fidgetin-like protein 1

Overview
Namefidgetin-like protein 1
Smed IDSMED30011181
Length (bp)1134
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of fidgetin-like protein 1 (SMED30011181) t-SNE clustered cells

Violin plots show distribution of expression levels for fidgetin-like protein 1 (SMED30011181) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of fidgetin-like protein 1 (SMED30011181) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for fidgetin-like protein 1 (SMED30011181) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011181

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30011181SMESG000045800.1 Contig4877newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30011181SMESG000045800.1 Contig4877uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30011181SMESG000045800.1 Contig3692newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30011181SMESG000045800.1 Contig3692uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30011181SMESG000060226.1 SMESG000021986.1 Contig3692newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30011181SMESG000060226.1 SMESG000021986.1 Contig3692uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
X1 cellSMED30011181SMESG000045800.1 SmedASXL_015473SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30011181SMESG000045800.1 dd_Smed_v4_14599_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011181SMESG000045800.1 Contig16511newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011181SMESG000045800.1 Contig16511uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
reproductive organSMED30011181SMESG000045800.1 Contig16511newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30011181SMESG000045800.1 Contig16511uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
zeta neoblastSMED30011181SMESG000045800.1 dd_Smed_v4_14599_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30011181SMESG000045800.1 SMED_32658_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30011181SMESG000045800.1 SMED_32658_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of fidgetin-like protein 1 vs. Ensembl Human
Match: FIGNL1 (fidgetin like 1 [Source:HGNC Symbol;Acc:HGNC:13286])

HSP 1 Score: 359.762 bits (922), Expect = 2.007e-118
Identity = 183/298 (61.41%), Postives = 231/298 (77.52%), Query Frame = 1
Query:  193 ENLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYG 1086
            E LK  EP  +EL++NEI+D G P+ W+DIAG+E  K  I+EIV+ PMLRPD+FTG+R P KG+LLFGPPGTGKTLIGKCIASQS +TFFSISASSLTSKWVG+GEKMVR +F VAR  QPAVIFIDEIDSLLSQR + EHESSR+IKT+FLV+++G  T   +++L +GATNRP EIDEA RRR VKR+YIPLP A AR+QI+  L+  E   ++EEE+E I+++SD +SGADMT LC+EA++GPIR+L    +  +T  ++ PI Y DF  A   V+ SVS  DL+ Y  +N  +G
Sbjct:  374 ERLKNLEPKMIELIMNEIMDHGPPVNWEDIAGVEFAKATIKEIVVWPMLRPDIFTGLRGPPKGILLFGPPGTGKTLIGKCIASQSGATFFSISASSLTSKWVGEGEKMVRALFAVARCQQPAVIFIDEIDSLLSQRGDGEHESSRRIKTEFLVQLDGATTSSEDRILVVGATNRPQEIDEAARRRLVKRLYIPLPEASARKQIVINLMSKEQCCLSEEEIEQIVQQSDAFSGADMTQLCREASLGPIRSLQTADIATITPDQVRPIAYIDFENAFRTVRPSVSPKDLELYENWNKTFG 671          
BLAST of fidgetin-like protein 1 vs. Ensembl Human
Match: FIGNL1 (fidgetin like 1 [Source:HGNC Symbol;Acc:HGNC:13286])

HSP 1 Score: 359.762 bits (922), Expect = 2.007e-118
Identity = 183/298 (61.41%), Postives = 231/298 (77.52%), Query Frame = 1
Query:  193 ENLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYG 1086
            E LK  EP  +EL++NEI+D G P+ W+DIAG+E  K  I+EIV+ PMLRPD+FTG+R P KG+LLFGPPGTGKTLIGKCIASQS +TFFSISASSLTSKWVG+GEKMVR +F VAR  QPAVIFIDEIDSLLSQR + EHESSR+IKT+FLV+++G  T   +++L +GATNRP EIDEA RRR VKR+YIPLP A AR+QI+  L+  E   ++EEE+E I+++SD +SGADMT LC+EA++GPIR+L    +  +T  ++ PI Y DF  A   V+ SVS  DL+ Y  +N  +G
Sbjct:  374 ERLKNLEPKMIELIMNEIMDHGPPVNWEDIAGVEFAKATIKEIVVWPMLRPDIFTGLRGPPKGILLFGPPGTGKTLIGKCIASQSGATFFSISASSLTSKWVGEGEKMVRALFAVARCQQPAVIFIDEIDSLLSQRGDGEHESSRRIKTEFLVQLDGATTSSEDRILVVGATNRPQEIDEAARRRLVKRLYIPLPEASARKQIVINLMSKEQCCLSEEEIEQIVQQSDAFSGADMTQLCREASLGPIRSLQTADIATITPDQVRPIAYIDFENAFRTVRPSVSPKDLELYENWNKTFG 671          
BLAST of fidgetin-like protein 1 vs. Ensembl Human
Match: FIGNL1 (fidgetin like 1 [Source:HGNC Symbol;Acc:HGNC:13286])

HSP 1 Score: 359.762 bits (922), Expect = 2.007e-118
Identity = 183/298 (61.41%), Postives = 231/298 (77.52%), Query Frame = 1
Query:  193 ENLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYG 1086
            E LK  EP  +EL++NEI+D G P+ W+DIAG+E  K  I+EIV+ PMLRPD+FTG+R P KG+LLFGPPGTGKTLIGKCIASQS +TFFSISASSLTSKWVG+GEKMVR +F VAR  QPAVIFIDEIDSLLSQR + EHESSR+IKT+FLV+++G  T   +++L +GATNRP EIDEA RRR VKR+YIPLP A AR+QI+  L+  E   ++EEE+E I+++SD +SGADMT LC+EA++GPIR+L    +  +T  ++ PI Y DF  A   V+ SVS  DL+ Y  +N  +G
Sbjct:  374 ERLKNLEPKMIELIMNEIMDHGPPVNWEDIAGVEFAKATIKEIVVWPMLRPDIFTGLRGPPKGILLFGPPGTGKTLIGKCIASQSGATFFSISASSLTSKWVGEGEKMVRALFAVARCQQPAVIFIDEIDSLLSQRGDGEHESSRRIKTEFLVQLDGATTSSEDRILVVGATNRPQEIDEAARRRLVKRLYIPLPEASARKQIVINLMSKEQCCLSEEEIEQIVQQSDAFSGADMTQLCREASLGPIRSLQTADIATITPDQVRPIAYIDFENAFRTVRPSVSPKDLELYENWNKTFG 671          
BLAST of fidgetin-like protein 1 vs. Ensembl Human
Match: FIGNL1 (fidgetin like 1 [Source:HGNC Symbol;Acc:HGNC:13286])

HSP 1 Score: 359.762 bits (922), Expect = 2.007e-118
Identity = 183/298 (61.41%), Postives = 231/298 (77.52%), Query Frame = 1
Query:  193 ENLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYG 1086
            E LK  EP  +EL++NEI+D G P+ W+DIAG+E  K  I+EIV+ PMLRPD+FTG+R P KG+LLFGPPGTGKTLIGKCIASQS +TFFSISASSLTSKWVG+GEKMVR +F VAR  QPAVIFIDEIDSLLSQR + EHESSR+IKT+FLV+++G  T   +++L +GATNRP EIDEA RRR VKR+YIPLP A AR+QI+  L+  E   ++EEE+E I+++SD +SGADMT LC+EA++GPIR+L    +  +T  ++ PI Y DF  A   V+ SVS  DL+ Y  +N  +G
Sbjct:  374 ERLKNLEPKMIELIMNEIMDHGPPVNWEDIAGVEFAKATIKEIVVWPMLRPDIFTGLRGPPKGILLFGPPGTGKTLIGKCIASQSGATFFSISASSLTSKWVGEGEKMVRALFAVARCQQPAVIFIDEIDSLLSQRGDGEHESSRRIKTEFLVQLDGATTSSEDRILVVGATNRPQEIDEAARRRLVKRLYIPLPEASARKQIVINLMSKEQCCLSEEEIEQIVQQSDAFSGADMTQLCREASLGPIRSLQTADIATITPDQVRPIAYIDFENAFRTVRPSVSPKDLELYENWNKTFG 671          
BLAST of fidgetin-like protein 1 vs. Ensembl Human
Match: FIGNL1 (fidgetin like 1 [Source:HGNC Symbol;Acc:HGNC:13286])

HSP 1 Score: 359.762 bits (922), Expect = 2.007e-118
Identity = 183/298 (61.41%), Postives = 231/298 (77.52%), Query Frame = 1
Query:  193 ENLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYG 1086
            E LK  EP  +EL++NEI+D G P+ W+DIAG+E  K  I+EIV+ PMLRPD+FTG+R P KG+LLFGPPGTGKTLIGKCIASQS +TFFSISASSLTSKWVG+GEKMVR +F VAR  QPAVIFIDEIDSLLSQR + EHESSR+IKT+FLV+++G  T   +++L +GATNRP EIDEA RRR VKR+YIPLP A AR+QI+  L+  E   ++EEE+E I+++SD +SGADMT LC+EA++GPIR+L    +  +T  ++ PI Y DF  A   V+ SVS  DL+ Y  +N  +G
Sbjct:  374 ERLKNLEPKMIELIMNEIMDHGPPVNWEDIAGVEFAKATIKEIVVWPMLRPDIFTGLRGPPKGILLFGPPGTGKTLIGKCIASQSGATFFSISASSLTSKWVGEGEKMVRALFAVARCQQPAVIFIDEIDSLLSQRGDGEHESSRRIKTEFLVQLDGATTSSEDRILVVGATNRPQEIDEAARRRLVKRLYIPLPEASARKQIVINLMSKEQCCLSEEEIEQIVQQSDAFSGADMTQLCREASLGPIRSLQTADIATITPDQVRPIAYIDFENAFRTVRPSVSPKDLELYENWNKTFG 671          
BLAST of fidgetin-like protein 1 vs. Ensembl Celegans
Match: figl-1 (Fidgetin-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:O16299])

