFEFLSQDLKKYMDCLPP---------------------------SGIS-TSLIKSYVYQLLSGVAYCHSHRVLHRDLKPQNLLIDKNGAIKLADFGLA 149          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Nematostella
Match: EDO49420 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGF7])

HSP 1 Score: 66.2402 bits (160), Expect = 5.729e-12
Identity = 51/178 (28.65%), Postives = 83/178 (46.63%), Query Frame = 1
Query:  334 LTLIGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCICDLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            L  IG+G +G V+KG+++ T+++ ALK+V   +D +    S +++I L    L EL K +  VRL             LV E+C  DL K                             +     G     +V  ++F+LL G+ +    +++H DLK  N+LI ++G +K+ DFGLA
Sbjct:    7 LEKIGEGTYGTVFKGKNKETREILALKRVRLDDDDEGVPSSALREICL----LKEL-KHNNIVRLYDVLHS--EKKLTLVFEFCDQDLKK-----------------------------YFDSCQGEVDASVVKSFMFQLLRGLAFCHSHNVLHRDLKPQNLLINKDGELKLADFGLA 148          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Nematostella
Match: EDO42845 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0A9])

HSP 1 Score: 66.6254 bits (161), Expect = 5.884e-12
Identity = 55/216 (25.46%), Postives = 95/216 (43.98%), Query Frame = 1
Query:  271 NMSRILRDSRLVIKWSERLKSLTLIGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYC----ICDLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA--FNDSWFHRKSI 900
            N  R L +  L     E    L  +G+G++G V+K   + + ++ A+K+V    D+    +  IK+I     ++ +   S + V+  G++    N   W+VMEYC    + DL K+         ++ LT E +                     K V +Y  +   G+ YL  R  +H D+K  N+L+   GH K+ DFG+A    D+   R ++
Sbjct:    6 NELRKLSEESLTRPPEEVFDVLEKLGEGSYGSVFKAMHKESGQVVAIKQVPVDTDL----QEIIKEI-----SMMQQCDSPYVVKYYGSY--FKNTDLWIVMEYCGAGSVSDLMKI--------RNKTLTEEEI---------------------KCVLKYTLK---GLEYLHLRRKIHRDIKAGNILLNSEGHAKLADFGVAGQLTDTMAKRNTV 178          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Nematostella
Match: EDO38489 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCT2])

HSP 1 Score: 62.7734 bits (151), Expect = 2.311e-11
Identity = 50/176 (28.41%), Postives = 80/176 (45.45%), Query Frame = 1
Query:  343 IGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCIC-DLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            I +GAFG VY G   +        KV+K++D+    ++ I+ ++ E+  L  ++KS + V L  +FQ       +LVMEY +  DL  L+                  GY   E+  F               Y  +++  + YL    I+H DLK DN+L+   G +K+ DFGL+
Sbjct:   10 ISRGAFGQVYLGRKRDKSGQLYAIKVMKKKDV--INKNMIEQVVAERDAL-AISKSPYVVHLFYSFQS--RDKIFLVMEYLVGGDLKSLLHNI---------------GYFDEEMARF---------------YTAQIILALEYLHSHGIIHRDLKPDNMLLSNTGKVKLTDFGLS 150          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Medaka
Match: cdk20 (cyclin dependent kinase 20 [Source:NCBI gene;Acc:101166132])

HSP 1 Score: 74.7146 bits (182), Expect = 3.226e-14
Identity = 61/205 (29.76%), Postives = 93/205 (45.37%), Query Frame = 1
Query:  319 ERLKSLTLIGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCICDLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLAFNDSWFHRKSIKMLVTTDAEKC 933
            E+   L  IG+GA G V+K +   T +  ALKKV  R+  D      +++I      L E+  +   V+L   F   G G + LV  + + DL+++++         +LT   V GY++                         LL G+ +L + +I+H DLK  N+LI  +GH+KI DFGLA   S   R+     V T A  C
Sbjct:    2 EQYSILGRIGEGAHGIVFKAKHVQTGETVALKKVALRKLEDGIPNQALREI----KALQEIEDNQHVVKLKDVFPH-GTG-FVLVFNFMLSDLSEVIR-----NHQRHLTPAQVKGYMVM------------------------LLKGVAFLHQNNIMHRDLKPANLLISSSGHLKIADFGLARLFSHEGRRLYSHQVATRAVGC 171          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Medaka
Match: cdk1 (cyclin dependent kinase 1 [Source:NCBI gene;Acc:100049478])