HSP 1 Score: 282.722 bits (722), Expect = 4.885e-90
Identity = 169/309 (54.69%), Postives = 223/309 (72.17%), Query Frame = 1
Query:  160 KSNKYESIINHENLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYG 1086
            K  K   +     LK F+   + L+ +EI+     I W D+AGLE  K+ ++EIV+LP  RPD+FTGIRAP KG+LLFGPPGTGKT+IG+C+ASQ K+TFF+ISASSLTSKWVG+GEK+VR +F+VARL  P+VIFIDEIDSLLS R+E+EHESSR+IKT+FLV+++GV T  +E+LL +GATNRP E+DEA RRRF KR+YI LP  ++R QI+  LL     +IT   +E I E +DGYSGADM  LC EAAMGPIR++  D +  +   ++  +   DF EA   V+ +V  + LD Y  ++ K+G
Sbjct:  278 KDEKMSGLRAEPTLKHFDENIISLIESEIMSVNNEIGWADVAGLEGAKKALREIVVLPFKRPDVFTGIRAPPKGVLLFGPPGTGKTMIGRCVASQCKATFFNISASSLTSKWVGEGEKLVRALFSVARLKLPSVIFIDEIDSLLSSRSESEHESSRRIKTEFLVQLDGVNTAPDERLLVLGATNRPQELDEAARRRFQKRLYIALPEPESRTQIVQNLLVGTRHDITNHNLERIRELTDGYSGADMRQLCTEAAMGPIRDI-GDDIETIDKDDIRAVTVMDFAEAARVVRPTVDDSQLDAYAAWDKKFG 585          
BLAST of fidgetin-like protein 1 vs. Ensembl Celegans
Match: figl-1 (Fidgetin-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:O16299])

HSP 1 Score: 282.722 bits (722), Expect = 4.885e-90
Identity = 169/309 (54.69%), Postives = 223/309 (72.17%), Query Frame = 1
Query:  160 KSNKYESIINHENLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYG 1086
            K  K   +     LK F+   + L+ +EI+     I W D+AGLE  K+ ++EIV+LP  RPD+FTGIRAP KG+LLFGPPGTGKT+IG+C+ASQ K+TFF+ISASSLTSKWVG+GEK+VR +F+VARL  P+VIFIDEIDSLLS R+E+EHESSR+IKT+FLV+++GV T  +E+LL +GATNRP E+DEA RRRF KR+YI LP  ++R QI+  LL     +IT   +E I E +DGYSGADM  LC EAAMGPIR++  D +  +   ++  +   DF EA   V+ +V  + LD Y  ++ K+G
Sbjct:  278 KDEKMSGLRAEPTLKHFDENIISLIESEIMSVNNEIGWADVAGLEGAKKALREIVVLPFKRPDVFTGIRAPPKGVLLFGPPGTGKTMIGRCVASQCKATFFNISASSLTSKWVGEGEKLVRALFSVARLKLPSVIFIDEIDSLLSSRSESEHESSRRIKTEFLVQLDGVNTAPDERLLVLGATNRPQELDEAARRRFQKRLYIALPEPESRTQIVQNLLVGTRHDITNHNLERIRELTDGYSGADMRQLCTEAAMGPIRDI-GDDIETIDKDDIRAVTVMDFAEAARVVRPTVDDSQLDAYAAWDKKFG 585          
BLAST of fidgetin-like protein 1 vs. Ensembl Celegans
Match: spas-1 (Probable spastin homolog spas-1 [Source:UniProtKB/Swiss-Prot;Acc:Q8MNV0])

HSP 1 Score: 245.358 bits (625), Expect = 4.029e-77
Identity = 142/347 (40.92%), Postives = 215/347 (61.96%), Query Frame = 1
Query:   73 IAPVIGNKTDQTYNDHSPSSSAAAPIKMPKSNKYESIINHEN-------LKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESL--NITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYG 1086
            + P +      T     P+S+A    +  ++    S+  H+N       L   +    E LL+E+LD    +  DD+AG  S K  ++E V+LP L P+LF G+R P KG+LLFGPPG GKTL+ K +A +SK  FF+ISASSLTSKWVGD EK +R +F +AR  QP++IFIDEIDS+L +R+E + E SR++KT+FLV+ +G  +  ++++L IGATNRP+E+D+AV RRF KR+ + LP  +AR+++I K LK  ++   +   ++  I   + G+S +D+  LCKEAAM PIR +   +L     +++  I+  DF  AL  ++ S S   + K  +F+  +G
Sbjct:  105 VDPNVKQSRSATVGPSRPASAARVTPRPTRATAPASLPMHQNPVNRAALLNGVDKVIGERLLDEVLD-NTGVRMDDVAGCHSAKAALEEAVILPALNPNLFKGLRQPVKGILLFGPPGNGKTLLAKAVAGESKQMFFNISASSLTSKWVGDSEKTIRGLFQIARNAQPSIIFIDEIDSILCERSEKDAEVSRRMKTEFLVQFDGATSSADDRILVIGATNRPHELDDAVLRRFPKRIMLNLPDEEARKELITKTLKKHNMMDGLISSDIRYIASNTSGFSNSDLVALCKEAAMVPIREIDRSKLSMTDGEKIRKIRASDFDTALRTIRPSTSQKIMSKLSDFSRSFG 450          
BLAST of fidgetin-like protein 1 vs. Ensembl Celegans
Match: spas-1 (Probable spastin homolog spas-1 [Source:UniProtKB/Swiss-Prot;Acc:Q8MNV0])

HSP 1 Score: 244.588 bits (623), Expect = 3.193e-76
Identity = 133/289 (46.02%), Postives = 196/289 (67.82%), Query Frame = 1
Query:  226 ELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESL--NITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYG 1086
            E LL+E+LD    +  DD+AG  S K  ++E V+LP L P+LF G+R P KG+LLFGPPG GKTL+ K +A +SK  FF+ISASSLTSKWVGD EK +R +F +AR  QP++IFIDEIDS+L +R+E + E SR++KT+FLV+ +G  +  ++++L IGATNRP+E+D+AV RRF KR+ + LP  +AR+++I K LK  ++   +   ++  I   + G+S +D+  LCKEAAM PIR +   +L     +++  I+  DF  AL  ++ S S   + K  +F+  +G
Sbjct:  224 ERLLDEVLD-NTGVRMDDVAGCHSAKAALEEAVILPALNPNLFKGLRQPVKGILLFGPPGNGKTLLAKAVAGESKQMFFNISASSLTSKWVGDSEKTIRGLFQIARNAQPSIIFIDEIDSILCERSEKDAEVSRRMKTEFLVQFDGATSSADDRILVIGATNRPHELDDAVLRRFPKRIMLNLPDEEARKELITKTLKKHNMMDGLISSDIRYIASNTSGFSNSDLVALCKEAAMVPIREIDRSKLSMTDGEKIRKIRASDFDTALRTIRPSTSQKIMSKLSDFSRSFG 511          
BLAST of fidgetin-like protein 1 vs. Ensembl Celegans
Match: vps-4 (Related to yeast Vacuolar Protein Sorting factor [Source:UniProtKB/TrEMBL;Acc:Q9BL83])

HSP 1 Score: 213.772 bits (543), Expect = 3.434e-65
Identity = 125/318 (39.31%), Postives = 191/318 (60.06%), Query Frame = 1
Query:  265 IYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXX-XXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIR-------------------------------------------NLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYG 1086
            + W DIAGLE  K+ ++E V+LP+  P LFTG R P +G+LLFGPPGTGK+ I K +A+++  + F SIS+S L SKW+G+ EK+V+ +F +AR  +P++IFIDEIDSL S R++ E ES+R+IKT+F+V+M+GVG   N+ +L +GATN P+ +D A+RRRF KR+YIPLP   AR+++    +      +T+++ + + E+ +GYSG D++ L K+A M P+R                                           ++P D+L N       P+  QD   +L +VK +V++ DLD+   F   +G
Sbjct:  115 VKWTDIAGLEGAKEALKEAVILPIKFPQLFTGNRKPWQGILLFGPPGTGKSYIAKAVATEAGESTFFSISSSDLMSKWLGESEKLVKNLFALAREHKPSIIFIDEIDSLCSARSDNESESARRIKTEFMVQMQGVGLN-NDGILVLGATNIPWILDSAIRRRFEKRIYIPLPDIHARKEMFRIDVGKNYNTLTDQDFKVLAERCEGYSGYDISILVKDALMQPVRRVQSATHFKHVSGPSPKDPNVIAHDLLTPCSPGDPHAIAMNWLDVPGDKLAN------PPLSMQDISRSLASVKPTVNNTDLDRLEAFKNDFG 425          
BLAST of fidgetin-like protein 1 vs. Ensembl Fly
Match: Fign (gene:FBgn0031519 transcript:FBtr0077603)

HSP 1 Score: 289.656 bits (740), Expect = 2.475e-93
Identity = 150/296 (50.68%), Postives = 211/296 (71.28%), Query Frame = 1
Query:  199 LKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYG 1086
            L   +   V+ +L E +   KP+ W+DIAGLES K    E +++P+ RPDLFTG+R P +G+LLFGPPGTGKTLI K IASQ+K+ FFSI+ SSLTSKWVGD EK+V+ +F VA   QPA+IFIDE+DSLLS+R+  E+ES+ ++K +FL+ ++G  + E  ++L IGATNRP E+DEAVRRRFV+R+Y+PLP+ +AR++II KL+     N+   +V  + E +DGYSGAD+  LC+ A+M P+R+L PDQ+  +   +L  +   DF +AL  +  SVSS D  ++  +N  YG
Sbjct:  225 LAHLDSKMVDHILGESMHDFKPVAWEDIAGLESAKSTFLEAIIMPLRRPDLFTGVRCPPRGVLLFGPPGTGKTLIAKSIASQAKAKFFSINPSSLTSKWVGDAEKLVKTLFAVAAAHQPAIIFIDEVDSLLSKRSANENESTLRLKNEFLIHLDGAASNEEIRVLVIGATNRPQELDEAVRRRFVRRLYVPLPTREARQKIIEKLIHQVKHNLDVRQVIELAELTDGYSGADVDTLCRYASMAPLRSLTPDQMEVIETHQLPAVTMDDFKQALRVISKSVSSEDCKQFEAWNEIYG 520          
BLAST of fidgetin-like protein 1 vs. Ensembl Fly
Match: Fign (gene:FBgn0031519 transcript:FBtr0331372)

HSP 1 Score: 289.656 bits (740), Expect = 2.475e-93
Identity = 150/296 (50.68%), Postives = 211/296 (71.28%), Query Frame = 1
Query:  199 LKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYG 1086
            L   +   V+ +L E +   KP+ W+DIAGLES K    E +++P+ RPDLFTG+R P +G+LLFGPPGTGKTLI K IASQ+K+ FFSI+ SSLTSKWVGD EK+V+ +F VA   QPA+IFIDE+DSLLS+R+  E+ES+ ++K +FL+ ++G  + E  ++L IGATNRP E+DEAVRRRFV+R+Y+PLP+ +AR++II KL+     N+   +V  + E +DGYSGAD+  LC+ A+M P+R+L PDQ+  +   +L  +   DF +AL  +  SVSS D  ++  +N  YG
Sbjct:  225 LAHLDSKMVDHILGESMHDFKPVAWEDIAGLESAKSTFLEAIIMPLRRPDLFTGVRCPPRGVLLFGPPGTGKTLIAKSIASQAKAKFFSINPSSLTSKWVGDAEKLVKTLFAVAAAHQPAIIFIDEVDSLLSKRSANENESTLRLKNEFLIHLDGAASNEEIRVLVIGATNRPQELDEAVRRRFVRRLYVPLPTREARQKIIEKLIHQVKHNLDVRQVIELAELTDGYSGADVDTLCRYASMAPLRSLTPDQMEVIETHQLPAVTMDDFKQALRVISKSVSSEDCKQFEAWNEIYG 520          
BLAST of fidgetin-like protein 1 vs. Ensembl Fly
Match: spas (gene:FBgn0039141 transcript:FBtr0445311)

HSP 1 Score: 263.848 bits (673), Expect = 9.605e-84
Identity = 143/298 (47.99%), Postives = 218/298 (73.15%), Query Frame = 1
Query:  196 NLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGV-GTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYG 1086
            ++K  E   V+L+L+EI++ G  + W DIAG +  KQ +QE+V+LP +RP+LFTG+RAPAKGLLLFGPPG GKTL+ + +A++  +TF +ISA+SLTSK+VGDGEK+VR +F VAR +QP++IFIDE+DSLLS+R+ +EHE+SR++KT+FLVE +G+ G  + ++++ + ATNRP E+DEA  RRF KRVY+ LP  + R  ++ +LL+ +   +  E +  + + +DGYSG+D+T L K+AA+ PIR L  +Q+  L +  +  I  QDF  +L+ ++ SV+   L+ Y +++  YG
Sbjct:  188 SVKGVEQKLVQLILDEIVEGGAKVEWTDIAGQDVAKQALQEMVILPSVRPELFTGLRAPAKGLLLFGPPGNGKTLLARAVATECSATFLNISAASLTSKYVGDGEKLVRALFAVARHMQPSIIFIDEVDSLLSERSSSEHEASRRLKTEFLVEFDGLPGNPDGDRIVVLAATNRPQELDEAALRRFTKRVYVSLPDEQTRELLLNRLLQKQGSPLDTEALRRLAKITDGYSGSDLTALAKDAALEPIRELNVEQVKCLDISAMRAITEQDFHSSLKRIRRSVAPQSLNSYEKWSQDYG 485          
BLAST of fidgetin-like protein 1 vs. Ensembl Fly
Match: spas (gene:FBgn0039141 transcript:FBtr0445310)

HSP 1 Score: 264.233 bits (674), Expect = 3.511e-83
Identity = 143/298 (47.99%), Postives = 218/298 (73.15%), Query Frame = 1
Query:  196 NLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGV-GTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYG 1086
            ++K  E   V+L+L+EI++ G  + W DIAG +  KQ +QE+V+LP +RP+LFTG+RAPAKGLLLFGPPG GKTL+ + +A++  +TF +ISA+SLTSK+VGDGEK+VR +F VAR +QP++IFIDE+DSLLS+R+ +EHE+SR++KT+FLVE +G+ G  + ++++ + ATNRP E+DEA  RRF KRVY+ LP  + R  ++ +LL+ +   +  E +  + + +DGYSG+D+T L K+AA+ PIR L  +Q+  L +  +  I  QDF  +L+ ++ SV+   L+ Y +++  YG
Sbjct:  250 SVKGVEQKLVQLILDEIVEGGAKVEWTDIAGQDVAKQALQEMVILPSVRPELFTGLRAPAKGLLLFGPPGNGKTLLARAVATECSATFLNISAASLTSKYVGDGEKLVRALFAVARHMQPSIIFIDEVDSLLSERSSSEHEASRRLKTEFLVEFDGLPGNPDGDRIVVLAATNRPQELDEAALRRFTKRVYVSLPDEQTRELLLNRLLQKQGSPLDTEALRRLAKITDGYSGSDLTALAKDAALEPIRELNVEQVKCLDISAMRAITEQDFHSSLKRIRRSVAPQSLNSYEKWSQDYG 547          
BLAST of fidgetin-like protein 1 vs. Ensembl Fly
Match: spas (gene:FBgn0039141 transcript:FBtr0321260)

HSP 1 Score: 263.848 bits (673), Expect = 1.262e-81
Identity = 143/298 (47.99%), Postives = 218/298 (73.15%), Query Frame = 1
Query:  196 NLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGV-GTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYG 1086
            ++K  E   V+L+L+EI++ G  + W DIAG +  KQ +QE+V+LP +RP+LFTG+RAPAKGLLLFGPPG GKTL+ + +A++  +TF +ISA+SLTSK+VGDGEK+VR +F VAR +QP++IFIDE+DSLLS+R+ +EHE+SR++KT+FLVE +G+ G  + ++++ + ATNRP E+DEA  RRF KRVY+ LP  + R  ++ +LL+ +   +  E +  + + +DGYSG+D+T L K+AA+ PIR L  +Q+  L +  +  I  QDF  +L+ ++ SV+   L+ Y +++  YG
Sbjct:  395 SVKGVEQKLVQLILDEIVEGGAKVEWTDIAGQDVAKQALQEMVILPSVRPELFTGLRAPAKGLLLFGPPGNGKTLLARAVATECSATFLNISAASLTSKYVGDGEKLVRALFAVARHMQPSIIFIDEVDSLLSERSSSEHEASRRLKTEFLVEFDGLPGNPDGDRIVVLAATNRPQELDEAALRRFTKRVYVSLPDEQTRELLLNRLLQKQGSPLDTEALRRLAKITDGYSGSDLTALAKDAALEPIRELNVEQVKCLDISAMRAITEQDFHSSLKRIRRSVAPQSLNSYEKWSQDYG 692          
BLAST of fidgetin-like protein 1 vs. Ensembl Zebrafish
Match: fignl1 (fidgetin-like 1 [Source:ZFIN;Acc:ZDB-GENE-030131-1862])

HSP 1 Score: 363.614 bits (932), Expect = 2.435e-120
Identity = 191/346 (55.20%), Postives = 254/346 (73.41%), Query Frame = 1
Query:   49 SRGVRSEFIAPVIGNKTDQTYNDHSPSSSAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYG 1086
            SRG  S+FI+P+   + ++   D++P      P+              E LK FEP  +EL+++EI+D G P+ WDDIAGLE  K  I+EIV+ PMLRPD+FTG+R P KG+LLFGPPGTGKTLIGKCIA QS +TFFSISASSLTSKWVG+GEKMVR +F +AR  QPAVIFIDEIDSLLSQR + EH+SSR+IKT+FLV+++G  T   +++L +GATNRP EIDEA RRR  KR+YIPLP A+ARRQI+  L+ +E   +  +E+E +++ ++G+SGADMT LC+EAA+GPIR++    +  +  +++ PI Y DF EAL+ V+ SVSS DL+ Y E+N  +G
Sbjct:  330 SRGASSKFISPM--PRQEEDLKDNTPKD--MQPVD-------------ERLKNFEPKIIELIMSEIMDHGPPVAWDDIAGLEFAKATIKEIVVWPMLRPDIFTGLRGPPKGILLFGPPGTGKTLIGKCIACQSGATFFSISASSLTSKWVGEGEKMVRALFAIARCHQPAVIFIDEIDSLLSQRTDGEHDSSRRIKTEFLVQLDGAATSAEDRILVVGATNRPQEIDEAARRRLAKRLYIPLPEAEARRQIVTNLMSHEKSQLGVDEMEKVVQGTEGFSGADMTQLCREAALGPIRSISLSDIATIMAEQVRPILYSDFQEALKTVRPSVSSKDLELYEEWNKTFG 658          
BLAST of fidgetin-like protein 1 vs. Ensembl Zebrafish
Match: fignl1 (fidgetin-like 1 [Source:ZFIN;Acc:ZDB-GENE-030131-1862])