HSP 1 Score: 72.0182 bits (175), Expect = 1.978e-13
Identity = 53/177 (29.94%), Postives = 84/177 (47.46%), Query Frame = 1
Query:  343 IGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCICDLTKLVKAFP--QYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            IG+G +G VYKG  ++T ++ A+KK+    + +    + ++++ L    L EL K    VRL+     M     +L+ E+   DL K + + P  QY D                               LV  YL+++L G+++  RR ++H DLK  N+LI   G IK+ DFGLA
Sbjct:   10 IGEGTYGVVYKGRHKSTGQVVAMKKIRLESEEEGVPSTAVREVSL----LQEL-KHPNVVRLLDVL--MQESRLYLIFEFLSMDLKKYLDSIPSGQYMD-----------------------------PMLVKSYLYQILEGIYFCHRRRVLHRDLKPQNLLIDNKGVIKLADFGLA 150          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Medaka
Match: cdk20 (cyclin dependent kinase 20 [Source:NCBI gene;Acc:101166132])

HSP 1 Score: 72.4034 bits (176), Expect = 2.101e-13
Identity = 55/183 (30.05%), Postives = 86/183 (46.99%), Query Frame = 1
Query:  319 ERLKSLTLIGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCICDLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            E+   L  IG+GA G V+K +   T +  ALKKV  R+  D      +++I      L E+  +   V+L   F   G G + LV  + + DL+++++         +LT   V GY++                         LL G+ +L + +I+H DLK  N+LI  +GH+KI DFGLA
Sbjct:    4 EQYSILGRIGEGAHGIVFKAKHVQTGETVALKKVALRKLEDGIPNQALREI----KALQEIEDNQHVVKLKDVFPH-GTG-FVLVFNFMLSDLSEVIR-----NHQRHLTPAQVKGYMVM------------------------LLKGVAFLHQNNIMHRDLKPANLLISSSGHLKIADFGLA 151          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Medaka
Match: cdk5 (cyclin dependent kinase 5 [Source:NCBI gene;Acc:101174461])

HSP 1 Score: 68.9366 bits (167), Expect = 1.619e-12
Identity = 55/183 (30.05%), Postives = 86/183 (46.99%), Query Frame = 1
Query:  319 ERLKSLTLIGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCICDLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLA 867
            ++ + L  IG+G +G V+K ++  T ++ ALK+V   +D +    S +++I L    L EL K    VRL        +    LV EYC  DL K   +               NG L  E                V  ++++LL G+ +   R+++H DLK  N+LI +NG +K+ DFGLA
Sbjct:    2 QKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICL----LKEL-KHKNIVRLHDVLH--SDKKLTLVFEYCDQDLKKYFDS--------------CNGDLDPET---------------VKSFMYQLLKGLAFCHSRNVLHRDLKPQNLLINRNGELKLADFGLA 148          
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Medaka
Match: cdc42bpb (CDC42 binding protein kinase beta [Source:NCBI gene;Acc:101168010])

HSP 1 Score: 69.707 bits (169), Expect = 4.988e-12
Identity = 55/181 (30.39%), Postives = 94/181 (51.93%), Query Frame = 1
Query:  334 LTLIGQGAFGDVYKGEDENTKKMFALK-----KVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCICDLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFG 861
            L +IG+GAFG+V   + +NT++++A+K     +++KR +   + E   +D+L+ KG       S +  RL  AFQ+  +   +LVM+Y                        YV G LL  +++F  D    D  +    Y+ E++  +H + ++H VH D+K DN+L+  NGHI++ DFG
Sbjct:   77 LKVIGRGAFGEVAVVKMKNTERVYAMKILNKWEMLKRAETACFREE--RDVLV-KG------DSQWITRLHYAFQD--DNFLYLVMDY------------------------YVGGDLLTLLSKF-EDRLPEDMARF---YVAEMVLAVHSIHQQHYVHRDIKPDNILLDVNGHIRLADFG 218          
BLAST of Serine/threonine-protein kinase greatwall vs. Planmine SMEST
Match: SMESG000009373.1 (SMESG000009373.1)

HSP 1 Score: 1090.1 bits (2818), Expect = 0.000e+0
Identity = 525/525 (100.00%), Postives = 525/525 (100.00%), Query Frame = 1
Query:   49 MSAKKAWFRLQEKHSPSSKTYLSPIKHICYNSAVDALMTQDPYTKPQIWALLTLEEFYYQNSCLTVYHEFHHEFNMSRILRDSRLVIKWSERLKSLTLIGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCICDLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLAFNDSWFHRKSIKMLVTTDAEKCAADNADKGNFGRGNTLHYDAELSVSRLIQKKPKYLKRIVRQYSQNPLFQMDFPIKQVFLTDIYAVGFIVVQLLFGGLNLKVKPDEFEEFVWHIDITFDEYIFDEFILRKFLSSATDVKEYSVMKFLASLFSPRAVRADGYVEDIRIFSKCEEVYESAINIYRVEQLEYYKSIKMEHMNVLNSNMPEEFINLLKKNSQEKKAESIQLASDDEARKVMNLPTFAFTDSKYLK 1623
            MSAKKAWFRLQEKHSPSSKTYLSPIKHICYNSAVDALMTQDPYTKPQIWALLTLEEFYYQNSCLTVYHEFHHEFNMSRILRDSRLVIKWSERLKSLTLIGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCICDLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLAFNDSWFHRKSIKMLVTTDAEKCAADNADKGNFGRGNTLHYDAELSVSRLIQKKPKYLKRIVRQYSQNPLFQMDFPIKQVFLTDIYAVGFIVVQLLFGGLNLKVKPDEFEEFVWHIDITFDEYIFDEFILRKFLSSATDVKEYSVMKFLASLFSPRAVRADGYVEDIRIFSKCEEVYESAINIYRVEQLEYYKSIKMEHMNVLNSNMPEEFINLLKKNSQEKKAESIQLASDDEARKVMNLPTFAFTDSKYLK
Sbjct:    1 MSAKKAWFRLQEKHSPSSKTYLSPIKHICYNSAVDALMTQDPYTKPQIWALLTLEEFYYQNSCLTVYHEFHHEFNMSRILRDSRLVIKWSERLKSLTLIGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCICDLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLAFNDSWFHRKSIKMLVTTDAEKCAADNADKGNFGRGNTLHYDAELSVSRLIQKKPKYLKRIVRQYSQNPLFQMDFPIKQVFLTDIYAVGFIVVQLLFGGLNLKVKPDEFEEFVWHIDITFDEYIFDEFILRKFLSSATDVKEYSVMKFLASLFSPRAVRADGYVEDIRIFSKCEEVYESAINIYRVEQLEYYKSIKMEHMNVLNSNMPEEFINLLKKNSQEKKAESIQLASDDEARKVMNLPTFAFTDSKYLK 525          
BLAST of Serine/threonine-protein kinase greatwall vs. Planmine SMEST
Match: SMESG000003082.1 (SMESG000003082.1)

HSP 1 Score: 201.445 bits (511), Expect = 1.401e-57
Identity = 143/494 (28.95%), Postives = 243/494 (49.19%), Query Frame = 1
Query:   61 KAWFRLQEKHSPSSKTYLSPIKHICYNSAVDALMTQDPYTKPQIWALLTLEEFYYQNSCLTVYHEFHHEFN-MSRILRDSRLVIKWSERLKSLTLIGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCICDLTKLVKAFPQYKDDEYLTNEYVNGYLLFEV-NEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLAFNDSWFHRKS-IKMLVTTDAEKCAADNADKGNFGRGNTLHYDAELSVSRLIQKKPKYLKRIVRQYSQNPLFQMDFPIKQVFLTDIYAVGFIVVQLLFGGLNLKVKPDEFEEFVW-------------HIDITFDEYIFDEFILRKFLSSATDVKEYSVMKFLASLFSPRAVRADGYVEDIRIFSKCEEVYESAINIYRVEQLEYYKSIKMEHMNVLNSNMPEE 1494
            KAW R   K+SPS  T  SP+  I  +   D  + ++ Y    + ++   EE YY N+ +++ HE  ++ N +  IL+ +       +RL  +  I +G +G V++  D++T++  A+K +V      Y     +  I +E+  L+  N   F  R+  AFQ++   ++WLV+EYCIC L   +     + + + ++  ++ G  + ++ ++ MS   G DY+ +VF Y FELLC +HYL+ RHIVH D+K++N+LI  NGH K+ D G A    W  ++S + ++   D  K   +  D      GN  + D E +V  L     + L  I   ++   LF  +   +Q FL+D YA+G +V ++L GG  L   PD ++                 +I I +++ +F+  IL     S     E  V   + S+   R  RA     +I+I+       E+AI+I +VE + YY+   +   NV N   P+ 
Sbjct:    6 KAWKRTLGKYSPSKITQFSPVNLIYAHIKSDRFVKEE-YFDGLLLSVHLSEENYYINT-ISLVHEMRNQSNKLKNILKGTWSRTNLLDRLVDVHYIAKGTYGKVFEAYDQSTQQRLAIKNIVPDNKTQYTYFLSLWKIFMERDVLFAANDCPFMNRMYAAFQDLNKKSFWLVLEYCICCLRDFITN-AMHVNIKMVSTRFIYGDNVIDILSKNMSQNIGFDYQSVVFLYFFELLCALHYLADRHIVHADIKSENILIATNGHPKLSDLGAAQRYRWVDKRSALHIMHNMDHLKSKVEMIDFEFKRSGNVAYLDPETTVRYLKSLNERDLTDIRNYFNLYHLFADEKLTRQTFLSDYYAIGILVFEMLLGGTVLS-HPDSYDRSELQRLGLSVLDIENINIAIAYNDSVFNNLILHNVQHSFHPRYEDLVGILIRSILK-RDHRAKNISRNIKIYRNNRVEIETAIDIKKVELVGYYQGRNITMENVRNIVFPQS 494          
BLAST of Serine/threonine-protein kinase greatwall vs. Planmine SMEST
Match: SMESG000076342.1 (SMESG000076342.1)