HSP 1 Score: 363.614 bits (932), Expect = 2.435e-120
Identity = 191/346 (55.20%), Postives = 254/346 (73.41%), Query Frame = 1
Query:   49 SRGVRSEFIAPVIGNKTDQTYNDHSPSSSAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYG 1086
            SRG  S+FI+P+   + ++   D++P      P+              E LK FEP  +EL+++EI+D G P+ WDDIAGLE  K  I+EIV+ PMLRPD+FTG+R P KG+LLFGPPGTGKTLIGKCIA QS +TFFSISASSLTSKWVG+GEKMVR +F +AR  QPAVIFIDEIDSLLSQR + EH+SSR+IKT+FLV+++G  T   +++L +GATNRP EIDEA RRR  KR+YIPLP A+ARRQI+  L+ +E   +  +E+E +++ ++G+SGADMT LC+EAA+GPIR++    +  +  +++ PI Y DF EAL+ V+ SVSS DL+ Y E+N  +G
Sbjct:  330 SRGASSKFISPM--PRQEEDLKDNTPKD--MQPVD-------------ERLKNFEPKIIELIMSEIMDHGPPVAWDDIAGLEFAKATIKEIVVWPMLRPDIFTGLRGPPKGILLFGPPGTGKTLIGKCIACQSGATFFSISASSLTSKWVGEGEKMVRALFAIARCHQPAVIFIDEIDSLLSQRTDGEHDSSRRIKTEFLVQLDGAATSAEDRILVVGATNRPQEIDEAARRRLAKRLYIPLPEAEARRQIVTNLMSHEKSQLGVDEMEKVVQGTEGFSGADMTQLCREAALGPIRSISLSDIATIMAEQVRPILYSDFQEALKTVRPSVSSKDLELYEEWNKTFG 658          
BLAST of fidgetin-like protein 1 vs. Ensembl Zebrafish
Match: spast (spastin [Source:NCBI gene;Acc:405851])

HSP 1 Score: 307.76 bits (787), Expect = 1.222e-99
Identity = 156/300 (52.00%), Postives = 230/300 (76.67%), Query Frame = 1
Query:  193 ENLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYGSS 1092
            +N K  +     L+LNEI+D G  + +DDIAG +  KQ +QEIV+LP LRP+LFTG+RAPA+GLLLFGPPG GKT++ K +A +S +TFF+ISA++LTSK+VG+GEK+VR +F VAR LQP++IFIDEIDSLL +R E EH++SR++KT+FL+E +GV +G +E++L +GATNRP E+DEAV RRF KR+Y+ LP+ + R +++  LL      ++++E+  +   +DGYSG+D+T+L K+AA+GPIR L P+Q+ N++  E+  I+  DF+E+L+ +K SVS   LD+Y+ +N +YG +
Sbjct:  268 KNFKNVDSKLASLILNEIVDSGSVVRFDDIAGQDLAKQALQEIVILPALRPELFTGLRAPARGLLLFGPPGNGKTMLAKAVAMESNATFFNISAATLTSKYVGEGEKLVRALFAVARELQPSIIFIDEIDSLLCERREGEHDASRRLKTEFLIEFDGVQSGGDERVLVMGATNRPQELDEAVLRRFAKRIYVALPTEETRLKLLKNLLSKHRNPLSQKELSQLARLTDGYSGSDLTSLAKDAALGPIRELKPEQVRNMSAHEMRDIRISDFLESLKRIKRSVSPQTLDQYVRWNREYGDT 567          
BLAST of fidgetin-like protein 1 vs. Ensembl Zebrafish
Match: fign (fidgetin [Source:NCBI gene;Acc:553599])

HSP 1 Score: 249.21 bits (635), Expect = 1.479e-75
Identity = 134/342 (39.18%), Postives = 218/342 (63.74%), Query Frame = 1
Query:   67 EFIAPVIGNKTDQTYNDHSPSSSAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYGSS 1092
            +F +PV+ +  D +   H P S     I    S+ + +    E LK  + + VE++  EIL    P+ W DIAGLE  K  I++ V+ P+LRPD+F+G+    + +LLFGP GTG+TL+G+C+ASQ  + F  +S S+L +KW+G+GEK+V+  F +AR  QP+V+FI ++D LLS +   E   +R IK++ L++++GV +   E +L + +T++P EIDE++RR FVKR+ +PLP A AR QII +LL   +  ++++EV  +++++DG+SG D+  LC+EA +GP+  +P   L  +   ++ P+ YQDF      ++ S+S  +LD Y E+N  +G S
Sbjct:  415 KFGSPVMSDHGDDS-RQHLPHS-----IGTATSSSHPA---EEQLKNSDASLVEMVTTEILQQTPPVDWSDIAGLEMAKATIKDEVLWPILRPDMFSGLATLPRSILLFGPQGTGRTLLGRCMASQLGAAFLLLSGSALVTKWLGEGEKIVQASFLIARCRQPSVVFISDVDLLLSSQLSEESPVNR-IKSELLLQLDGVLSSPEEHVLVVCSTSKPEEIDESLRRYFVKRLLVPLPDATARHQIISQLLSQHNYCLSDKEVTLLVQRTDGFSGLDVVRLCQEALVGPLHGMPGADLSGMIPGQMRPVSYQDFENVFCKIQPSISQKELDTYTEWNKMFGCS 746          
BLAST of fidgetin-like protein 1 vs. Ensembl Zebrafish
Match: fign (fidgetin [Source:NCBI gene;Acc:553599])

HSP 1 Score: 248.825 bits (634), Expect = 1.603e-75
Identity = 134/342 (39.18%), Postives = 218/342 (63.74%), Query Frame = 1
Query:   67 EFIAPVIGNKTDQTYNDHSPSSSAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYGSS 1092
            +F +PV+ +  D +   H P S     I    S+ + +    E LK  + + VE++  EIL    P+ W DIAGLE  K  I++ V+ P+LRPD+F+G+    + +LLFGP GTG+TL+G+C+ASQ  + F  +S S+L +KW+G+GEK+V+  F +AR  QP+V+FI ++D LLS +   E   +R IK++ L++++GV +   E +L + +T++P EIDE++RR FVKR+ +PLP A AR QII +LL   +  ++++EV  +++++DG+SG D+  LC+EA +GP+  +P   L  +   ++ P+ YQDF      ++ S+S  +LD Y E+N  +G S
Sbjct:  404 KFGSPVMSDHGDDS-RQHLPHS-----IGTATSSSHPA---EEQLKNSDASLVEMVTTEILQQTPPVDWSDIAGLEMAKATIKDEVLWPILRPDMFSGLATLPRSILLFGPQGTGRTLLGRCMASQLGAAFLLLSGSALVTKWLGEGEKIVQASFLIARCRQPSVVFISDVDLLLSSQLSEESPVNR-IKSELLLQLDGVLSSPEEHVLVVCSTSKPEEIDESLRRYFVKRLLVPLPDATARHQIISQLLSQHNYCLSDKEVTLLVQRTDGFSGLDVVRLCQEALVGPLHGMPGADLSGMIPGQMRPVSYQDFENVFCKIQPSISQKELDTYTEWNKMFGCS 735          
BLAST of fidgetin-like protein 1 vs. Ensembl Xenopus
Match: fignl1 (fidgetin-like 1 [Source:NCBI gene;Acc:100124890])

HSP 1 Score: 362.459 bits (929), Expect = 8.246e-120
Identity = 194/346 (56.07%), Postives = 250/346 (72.25%), Query Frame = 1
Query:   49 SRGVRSEFIAPVIGNKTDQTYNDHSPSSSAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYG 1086
            SRG+  +F+ PV   +  Q  N               + N   +  + E LK  EP  +EL+++EI+D G P+ WDDIAGLE  K  I+EIV+ PMLRPD+FTG+R P KG+LLFGPPGTGKTLIGKCIA QS +TFFSISASSLTSKWVG+GEKMVR +FTVAR  QPAVIFIDEIDSLLSQR E EHESSR+IKT+FLV+++G  T  ++++L +GATNRP EIDEA RRR VKR+YIPLP A AR+QI+  L+  E  ++ E+EVE+I+ ++DG+SGADMT LC+EAA+GPIR++    +  +T +++ PI Y DF  A   V+ SVS  DL+ Y  +N  +G
Sbjct:  318 SRGLHGKFVPPVPRQEDVQDSNRKV----------YGQGNSEMNAPSDERLKNIEPKMIELIMSEIMDHGPPLNWDDIAGLEFAKTTIKEIVVWPMLRPDIFTGLRGPPKGILLFGPPGTGKTLIGKCIACQSGATFFSISASSLTSKWVGEGEKMVRALFTVARCHQPAVIFIDEIDSLLSQRGEGEHESSRRIKTEFLVQLDGATTSSDDRILVVGATNRPQEIDEAARRRLVKRLYIPLPEASARKQIVVSLMAKEHCSLAEQEVEAIVLQADGFSGADMTQLCREAALGPIRSIQLMDISTITPEQVRPIAYIDFQSAFLVVRPSVSQKDLELYENWNKTFG 653          
BLAST of fidgetin-like protein 1 vs. Ensembl Xenopus
Match: spast (spastin [Source:NCBI gene;Acc:549207])

HSP 1 Score: 298.13 bits (762), Expect = 9.156e-96
Identity = 158/331 (47.73%), Postives = 242/331 (73.11%), Query Frame = 1
Query:  118 HSPSSSAAAPIKMPKSNKYESII------NHENLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYGSS 1092
            ++PS+  AA     ++NK  +        + +NL+  +     L+LNEI+D G  + + DIAG +  KQ +QEIV+LP +RP+LFTG+RAPA+GLLLFGPPG GKT++ K +A++S +TFF+ISA+SLTSK+VG+GEK+VR +F+VAR LQP++IFIDE+DSLL +R E EH++SR++KT+FL+E +GV +G ++++L +GATNRP E+D+AV RRF KRVY+ LP+ + R  ++  LL  +   + E+E+  +   ++GYSG+D+T L K+AA+GPIR L P+Q+ N+   E+  IKY DF+ +L+ +K SVS + L+ Y+ +N ++G +
Sbjct:  239 NAPSNRGAAGKNNTRTNKPTTPTTAVRKKDMKNLRNVDSNLANLILNEIVDSGPTVKFADIAGQDLAKQALQEIVILPSIRPELFTGLRAPARGLLLFGPPGNGKTMLAKAVAAESNATFFNISAASLTSKYVGEGEKLVRALFSVARELQPSIIFIDEVDSLLCERREGEHDASRRLKTEFLIEFDGVQSGGDDRVLVMGATNRPQELDDAVLRRFTKRVYVSLPNEETRLLLLKNLLSKQGNPLNEKELTQLSRLTEGYSGSDITALAKDAALGPIRELKPEQVKNMAASEMRNIKYSDFLSSLKKIKCSVSPSTLESYIRWNKEFGDT 569          
BLAST of fidgetin-like protein 1 vs. Ensembl Xenopus
Match: spast (spastin [Source:NCBI gene;Acc:549207])