HSP 1 Score: 166.777 bits (421), Expect = 1.659e-44
Identity = 137/504 (27.18%), Postives = 245/504 (48.61%), Query Frame = 1
Query:   43 LKMSAKKAWFRLQEKHSPSSKTYLSPIKHICYNSAVDALMT-----QDPYTKPQIWALLTLEEFYYQNSCLTVYHEFHHEFNMSRILRDSR--LVIKWSERLKSLTLIGQGAFGDVYKGEDENTKKMFALKKV-VKREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCICDLTKLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLAFNDSWFHRKSIKMLVTTDAEKCAADNADKGNFGRGNTLHYDAELSVSRLIQKKPKYLKRIVRQ---YSQNPLFQMDFPIKQVFLTDIYAVGFIVVQLLFGGLNL----KVKPDEFEEF------VWHIDITFDEYIFDEFILRKFLSSATDVKEYSVMKFLASLFSPRAVRADGYVEDIRIFSKCEEVYESAINIYRVEQLEYYKSIKMEHMNVLNSNMPE 1491
             + S   AW ++  K+SPS++  +SPIK    N  +  + T     +D Y    IW +   E+F+Y N+ + + +    +  M  +L  +R  + +K+ E L+++  +G G FG VY   D NT+K FA+K + ++ ED+  + +  I   + E+ +    N S F V+   + Q       +L  EYCI DL   +     Y D E++            + E + +  GL    LV  Y+FEL CG+ +L + +I+H D+K+DN++I +  H+KIGDFGL +     HRKS K+LV  D E    + +D      G   + D E+ +  L  +    ++R +     ++   +   D  ++  FLTD +A G + + LLF   ++     ++   FE+       V+ I +     I+ E+I    + +  +  +  +MKFLAS+F PR +RA  YV++  I+   ++     ++  ++E++  +K       N+    +PE
Sbjct:   69 FRKSTDVAWKKVYSKYSPSTEILISPIKASQVN--LQGIWTNDDDEEDEYISIFIWIVNMSEQFFYDNTLMLMNNSKTSKEKMKLLLLHNRKEIKLKFFENLENIIFLGAGGFGRVYSARDINTQKTFAIKYISMESEDLVEHCKH-ILSYMSERNSTVRANDSPFVVKFYYSLQTKLVQGLFLFFEYCIGDLYTYISNI-SYYDYEFIAQSLKTNNP--SILEDLDNDLGLLDVSLV--YIFELFCGLDFLVQSNIIHQDIKSDNLMISETLHLKIGDFGLIYRTRCIHRKSNKLLVNHD-EIDKVERSDYRVCADGTEDYQDFEIKLMILKNENHPDIERFIHNKVVFNTPGIRYSDDILEPTFLTDTWAAGVVSIALLFRAFDILDPFLLETTLFEDVPQDDRNVYAIHLVGKRRIYQEYIFNGLIKAGGECHK-ELMKFLASIFLPRPIRAQEYVKEKEIYQFSKKRLVKYVDFDKIERITSFKDRNFTRENIFLLELPE 562          
BLAST of Serine/threonine-protein kinase greatwall vs. Planmine SMEST
Match: SMESG000076346.1 (SMESG000076346.1)

HSP 1 Score: 166.392 bits (420), Expect = 2.557e-44
Identity = 134/510 (26.27%), Postives = 245/510 (48.04%), Query Frame = 1
Query:   61 KAWFRLQEKHSPSSKTYLSPIKHICYNSAVDALMTQDPYTKPQIWALLTLEEFYYQNSCLTVYHEFHH-EFNMSRILRDSRLV-IKWSERLKSLTLIGQGAFGDVYKGEDENTKKMFALKKVV-KREDMDYYAESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCICDLTKLVKAFPQYKDDEYLTNEYVNGYLLFE-----VNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLAFNDSWFHRKSIKMLVTTDAEKCAADNADKGNFG---RGNTLHYDAELSVSRLIQKKPKYLKRIVRQYSQNPL--FQMDFPI-KQVFLTDIYAVGFIVVQLLFGGLNL------------KVKPDEFEEFVWHIDITFDEYIFDEFILRKFLSSATDVKEYSVMKFLASLFSPRAVRADGYVEDIRIFSKCEEVYESAINIYRVEQLEYYKSIKMEHMNVLNSNMPEEFINLLK 1512
            + W R+  K SPS++  +SPIK    N         DPY +   W +   E+F+Y NS L +       E     + R+S+ + + + + L ++  +G+G FG VY+G D  T K +A+K V  + E++  + E+ I D + E+ +L     S F V+   + Q    G  +L+ E C+ DL+  ++    Y D + ++        LF+     + E  +D   LD       Y+FEL C + +L + +I+H D+K DN++I +  H+KIGDFGL +     HR +  +L+    +    D  +  N+G    G   + D E  +  L   K       +    +  +  F+ D  I    +LTD +A G + + LLF G ++             V     EEF+ H  +   + ++++FI R+ L ++   K   +M+F+AS+F PR VRA+GY++   ++    ++ +  I++ ++E ++ +K  +     +   ++PE+   + K
Sbjct:   74 QGWERIYTKFSPSTEVTVSPIKAAQANLQNVLFNETDPYIQIFTWVVNMSEQFFYDNSLLLLNSSKSDIELINKSLRRNSKQIDLAFFKNLINIGFLGKGNFGSVYRGTDMLTMKNYAIKYVAPESENVVKHCEN-ILDYMAERNSLIRAMNSPFAVKFFYSLQIKHMGGLFLIFELCVGDLSAYIQGI-LYNDHKDISRR------LFKNESDIIQELDNDVKVLDTS---LMYIFELFCALDFLVKANIIHQDIKPDNLMISETFHLKIGDFGLVYRTRTVHRSTNNLLI----KHSEIDTTESSNYGLSIDGTEEYEDLEGKLMELENAKHPLFDEAIENTKKFSIDHFRYDEEILVPSYLTDTWAAGVVCINLLFRGFHIFNPSHICDTILPGVPRTSLEEFLVH--VVTRKSLYNKFI-RQGLITSGGTKHKELMQFIASIFKPREVRANGYIKKKTMYQYTRKLNQRYIDLSKLENIKSFKIRRFNSKTIFTRDVPEKIKQMFK 565          
BLAST of Serine/threonine-protein kinase greatwall vs. Planmine SMEST
Match: SMESG000056745.1 (SMESG000056745.1)