HSP 1 Score: 298.13 bits (762), Expect = 2.007e-95
Identity = 158/331 (47.73%), Postives = 242/331 (73.11%), Query Frame = 1
Query:  118 HSPSSSAAAPIKMPKSNKYESII------NHENLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYGSS 1092
            ++PS+  AA     ++NK  +        + +NL+  +     L+LNEI+D G  + + DIAG +  KQ +QEIV+LP +RP+LFTG+RAPA+GLLLFGPPG GKT++ K +A++S +TFF+ISA+SLTSK+VG+GEK+VR +F+VAR LQP++IFIDE+DSLL +R E EH++SR++KT+FL+E +GV +G ++++L +GATNRP E+D+AV RRF KRVY+ LP+ + R  ++  LL  +   + E+E+  +   ++GYSG+D+T L K+AA+GPIR L P+Q+ N+   E+  IKY DF+ +L+ +K SVS + L+ Y+ +N ++G +
Sbjct:  271 NAPSNRGAAGKNNTRTNKPTTPTTAVRKKDMKNLRNVDSNLANLILNEIVDSGPTVKFADIAGQDLAKQALQEIVILPSIRPELFTGLRAPARGLLLFGPPGNGKTMLAKAVAAESNATFFNISAASLTSKYVGEGEKLVRALFSVARELQPSIIFIDEVDSLLCERREGEHDASRRLKTEFLIEFDGVQSGGDDRVLVMGATNRPQELDDAVLRRFTKRVYVSLPNEETRLLLLKNLLSKQGNPLNEKELTQLSRLTEGYSGSDITALAKDAALGPIRELKPEQVKNMAASEMRNIKYSDFLSSLKKIKCSVSPSTLESYIRWNKEFGDT 601          
BLAST of fidgetin-like protein 1 vs. Ensembl Xenopus
Match: spast (spastin [Source:NCBI gene;Acc:549207])

HSP 1 Score: 288.5 bits (737), Expect = 2.467e-92
Identity = 159/331 (48.04%), Postives = 236/331 (71.30%), Query Frame = 1
Query:  118 HSPSSSAAAPIKMPKSNKYESII------NHENLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYGSS 1092
            ++PS+  AA     ++NK  +        + +NL+  +     L+LNEI+D G  + + DIAG +  KQ +QEIV+LP +RP+LFTG+RAPA+GLLLFGPPG GKT++ K +A++S +TFF+ISA+SLTSK+VG+GEK+VR +F+VAR LQP++IFIDE+DSLL +R E EH++SR++KT+FL+E +GV +G ++++L +GATNRP E+D+AV RRF KRVY+ LP+ +    IIY        NI    V      ++GYSG+D+T L K+AA+GPIR L P+Q+ N+   E+  IKY DF+ +L+ +K SVS + L+ Y+ +N ++G +
Sbjct:  227 NAPSNRGAAGKNNTRTNKPTTPTTAVRKKDMKNLRNVDSNLANLILNEIVDSGPTVKFADIAGQDLAKQALQEIVILPSIRPELFTGLRAPARGLLLFGPPGNGKTMLAKAVAAESNATFFNISAASLTSKYVGEGEKLVRALFSVARELQPSIIFIDEVDSLLCERREGEHDASRRLKTEFLIEFDGVQSGGDDRVLVMGATNRPQELDDAVLRRFTKRVYVSLPNEEVTF-IIYT-------NIYCHVVYFSSRLTEGYSGSDITALAKDAALGPIRELKPEQVKNMAASEMRNIKYSDFLSSLKKIKCSVSPSTLESYIRWNKEFGDT 549          
BLAST of fidgetin-like protein 1 vs. Ensembl Xenopus
Match: spast (spastin [Source:NCBI gene;Acc:549207])

HSP 1 Score: 264.618 bits (675), Expect = 7.786e-84
Identity = 143/300 (47.67%), Postives = 217/300 (72.33%), Query Frame = 1
Query:  193 ENLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYGSS 1092
            +NL+  +     L+LNEI+D G  + + DIAG +  KQ +QEIV+LP +RP+LFTG+RAPA+GLLLFGPPG GKT++ K +A++S +TFF+ISA+SLTSK+VG+GEK+VR +F+VAR LQP++IFIDE+DSLL +R E EH++SR++KT+FL+E +GV +G ++++L +GATNRP E+D+AV                 R  ++  LL  +   + E+E+  +   ++GYSG+D+T L K+AA+GPIR L P+Q+ N+   E+  IKY DF+ +L+ +K SVS + L+ Y+ +N ++G +
Sbjct:  196 KNLRNVDSNLANLILNEIVDSGPTVKFADIAGQDLAKQALQEIVILPSIRPELFTGLRAPARGLLLFGPPGNGKTMLAKAVAAESNATFFNISAASLTSKYVGEGEKLVRALFSVARELQPSIIFIDEVDSLLCERREGEHDASRRLKTEFLIEFDGVQSGGDDRVLVMGATNRPQELDDAV----------------LRLLLLKNLLSKQGNPLNEKELTQLSRLTEGYSGSDITALAKDAALGPIRELKPEQVKNMAASEMRNIKYSDFLSSLKKIKCSVSPSTLESYIRWNKEFGDT 479          
BLAST of fidgetin-like protein 1 vs. Ensembl Mouse
Match: Fignl1 (fidgetin-like 1 [Source:MGI Symbol;Acc:MGI:1890648])

HSP 1 Score: 364.77 bits (935), Expect = 1.971e-120
Identity = 191/346 (55.20%), Postives = 252/346 (72.83%), Query Frame = 1
Query:   49 SRGVRSEFIAPVIGNKTDQTYNDHSPSSSAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYG 1086
            SRG+  +F+ PV  NK D +        S+ A    P      + +  + LK  EP  VEL++NEI+D G P++WDDIAG+E  K  I+EIV+ PM+RPD+FTG+R P KG+LLFGPPGTGKTLIGKCIASQS +TFFSISASSLTSKWVG+GEKMVR +F VAR  QPAVIFIDEIDSLLSQR + EHESSR+IKT+FLV+++G  T   +++L +GATNRP EIDEA RRR VKR+YIPLP A AR+QI+  L+  E   +++EE + ++++SDG+SGADMT LC+EA++GPIR+L    +  ++  ++ PI Y DF  A + V+ +VS  DL+ Y  +N  +G
Sbjct:  342 SRGIFGKFVPPV-SNKQDGSEQHAKKHKSSRAGSAEP------AHLTDDCLKNVEPRMVELIMNEIMDHGPPVHWDDIAGVEFAKATIKEIVVWPMMRPDIFTGLRGPPKGILLFGPPGTGKTLIGKCIASQSGATFFSISASSLTSKWVGEGEKMVRALFAVARCQQPAVIFIDEIDSLLSQRGDGEHESSRRIKTEFLVQLDGATTSSEDRILVVGATNRPQEIDEAARRRLVKRLYIPLPEASARKQIVGNLMSKEQCCLSDEETDLVVQQSDGFSGADMTQLCREASLGPIRSLHAADIATISPDQVRPIAYIDFENAFKTVRPTVSPKDLELYENWNETFG 680          
BLAST of fidgetin-like protein 1 vs. Ensembl Mouse
Match: Fignl1 (fidgetin-like 1 [Source:MGI Symbol;Acc:MGI:1890648])

HSP 1 Score: 364.77 bits (935), Expect = 1.971e-120
Identity = 191/346 (55.20%), Postives = 252/346 (72.83%), Query Frame = 1
Query:   49 SRGVRSEFIAPVIGNKTDQTYNDHSPSSSAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYG 1086
            SRG+  +F+ PV  NK D +        S+ A    P      + +  + LK  EP  VEL++NEI+D G P++WDDIAG+E  K  I+EIV+ PM+RPD+FTG+R P KG+LLFGPPGTGKTLIGKCIASQS +TFFSISASSLTSKWVG+GEKMVR +F VAR  QPAVIFIDEIDSLLSQR + EHESSR+IKT+FLV+++G  T   +++L +GATNRP EIDEA RRR VKR+YIPLP A AR+QI+  L+  E   +++EE + ++++SDG+SGADMT LC+EA++GPIR+L    +  ++  ++ PI Y DF  A + V+ +VS  DL+ Y  +N  +G
Sbjct:  342 SRGIFGKFVPPV-SNKQDGSEQHAKKHKSSRAGSAEP------AHLTDDCLKNVEPRMVELIMNEIMDHGPPVHWDDIAGVEFAKATIKEIVVWPMMRPDIFTGLRGPPKGILLFGPPGTGKTLIGKCIASQSGATFFSISASSLTSKWVGEGEKMVRALFAVARCQQPAVIFIDEIDSLLSQRGDGEHESSRRIKTEFLVQLDGATTSSEDRILVVGATNRPQEIDEAARRRLVKRLYIPLPEASARKQIVGNLMSKEQCCLSDEETDLVVQQSDGFSGADMTQLCREASLGPIRSLHAADIATISPDQVRPIAYIDFENAFKTVRPTVSPKDLELYENWNETFG 680          
BLAST of fidgetin-like protein 1 vs. Ensembl Mouse
Match: Fignl1 (fidgetin-like 1 [Source:MGI Symbol;Acc:MGI:1890648])