HSP 1 Score: 160.229 bits (404), Expect = 1.186e-43
Identity = 110/389 (28.28%), Postives = 182/389 (46.79%), Query Frame = 1
Query:  469 ILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCICDLTKLVKAFPQYKDDEYLT--NEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFELLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLAFNDSWFHRKSIKMLVTTDAEKCAADNADKGNFGRGNTLHYDAELSVS-RLIQKKPKYLKRIVRQYSQNPLFQMDFPIKQV---FLTDIYAVGFIVVQLLFGGLNLKVKPD---------------EFEEFVWHIDITFDEYIFDEFILRKFLSSATDVKEYSVMKFLASLFSPRAVRADGYVEDIRIFSKCEEVYESAINIYRVEQLEYYKSIKMEHMNVLNSNMPEEFINLLKKNSQEKKAESIQLASDDEAR 1572
            I+ E+   +  N+S F V+L GAFQ+    +YWLV E+CI DL    KA+      E +    + +   +L  +N+        D +K+ F Y+FELL G+ YL++R+++H DLK +N+L+   GH+KI D GL     W  R S    V  ++ +       +G F  GN  + D E+ +   +I K  K  +R + +         DFP+K +   FL+D++ V  I ++LLF G+N  V P+                FE  +W I   +++ I   F+    L    + K  S+++FL +   PR+ RA  Y + +      E  +   I+  +V+ ++YYK       N+ +  MP     +        KA++ Q   D   R
Sbjct:    3 IMTERNAHFRANESPFVVKLHGAFQDSRFTSYWLVFEFCIGDL----KAYVNLIKCEIINFIEDLLEKNILNTLNQLFLIAKKFDTEKVGFIYVFELLAGIDYLAKRNLLHNDLKPENILVSSRGHLKISDLGLTNRFRWLDRWSAAEFVEPESFQLVDKMEKQGKFV-GNMRYTDPEVLIHYNMIYKSKKIYERFMHE---------DFPLKNIHQDFLSDLFGVALIAIELLFYGMNFVVSPNFTVKINKRFEISFLSPFETRLWPIRCLYEQDIITNFV-EVILEKQKNAKNRSILEFLKTCIKPRSTRALEYTKSLSHLKLKELQHSRCIDFEKVKSIQYYKERGFTEYNITSMEMPAPVFEIFSHKQSVMKAKTFQELLDQNTR 376          
The following BLAST results are available for this feature:
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MASTL1.007e-1233.52microtubule associated serine/threonine kinase lik... [more]
CDK51.075e-1230.60cyclin dependent kinase 5 [Source:HGNC Symbol;Acc:... [more]
MASTL1.267e-1233.52microtubule associated serine/threonine kinase lik... [more]
MASTL1.313e-1233.52microtubule associated serine/threonine kinase lik... [more]
CDK12.946e-1228.49cyclin dependent kinase 1 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkc-22.338e-1330.69Protein kinase C-like 2 [Source:UniProtKB/Swiss-P... [more]
pkc-22.791e-1330.69Protein kinase C-like 2 [Source:UniProtKB/Swiss-P... [more]
pkc-23.330e-1330.69Protein kinase C-like 2 [Source:UniProtKB/Swiss-P... [more]
pkc-23.440e-1330.69Protein kinase C-like 2 [Source:UniProtKB/Swiss-P... [more]
wts-12.153e-1229.73Serine/threonine-protein kinase WARTS homolog [So... [more]
back to top
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tie3.314e-1229.03gene:FBgn0014073 transcript:FBtr0073323[more]
gwl5.026e-1229.38gene:FBgn0260399 transcript:FBtr0331352[more]
gwl5.620e-1226.72gene:FBgn0260399 transcript:FBtr0083674[more]
Cdk49.838e-1231.35gene:FBgn0016131 transcript:FBtr0087102[more]
Cdk49.838e-1231.35gene:FBgn0016131 transcript:FBtr0087103[more]
back to top
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdk19.074e-1330.29cyclin-dependent kinase 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
cdk19.074e-1330.29cyclin-dependent kinase 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
cdk51.065e-1230.05cyclin-dependent kinase 5 [Source:ZFIN;Acc:ZDB-GEN... [more]
cdk201.273e-1230.34cyclin-dependent kinase 20 [Source:NCBI gene;Acc:4... [more]
mastl1.297e-1232.95microtubule associated serine/threonine kinase-lik... [more]
back to top
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cachd18.074e-1533.52cache domain containing 1 [Source:Xenbase;Acc:XB-G... [more]
ankrd23.138e-1228.28ankyrin repeat domain 2 (stretch responsive muscle... [more]
ankrd23.444e-1228.28ankyrin repeat domain 2 (stretch responsive muscle... [more]
ankrd25.041e-1228.28ankyrin repeat domain 2 (stretch responsive muscle... [more]
cdk21.418e-1128.96cyclin-dependent kinase 2 [Source:NCBI gene;Acc:49... [more]
back to top
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mastl3.216e-1331.28microtubule associated serine/threonine kinase-lik... [more]
Cdk58.096e-1330.60cyclin-dependent kinase 5 [Source:MGI Symbol;Acc:M... [more]
Cdk133.361e-1226.29cyclin-dependent kinase 13 [Source:MGI Symbol;Acc:... [more]
Cdk131.560e-1126.29cyclin-dependent kinase 13 [Source:MGI Symbol;Acc:... [more]
Cdk91.655e-1128.80cyclin-dependent kinase 9 (CDC2-related kinase) [S... [more]
back to top
BLAST of Serine/threonine-protein kinase greatwall vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6NTJ3|GWL_XENLA1.390e-1434.09Serine/threonine-protein kinase greatwall OS=Xenop... [more]
sp|B1WAR9|GWL_XENTR3.955e-1433.52Serine/threonine-protein kinase greatwall OS=Xenop... [more]
sp|E1BFR5|GWL_BOVIN1.087e-1231.28Serine/threonine-protein kinase greatwall OS=Bos t... [more]
sp|Q9DGA2|CDK1_ORYJA1.693e-1229.94Cyclin-dependent kinase 1 OS=Oryzias javanicus OX=... [more]
sp|Q9DGD3|CDK1_ORYLA1.773e-1229.94Cyclin-dependent kinase 1 OS=Oryzias latipes OX=80... [more]
back to top
BLAST of Serine/threonine-protein kinase greatwall vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1J4JXW01.535e-1330.98Cyclin-dependent kinase 2 OS=Tritrichomonas foetus... [more]