HSP 1 Score: 364.77 bits (935), Expect = 1.971e-120
Identity = 191/346 (55.20%), Postives = 252/346 (72.83%), Query Frame = 1
Query:   49 SRGVRSEFIAPVIGNKTDQTYNDHSPSSSAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYG 1086
            SRG+  +F+ PV  NK D +        S+ A    P      + +  + LK  EP  VEL++NEI+D G P++WDDIAG+E  K  I+EIV+ PM+RPD+FTG+R P KG+LLFGPPGTGKTLIGKCIASQS +TFFSISASSLTSKWVG+GEKMVR +F VAR  QPAVIFIDEIDSLLSQR + EHESSR+IKT+FLV+++G  T   +++L +GATNRP EIDEA RRR VKR+YIPLP A AR+QI+  L+  E   +++EE + ++++SDG+SGADMT LC+EA++GPIR+L    +  ++  ++ PI Y DF  A + V+ +VS  DL+ Y  +N  +G
Sbjct:  342 SRGIFGKFVPPV-SNKQDGSEQHAKKHKSSRAGSAEP------AHLTDDCLKNVEPRMVELIMNEIMDHGPPVHWDDIAGVEFAKATIKEIVVWPMMRPDIFTGLRGPPKGILLFGPPGTGKTLIGKCIASQSGATFFSISASSLTSKWVGEGEKMVRALFAVARCQQPAVIFIDEIDSLLSQRGDGEHESSRRIKTEFLVQLDGATTSSEDRILVVGATNRPQEIDEAARRRLVKRLYIPLPEASARKQIVGNLMSKEQCCLSDEETDLVVQQSDGFSGADMTQLCREASLGPIRSLHAADIATISPDQVRPIAYIDFENAFKTVRPTVSPKDLELYENWNETFG 680          
BLAST of fidgetin-like protein 1 vs. Ensembl Mouse
Match: Fignl1 (fidgetin-like 1 [Source:MGI Symbol;Acc:MGI:1890648])

HSP 1 Score: 364.77 bits (935), Expect = 1.971e-120
Identity = 191/346 (55.20%), Postives = 252/346 (72.83%), Query Frame = 1
Query:   49 SRGVRSEFIAPVIGNKTDQTYNDHSPSSSAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYG 1086
            SRG+  +F+ PV  NK D +        S+ A    P      + +  + LK  EP  VEL++NEI+D G P++WDDIAG+E  K  I+EIV+ PM+RPD+FTG+R P KG+LLFGPPGTGKTLIGKCIASQS +TFFSISASSLTSKWVG+GEKMVR +F VAR  QPAVIFIDEIDSLLSQR + EHESSR+IKT+FLV+++G  T   +++L +GATNRP EIDEA RRR VKR+YIPLP A AR+QI+  L+  E   +++EE + ++++SDG+SGADMT LC+EA++GPIR+L    +  ++  ++ PI Y DF  A + V+ +VS  DL+ Y  +N  +G
Sbjct:  342 SRGIFGKFVPPV-SNKQDGSEQHAKKHKSSRAGSAEP------AHLTDDCLKNVEPRMVELIMNEIMDHGPPVHWDDIAGVEFAKATIKEIVVWPMMRPDIFTGLRGPPKGILLFGPPGTGKTLIGKCIASQSGATFFSISASSLTSKWVGEGEKMVRALFAVARCQQPAVIFIDEIDSLLSQRGDGEHESSRRIKTEFLVQLDGATTSSEDRILVVGATNRPQEIDEAARRRLVKRLYIPLPEASARKQIVGNLMSKEQCCLSDEETDLVVQQSDGFSGADMTQLCREASLGPIRSLHAADIATISPDQVRPIAYIDFENAFKTVRPTVSPKDLELYENWNETFG 680          
BLAST of fidgetin-like protein 1 vs. Ensembl Mouse
Match: Spast (spastin [Source:MGI Symbol;Acc:MGI:1858896])

HSP 1 Score: 300.442 bits (768), Expect = 1.054e-96
Identity = 153/300 (51.00%), Postives = 227/300 (75.67%), Query Frame = 1
Query:  193 ENLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYGSS 1092
            +N +  +     L++NEI+D G  + +DDIAG E  KQ +QEIV+LP LRP+LFTG+RAPA+GLLLFGPPG GKT++ K +A++S +TFF+ISA+SLTSK+VG+GEK+VR +F VAR LQP++IFIDE+DSLL +R E EH++SR++KT+FL+E +GV +  ++++L +GATNRP E+DEAV RRF+KRVY+ LP+ + R  ++  LL  +   +T++E+  +   +DGYSG+D+T L K+AA+GPIR L P+Q+ N++  E+  I+  DF E+L+ +K SVS   L+ Y+ +N  +G +
Sbjct:  280 KNFRNVDSNLANLIMNEIVDNGTAVKFDDIAGQELAKQALQEIVILPSLRPELFTGLRAPARGLLLFGPPGNGKTMLAKAVAAESNATFFNISAASLTSKYVGEGEKLVRALFAVARELQPSIIFIDEVDSLLCERREGEHDASRRLKTEFLIEFDGVQSAGDDRVLVMGATNRPQELDEAVLRRFIKRVYVSLPNEETRLLLLKNLLCKQGSPLTQKELAQLARMTDGYSGSDLTALAKDAALGPIRELKPEQVKNMSASEMRNIRLSDFTESLKKIKRSVSPQTLEAYIRWNKDFGDT 579          
BLAST of fidgetin-like protein 1 vs. UniProt/SwissProt
Match: sp|Q6GX84|FIGL1_RAT (Fidgetin-like protein 1 OS=Rattus norvegicus OX=10116 GN=Fignl1 PE=2 SV=1)

HSP 1 Score: 365.54 bits (937), Expect = 4.799e-120
Identity = 194/348 (55.75%), Postives = 254/348 (72.99%), Query Frame = 1
Query:   49 SRGVRSEFIAPVIGNKTDQTYNDHS--PSSSAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYG 1086
            SRG+  +F+ PV  NK D +  + +  P SS A   +        + +  + LK  EP  VEL++NEI+D G P++W+DIAG+E  K  I+EIV+ PM+RPD+FTG+R P KG+LLFGPPGTGKTLIGKCIASQS +TFFSISASSLTSKWVG+GEKMVR +F VAR  QPAVIFIDEIDSLLSQR + EHESSR+IKT+FLV+++G  T   +++L +GATNRP EIDEA RRR VKR+YIPLP A AR+QI+  L+  E   +T+EE E ++++SDG+SGADMT LC+EA++GPIR+L    +  ++  ++ PI Y DF  A   V+ SVS  DL+ Y  +N  +G
Sbjct:  335 SRGIFGKFVPPV-SNKQDGSEQNGNVKPKSSRAGSAE-------PAHLTDDRLKNVEPRMVELIMNEIMDHGPPVHWEDIAGVEFAKATIKEIVVWPMMRPDIFTGLRGPPKGILLFGPPGTGKTLIGKCIASQSGATFFSISASSLTSKWVGEGEKMVRALFAVARCQQPAVIFIDEIDSLLSQRGDGEHESSRRIKTEFLVQLDGATTSSEDRILVVGATNRPQEIDEAARRRLVKRLYIPLPEASARKQIVVNLMSKEQCCLTDEETELVVQQSDGFSGADMTQLCREASLGPIRSLHTADIATISPDQVRPIAYIDFENAFRTVRPSVSPKDLELYENWNKTFG 674          
BLAST of fidgetin-like protein 1 vs. UniProt/SwissProt
Match: sp|Q6DDU8|FIGL1_XENLA (Fidgetin-like protein 1 OS=Xenopus laevis OX=8355 GN=fignl1 PE=2 SV=1)

HSP 1 Score: 364.385 bits (934), Expect = 8.531e-120
Identity = 186/298 (62.42%), Postives = 235/298 (78.86%), Query Frame = 1
Query:  193 ENLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYG 1086
            E+LK  EP  +EL+++EI+D G P+ WDDIAGLE  K  I+EIV+ PMLRPD+FTG+R P KG+LLFGPPGTGKTLIGKCIA QS +TFFSISASSLTSKWVG+GEKMVR +FTVAR  QPAVIFIDEIDSLLSQR E EHESSR+IKT+FLV+++G  T   +++L +GATNRP EIDEA RRR VKR+YIPLP A AR+QI+  L+  E  ++TE+EVE+I+ ++DG+SGADMT LC+EAA+GPIR++    +  +T +++ PI Y DF  A   V+ SVS  DL+ Y  +N  +G
Sbjct:  355 EHLKNIEPKMIELIMSEIMDHGPPLNWDDIAGLEFAKTTIKEIVVWPMLRPDIFTGLRGPPKGILLFGPPGTGKTLIGKCIACQSGATFFSISASSLTSKWVGEGEKMVRALFTVARCHQPAVIFIDEIDSLLSQRGEGEHESSRRIKTEFLVQLDGATTSSEDRILVVGATNRPQEIDEAARRRLVKRLYIPLPEASARKQIVVSLMSKEHCSLTEQEVEAIVLQADGFSGADMTQLCREAALGPIRSIQLMDISTITAEQVRPIAYIDFQSAFLVVRPSVSQKDLELYENWNKTFG 652          
BLAST of fidgetin-like protein 1 vs. UniProt/SwissProt
Match: sp|Q8BPY9|FIGL1_MOUSE (Fidgetin-like protein 1 OS=Mus musculus OX=10090 GN=Fignl1 PE=1 SV=1)

HSP 1 Score: 364.77 bits (935), Expect = 1.379e-119
Identity = 191/346 (55.20%), Postives = 252/346 (72.83%), Query Frame = 1
Query:   49 SRGVRSEFIAPVIGNKTDQTYNDHSPSSSAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYG 1086
            SRG+  +F+ PV  NK D +        S+ A    P      + +  + LK  EP  VEL++NEI+D G P++WDDIAG+E  K  I+EIV+ PM+RPD+FTG+R P KG+LLFGPPGTGKTLIGKCIASQS +TFFSISASSLTSKWVG+GEKMVR +F VAR  QPAVIFIDEIDSLLSQR + EHESSR+IKT+FLV+++G  T   +++L +GATNRP EIDEA RRR VKR+YIPLP A AR+QI+  L+  E   +++EE + ++++SDG+SGADMT LC+EA++GPIR+L    +  ++  ++ PI Y DF  A + V+ +VS  DL+ Y  +N  +G
Sbjct:  342 SRGIFGKFVPPV-SNKQDGSEQHAKKHKSSRAGSAEP------AHLTDDCLKNVEPRMVELIMNEIMDHGPPVHWDDIAGVEFAKATIKEIVVWPMMRPDIFTGLRGPPKGILLFGPPGTGKTLIGKCIASQSGATFFSISASSLTSKWVGEGEKMVRALFAVARCQQPAVIFIDEIDSLLSQRGDGEHESSRRIKTEFLVQLDGATTSSEDRILVVGATNRPQEIDEAARRRLVKRLYIPLPEASARKQIVGNLMSKEQCCLSDEETDLVVQQSDGFSGADMTQLCREASLGPIRSLHAADIATISPDQVRPIAYIDFENAFKTVRPTVSPKDLELYENWNETFG 680          
BLAST of fidgetin-like protein 1 vs. UniProt/SwissProt
Match: sp|A4IHT0|FIGL1_XENTR (Fidgetin-like protein 1 OS=Xenopus tropicalis OX=8364 GN=fignl1 PE=2 SV=1)