A0A131XDP81.811e-1336.00Putative serine/threonine kinase (Fragment) OS=Hya... [more]
A0A195DUA02.065e-1331.12Cell division protein kinase 6 OS=Trachymyrmex cor... [more]
A0A4P9Y6L82.086e-1333.70Kinase-like domain-containing protein (Fragment) O... [more]
A0A1Y2ARW35.076e-1335.80Kinase-like protein (Fragment) OS=Neocallimastix c... [more]
back to top
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdk202.903e-1430.90cyclin dependent kinase 20 [Source:NCBI gene;Acc:1... [more]
cdk205.086e-1430.90cyclin dependent kinase 20 [Source:NCBI gene;Acc:1... [more]
mastl3.753e-1332.95microtubule associated serine/threonine kinase lik... [more]
cdk58.945e-1330.05cyclin dependent kinase 5 [Source:NCBI gene;Acc:10... [more]
cdk14.167e-1230.51cyclin dependent kinase 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000855.12.179e-1328.11pep scaffold:Pmarinus_7.0:GL480767:13986:34488:-1 ... [more]
ENSPMAT00000000850.12.989e-1328.11pep scaffold:Pmarinus_7.0:GL480767:12801:33146:-1 ... [more]
ENSPMAT00000000851.14.093e-1328.11pep scaffold:Pmarinus_7.0:GL480767:12807:33146:-1 ... [more]
cdk11.156e-1127.91cyclin-dependent kinase 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
cdk23.137e-1130.86cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SPS13.498e-1330.51Putative protein serine/threonine kinase; localize... [more]
RIM153.557e-1329.05Protein kinase involved in cell proliferation in r... [more]
MKK15.290e-1223.50MAPKK involved in the protein kinase C signaling p... [more]
CTK11.528e-1029.05Catalytic (alpha) subunit of C-terminal domain kin... [more]
MKK21.866e-1023.50MAPKK involved in the protein kinase C signaling p... [more]
back to top
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO498651.803e-1431.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414038.414e-1429.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494205.729e-1228.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428455.884e-1225.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384892.311e-1128.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Serine/threonine-protein kinase greatwall vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdk203.226e-1429.76cyclin dependent kinase 20 [Source:NCBI gene;Acc:1... [more]
cdk11.978e-1329.94cyclin dependent kinase 1 [Source:NCBI gene;Acc:10... [more]
cdk202.101e-1330.05cyclin dependent kinase 20 [Source:NCBI gene;Acc:1... [more]
cdk51.619e-1230.05cyclin dependent kinase 5 [Source:NCBI gene;Acc:10... [more]
cdc42bpb4.988e-1230.39CDC42 binding protein kinase beta [Source:NCBI gen... [more]
back to top
BLAST of Serine/threonine-protein kinase greatwall vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000009373.10.000e+0100.00SMESG000009373.1[more]
SMESG000003082.11.401e-5728.95SMESG000003082.1[more]
SMESG000076342.11.659e-4427.18SMESG000076342.1[more]
SMESG000076346.12.557e-4426.27SMESG000076346.1[more]
SMESG000056745.11.186e-4328.28SMESG000056745.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011184 ID=SMED30011184|Name=Serine/threonine-protein kinase greatwall|organism=Schmidtea mediterranea sexual|type=transcript|length=1663bp
CTAAAAATAAAGATTTTAAAAAATCAATCATTTATTTATTTTTTAAAAAT
GTCAGCAAAAAAGGCCTGGTTCAGATTGCAGGAAAAACATTCTCCATCGT
CGAAAACATATTTATCGCCGATCAAGCACATATGTTACAATTCAGCAGTG
GATGCACTCATGACCCAGGATCCCTACACAAAACCCCAAATATGGGCTCT
GTTAACATTAGAAGAGTTCTATTATCAAAATTCTTGCTTAACAGTTTACC
ACGAGTTTCATCACGAATTTAATATGTCGAGAATTCTTAGAGATTCTAGG
TTGGTAATTAAATGGTCAGAAAGATTGAAAAGTTTGACATTAATTGGTCA
AGGCGCTTTTGGTGACGTTTATAAAGGCGAAGATGAAAACACAAAAAAAA
TGTTCGCCCTGAAGAAAGTGGTCAAACGGGAAGACATGGATTATTATGCC
GAATCATTCATTAAAGATATTTTATTGGAAAAAGGAACTCTGTACGAATT
GAACAAAAGTAGTTTTTTCGTTCGACTTGTTGGTGCATTTCAAGAAATGG
GAAATGGCGCCTATTGGCTAGTAATGGAATATTGTATTTGTGATTTGACG
AAATTGGTTAAAGCGTTTCCTCAGTATAAAGACGATGAATATCTAACAAA
TGAATATGTTAACGGATACTTATTGTTCGAGGTGAATGAATTCATGAGTG
ACTATTATGGTCTTGATTATAAAAAGTTAGTTTTCCAGTATTTATTTGAA
CTGCTTTGCGGCATGCATTATTTAAGTCGGCGGCACATTGTGCACACGGA
TTTAAAAACGGATAACGTTCTGATTGGTCAGAATGGTCACATTAAAATCG
GAGATTTTGGCTTGGCATTTAATGATAGTTGGTTCCATAGAAAGTCTATT
AAAATGCTTGTAACAACTGATGCCGAAAAATGTGCCGCTGACAATGCCGA
CAAAGGGAACTTTGGCCGAGGTAATACTTTGCATTACGACGCTGAACTAA
GTGTTTCAAGACTTATTCAAAAAAAACCGAAATATTTAAAACGAATAGTG
CGTCAATACAGTCAAAATCCACTCTTTCAGATGGATTTCCCTATTAAACA
AGTGTTTTTAACTGATATTTATGCTGTTGGATTTATAGTTGTTCAACTGC
TTTTCGGTGGGTTAAATTTAAAAGTCAAACCAGATGAATTTGAAGAGTTC
GTGTGGCATATAGATATAACGTTTGATGAATATATATTCGATGAATTTAT
TCTTAGAAAATTTCTCAGTAGCGCTACAGATGTAAAGGAATATTCGGTAA
TGAAATTTCTGGCTTCATTATTTTCGCCTCGAGCCGTTCGAGCTGACGGG
TACGTTGAAGATATAAGAATATTTTCAAAATGTGAAGAAGTTTATGAAAG
CGCAATAAACATTTATAGAGTTGAACAATTAGAATATTATAAATCTATCA
AAATGGAACATATGAATGTTTTGAATTCCAATATGCCGGAAGAATTTATA
AATTTGCTTAAAAAAAATTCCCAGGAGAAAAAAGCGGAAAGTATTCAACT
CGCTTCTGACGATGAAGCTAGGAAGGTCATGAACTTACCAACATTTGCAT
TTACTGACTCAAAATATTTGAAATAATCAAAATAATACATTTTGTTTTCT
AAAAAGATTTTTC
back to top

protein sequence of SMED30011184-orf-1

>SMED30011184-orf-1 ID=SMED30011184-orf-1|Name=SMED30011184-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=542bp
LKIKILKNQSFIYFLKMSAKKAWFRLQEKHSPSSKTYLSPIKHICYNSAV
DALMTQDPYTKPQIWALLTLEEFYYQNSCLTVYHEFHHEFNMSRILRDSR
LVIKWSERLKSLTLIGQGAFGDVYKGEDENTKKMFALKKVVKREDMDYYA
ESFIKDILLEKGTLYELNKSSFFVRLVGAFQEMGNGAYWLVMEYCICDLT
KLVKAFPQYKDDEYLTNEYVNGYLLFEVNEFMSDYYGLDYKKLVFQYLFE
LLCGMHYLSRRHIVHTDLKTDNVLIGQNGHIKIGDFGLAFNDSWFHRKSI
KMLVTTDAEKCAADNADKGNFGRGNTLHYDAELSVSRLIQKKPKYLKRIV
RQYSQNPLFQMDFPIKQVFLTDIYAVGFIVVQLLFGGLNLKVKPDEFEEF
VWHIDITFDEYIFDEFILRKFLSSATDVKEYSVMKFLASLFSPRAVRADG
YVEDIRIFSKCEEVYESAINIYRVEQLEYYKSIKMEHMNVLNSNMPEEFI
NLLKKNSQEKKAESIQLASDDEARKVMNLPTFAFTDSKYLK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0000086G2/M transition of mitotic cell cycle
GO:0000278mitotic cell cycle
GO:0006974cellular response to DNA damage stimulus
GO:0007049cell cycle
GO:0032515negative regulation of phosphoprotein phosphatase activity
GO:0046777protein autophosphorylation
GO:0051301cell division
GO:0006468protein phosphorylation
GO:0016310phosphorylation
GO:0018105peptidyl-serine phosphorylation
GO:0018107peptidyl-threonine phosphorylation
GO:0035556intracellular signal transduction
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0051721protein phosphatase 2A binding
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0004697protein kinase C activity
GO:0004698calcium-dependent protein kinase C activity
GO:0008270zinc ion binding
GO:0016301kinase activity
GO:0016740transferase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005737cytoplasm
GO:0005813centrosome
GO:0005815microtubule organizing center
GO:0005856cytoskeleton
GO:0032154cleavage furrow
GO:0005829cytosol
GO:0016020membrane
GO:0043005neuron projection
GO:0043025neuronal cell body
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR015155PFU
IPR000719Prot_kinase_dom
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 109..437
e-value: 9.2E-10
score: 4.9
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 111..289
e-value: 4.1E-25
score: 88.6
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 109..532
score: 24.118
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 203..513
e-value: 1.9E-18
score: 68.7
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 104..202
e-value: 5.0E-14
score: 53.7
NoneNo IPR availablePANTHERPTHR24356:SF1SERINE/THREONINE-PROTEIN KINASE GREATWALLcoord: 111..386
NoneNo IPR availablePANTHERPTHR24356SERINE/THREONINE-PROTEIN KINASEcoord: 111..386
NoneNo IPR availableCDDcd00180PKccoord: 115..289
e-value: 7.51404E-26
score: 103.504
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 115..138
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 263..275
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 96..407