HSP 1 Score: 362.459 bits (929), Expect = 4.369e-119
Identity = 194/346 (56.07%), Postives = 250/346 (72.25%), Query Frame = 1
Query:   49 SRGVRSEFIAPVIGNKTDQTYNDHSPSSSAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYG 1086
            SRG+  +F+ PV   +  Q  N               + N   +  + E LK  EP  +EL+++EI+D G P+ WDDIAGLE  K  I+EIV+ PMLRPD+FTG+R P KG+LLFGPPGTGKTLIGKCIA QS +TFFSISASSLTSKWVG+GEKMVR +FTVAR  QPAVIFIDEIDSLLSQR E EHESSR+IKT+FLV+++G  T  ++++L +GATNRP EIDEA RRR VKR+YIPLP A AR+QI+  L+  E  ++ E+EVE+I+ ++DG+SGADMT LC+EAA+GPIR++    +  +T +++ PI Y DF  A   V+ SVS  DL+ Y  +N  +G
Sbjct:  318 SRGLHGKFVPPVPRQEDVQDSNRKV----------YGQGNSEMNAPSDERLKNIEPKMIELIMSEIMDHGPPLNWDDIAGLEFAKTTIKEIVVWPMLRPDIFTGLRGPPKGILLFGPPGTGKTLIGKCIACQSGATFFSISASSLTSKWVGEGEKMVRALFTVARCHQPAVIFIDEIDSLLSQRGEGEHESSRRIKTEFLVQLDGATTSSDDRILVVGATNRPQEIDEAARRRLVKRLYIPLPEASARKQIVVSLMAKEHCSLAEQEVEAIVLQADGFSGADMTQLCREAALGPIRSIQLMDISTITPEQVRPIAYIDFQSAFLVVRPSVSQKDLELYENWNKTFG 653          
BLAST of fidgetin-like protein 1 vs. UniProt/SwissProt
Match: sp|Q6PIW4|FIGL1_HUMAN (Fidgetin-like protein 1 OS=Homo sapiens OX=9606 GN=FIGNL1 PE=1 SV=2)

HSP 1 Score: 359.762 bits (922), Expect = 9.639e-118
Identity = 183/298 (61.41%), Postives = 231/298 (77.52%), Query Frame = 1
Query:  193 ENLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYG 1086
            E LK  EP  +EL++NEI+D G P+ W+DIAG+E  K  I+EIV+ PMLRPD+FTG+R P KG+LLFGPPGTGKTLIGKCIASQS +TFFSISASSLTSKWVG+GEKMVR +F VAR  QPAVIFIDEIDSLLSQR + EHESSR+IKT+FLV+++G  T   +++L +GATNRP EIDEA RRR VKR+YIPLP A AR+QI+  L+  E   ++EEE+E I+++SD +SGADMT LC+EA++GPIR+L    +  +T  ++ PI Y DF  A   V+ SVS  DL+ Y  +N  +G
Sbjct:  374 ERLKNLEPKMIELIMNEIMDHGPPVNWEDIAGVEFAKATIKEIVVWPMLRPDIFTGLRGPPKGILLFGPPGTGKTLIGKCIASQSGATFFSISASSLTSKWVGEGEKMVRALFAVARCQQPAVIFIDEIDSLLSQRGDGEHESSRRIKTEFLVQLDGATTSSEDRILVVGATNRPQEIDEAARRRLVKRLYIPLPEASARKQIVINLMSKEQCCLSEEEIEQIVQQSDAFSGADMTQLCREASLGPIRSLQTADIATITPDQVRPIAYIDFENAFRTVRPSVSPKDLELYENWNKTFG 671          
BLAST of fidgetin-like protein 1 vs. TrEMBL
Match: A0A5K3FGH4 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 389.808 bits (1000), Expect = 1.522e-129
Identity = 206/351 (58.69%), Postives = 270/351 (76.92%), Query Frame = 1
Query:   49 SRGVRSEFIAPVIGNKTDQTYNDHSPSSSAAAPIKMP-KSNKYES---IINHENLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYGS 1089
            SRG RS F+ P      D    D   SS++ +   MP  ++K+ S   +   E LKQF+   V+L+++EI+D    I W+DIAGL   K  +QE+V+ PMLRPDLFTG+R P KGLLLFGPPGTGKTLIGKCIAS S+STFFSISASSLTSKWVGDGEKMVR +FT+AR+ QP+VIFIDEIDSLLSQR+ETEHESSR+IKT+FLV+++GVGT  ++KLL IGATNRP E+DEA RRRFVKR+YIPLPS  ARR+I+ +LLK +  ++T+++++ I   SDG+SGAD+ NLC+EAAMGPIR L  + + ++  +++ P++ +DF+ A  +VK+SVSS DL+ YL +N +YGS
Sbjct:   95 SRGPRSAFVPPFTRPSNDACLKDDINSSTSNSEFPMPPTASKFGSRCEVTADERLKQFDAKIVDLIMSEIMDSETSISWNDIAGLHRVKSTLQEVVIFPMLRPDLFTGLRGPPKGLLLFGPPGTGKTLIGKCIASSSQSTFFSISASSLTSKWVGDGEKMVRALFTIARIHQPSVIFIDEIDSLLSQRSETEHESSRRIKTEFLVQLDGVGTKSDDKLLLIGATNRPQELDEAARRRFVKRLYIPLPSFDARREIVDRLLKQQKHSLTQDDLDIIASNSDGFSGADVANLCREAAMGPIRGLTLEIIQSIPCQDVPPVEMKDFLMAFNHVKASVSSKDLEHYLSWNRQYGS 445          
BLAST of fidgetin-like protein 1 vs. TrEMBL
Match: A0A1S3IGH9 (fidgetin-like protein 1 OS=Lingula unguis OX=7574 GN=LOC106164080 PE=3 SV=1)

HSP 1 Score: 393.66 bits (1010), Expect = 2.097e-128
Identity = 207/348 (59.48%), Postives = 263/348 (75.57%), Query Frame = 1
Query:   52 RGVRSEFIAPVIGNKTDQTYNDHSPSSSAAAPIKMPKSNKYESIIN--HENLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYGS 1089
            RG+ S+F+ PV+         D S S  ++  +K    NK ++      E LK  +P  +EL+ NEI+D G P+ WDDIAGLE  K  I+EIV+ PMLRPD+FTG+R P KGLLLFGPPGTGKTLIGKCIASQSKSTFFSISASSLTSKWVG+GEKMVR +F VAR  QPAVIFIDEIDSLL+QR + EHE+SR+IKT+FLV+++G  TGE +++L +GATNRP E+DEA RRRFVKR+YIPLP   ARR I+  LL  ++  +TEE+++SI +KS+GYSGADM NLCKEAA+GPIR++    + N+T  E+ PI +QDF+     V++SVS ADLD Y+++N KYGS
Sbjct:  342 RGLTSKFVPPVMNR-------DGSDSDESSTLLKRSGLNKAQTTDEPVDERLKNIDPKMIELIANEIMDHGPPVSWDDIAGLEFAKNTIKEIVVWPMLRPDIFTGLRGPPKGLLLFGPPGTGKTLIGKCIASQSKSTFFSISASSLTSKWVGEGEKMVRALFAVARCHQPAVIFIDEIDSLLTQRTDGEHEASRRIKTEFLVQLDGATTGEEDRILVVGATNRPQELDEAARRRFVKRLYIPLPETAARRHIVVHLLSQQTYQLTEEDLDSICDKSEGYSGADMANLCKEAALGPIRSIAFSDIENITADEVRPITHQDFMAGFRQVRASVSEADLDLYIDWNKKYGS 682          
BLAST of fidgetin-like protein 1 vs. TrEMBL
Match: A0A1S3JHD2 (fidgetin-like protein 1 OS=Lingula unguis OX=7574 GN=LOC106173277 PE=3 SV=1)

HSP 1 Score: 393.275 bits (1009), Expect = 3.126e-128
Identity = 207/348 (59.48%), Postives = 263/348 (75.57%), Query Frame = 1
Query:   52 RGVRSEFIAPVIGNKTDQTYNDHSPSSSAAAPIKMPKSNKYESIIN--HENLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYGS 1089
            RG+ S+F+ PV+         D S S  ++  +K    NK ++      E LK  +P  +EL+ NEI+D G P+ WDDIAGLE  K  I+EIV+ PMLRPD+FTG+R P KGLLLFGPPGTGKTLIGKCIASQSKSTFFSISASSLTSKWVG+GEKMVR +F VAR  QPAVIFIDEIDSLL+QR + EHE+SR+IKT+FLV+++G  TGE +++L +GATNRP E+DEA RRRFVKR+YIPLP   ARR I+  LL  ++  +TEE+++SI +KS+GYSGADM NLCKEAA+GPIR++    + N+T  E+ PI +QDF+     V++SVS ADLD Y+++N KYGS
Sbjct:  342 RGLTSKFVPPVMNR-------DGSDSDESSTLLKRSGLNKAQTTDEPVDERLKNIDPKMIELIANEIMDHGPPVSWDDIAGLEFAKNTIKEIVVWPMLRPDIFTGLRGPPKGLLLFGPPGTGKTLIGKCIASQSKSTFFSISASSLTSKWVGEGEKMVRALFAVARCHQPAVIFIDEIDSLLTQRTDGEHEASRRIKTEFLVQLDGATTGEEDRILVVGATNRPQELDEAARRRFVKRLYIPLPETAARRHIVVHLLSQQTYQLTEEDLDSICDKSEGYSGADMANLCKEAALGPIRSIAFSDIENITADEVRPITHQDFMAGFRQVRASVSEADLDLYIDWNKKYGS 682          
BLAST of fidgetin-like protein 1 vs. TrEMBL
Match: A0A3P7Y347 (AAA domain-containing protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS65 PE=4 SV=1)

HSP 1 Score: 382.104 bits (980), Expect = 3.539e-128
Identity = 201/346 (58.09%), Postives = 266/346 (76.88%), Query Frame = 1
Query:   52 RGVRSEFIAPVIGNKTDQTYNDHSPSSSAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYGS 1089
            RGVR  F+ P     +D T     P+SS  A       NK E+ I  E LKQF+   V+++++EI+D    I WDDIAGLE  K+ +QEIV+LPMLRPDLF G+R P KGLLLFGPPGTGKTLIGKCIASQS STFFSISASSLTSKWVG+GEK+VR +F+VAR+ QP+VIFIDE+DSLL+QR+ETEHESSR+IKT+FLV+++G+ T ++E++LFIGATNRP E+DEA RRRFVKR+YIPLP+  AR++I+ +LL+     + E++   I  ++DGYSGADM NLC+EAAMGPIR+L  + + ++   E+ P++  DF  A   V++S SS+DL++YL++N++YGS
Sbjct:   31 RGVRGNFVPP-FEKDSDSTSK---PTSSYIA------ENKSEASICDERLKQFDQKIVDMIMSEIMDSKSSITWDDIAGLEFSKKTLQEIVILPMLRPDLFVGLRGPPKGLLLFGPPGTGKTLIGKCIASQSNSTFFSISASSLTSKWVGEGEKLVRALFSVARIHQPSVIFIDEVDSLLTQRSETEHESSRRIKTEFLVQLDGITTNDDERILFIGATNRPQELDEAARRRFVKRLYIPLPTRSARKEIVQRLLRQNHHTLKEDDFWDIAHRADGYSGADMANLCREAAMGPIRSLTIEAIQHIACDEVRPVELTDFHAAFRQVRASNSSSDLEQYLKWNSQYGS 366          
BLAST of fidgetin-like protein 1 vs. TrEMBL
Match: A0A183ND79 (AAA domain-containing protein OS=Schistosoma mattheei OX=31246 PE=4 SV=1)

HSP 1 Score: 382.104 bits (980), Expect = 3.861e-128
Identity = 201/346 (58.09%), Postives = 266/346 (76.88%), Query Frame = 1
Query:   52 RGVRSEFIAPVIGNKTDQTYNDHSPSSSAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYGS 1089
            RGVR  F+ P     +D T     P+SS  A       NK E+ I  E LKQF+   V+++++EI+D    I WDDIAGLE  K+ +QEIV+LPMLRPDLF G+R P KGLLLFGPPGTGKTLIGKCIASQS STFFSISASSLTSKWVG+GEK+VR +F+VAR+ QP+VIFIDE+DSLL+QR+ETEHESSR+IKT+FLV+++G+ T ++E++LFIGATNRP E+DEA RRRFVKR+YIPLP+  AR++I+ +LL+     + E++   I  ++DGYSGADM NLC+EAAMGPIR+L  + + ++   E+ P++  DF  A   V++S SS+DL++YL++N++YGS
Sbjct:   31 RGVRGNFVPP-FEKDSDSTSK---PTSSYIA------ENKSEASICDERLKQFDQKIVDMIMSEIMDSKSSITWDDIAGLEFSKKTLQEIVILPMLRPDLFVGLRGPPKGLLLFGPPGTGKTLIGKCIASQSNSTFFSISASSLTSKWVGEGEKLVRALFSVARIHQPSVIFIDEVDSLLTQRSETEHESSRRIKTEFLVQLDGITTNDDERILFIGATNRPQELDEAARRRFVKRLYIPLPTRSARKEIVQRLLRQNHHTLKEDDFWDIAHRADGYSGADMANLCREAAMGPIRSLTIEAIQHIACDEVRPVELTDFHAAFRQVRASNSSSDLEQYLKWNSQYGS 366          
BLAST of fidgetin-like protein 1 vs. Ensembl Cavefish
Match: spast (spastin [Source:NCBI gene;Acc:405851])

HSP 1 Score: 307.375 bits (786), Expect = 7.072e-100
Identity = 160/322 (49.69%), Postives = 238/322 (73.91%), Query Frame = 1
Query:  133 SAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESI--LEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYGSS 1092
            +  AP   P+  +     + +N K  +     L+LNEI+D G  + ++D+AG +  KQ +QEIV+LP LRP+LFTG+RAPA+GLLLFGPPG GKT++ K +A +S +TFF+ISA+SLTSK+VG+GEK+VR +F VAR LQP+VIFIDEIDSLL +R E EH++SR++KT+FL++ +GV +G ++++L +GATNRP E+DEAV RRF KRVY+ LP+ + R +++  LL      +T++E+  +  L  +DGYSG+D+T+L K+AA+GPIR L P+Q+ N+   E+  I++ DFV++L+ +K SVS   LD+Y+ +N +YG +
Sbjct:  230 AGGAPASAPQRKR-----DMKNFKNVDSKLANLILNEIVDSGSEVRFEDVAGQDLAKQALQEIVILPALRPELFTGLRAPARGLLLFGPPGNGKTMLAKAVAMESNATFFNISAASLTSKYVGEGEKLVRALFAVARELQPSVIFIDEIDSLLCERREGEHDASRRLKTEFLIQFDGVQSGGDDRVLVMGATNRPQELDEAVLRRFAKRVYVTLPTEETRLKLLRNLLGKHGNPLTQKELSQLARLLMTDGYSGSDLTSLAKDAALGPIRELRPEQVRNMAANEMRNIRFSDFVDSLKKIKKSVSPQTLDQYVRWNREYGDT 546          
BLAST of fidgetin-like protein 1 vs. Ensembl Cavefish
Match: fignl1 (fidgetin-like 1 [Source:ZFIN;Acc:ZDB-GENE-030131-1862])

HSP 1 Score: 306.22 bits (783), Expect = 2.199e-98
Identity = 171/346 (49.42%), Postives = 229/346 (66.18%), Query Frame = 1
Query:   49 SRGVRSEFIAPVIGNKTDQTYNDHSPSSSAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYG 1086
            SRG  S+F++P +  + D+  +D +  +    PI              E LK FEP  +EL+++EI+D G P+ WDDIAGLE  K  I+EIV+ PMLRPD+FTG+R P KG+LLFGPPGTGKTLIGKCIA QS +TFFSISASSLTSKWVG+GEKM                           R + EH+SSR+IKT+FLV+++G  T   +++L +GATNRP+EIDEA RRR  KR+YIPLP A ARRQI+  L+  E   +  EE+E ++  ++G+SGADMT LC+EAA+GPIR++    +  +T +++ PI Y DF EAL+ V+ SVS  DL+ Y E+N  +G
Sbjct:  336 SRGTHSKFVSP-MPRQEDEGRDDPAQDT---PPID-------------ERLKNFEPKIIELIMSEIMDHGPPVAWDDIAGLEFAKTTIKEIVVWPMLRPDIFTGLRGPPKGILLFGPPGTGKTLIGKCIACQSGATFFSISASSLTSKWVGEGEKM---------------------------RTDGEHDSSRRIKTEFLVQLDGAATSSEDRILVVGATNRPHEIDEAARRRLAKRLYIPLPEAAARRQIVINLMTREKSQLGPEELEKVVSGTEGFSGADMTQLCREAALGPIRSIQLSDIATITPEQVRPILYCDFQEALKTVRPSVSKKDLELYEEWNKTFG 637          
BLAST of fidgetin-like protein 1 vs. Ensembl Cavefish
Match: katna1 (katanin catalytic subunit A1 [Source:NCBI gene;Acc:103037638])

HSP 1 Score: 246.514 bits (628), Expect = 4.615e-77
Identity = 142/326 (43.56%), Postives = 224/326 (68.71%), Query Frame = 1
Query:  157 PKSNKYESIINHENLKQFEPAK-----VELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNET-EHESSRKIKTQFLVEMEGV-GTGENE---KLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRN----LPPDQLVNLTLKELS-PIKYQDFVEALENVKSSVSSADLDKYLEFNTKYGS 1089
            PK +K + + +   +K+F+        +E L  +I+     + WDDIA LE  K++++E V+LPM  P+ F GIR P KG+L+ GPPGTGKTL+ K +A++ ++TFF++S+S+LTSK+ G+ EK+VR++F +AR   P  IFIDEIDS+ S+R  + EHE+SR++K + LV+M+GV GT EN+    ++ + ATN P++IDEA+RRR  KR+YIPLPSAK R  ++   LK   L   + +++ I E+ +GYSGAD+TN+C++A++  +R     L P+++ N++ +E+  P   +DF  AL+ V  SVS+ADL+KY ++  ++GS
Sbjct:  158 PKEDKSKLVASETEVKKFDRGGEDKDLIETLERDIISQNPNVKWDDIADLEEAKKLLKEAVVLPMWMPEFFKGIRRPWKGVLMVGPPGTGKTLLAKAVATECRTTFFNVSSSTLTSKYRGESEKLVRLLFEMARFYAPTTIFIDEIDSMCSRRGTSEEHEASRRVKAELLVQMDGVGGTSENDPSKMVMVLAATNFPWDIDEALRRRLEKRIYIPLPSAKGRVDLLKINLKELEL-ANDVDMDKIAEQMEGYSGADITNVCRDASLMAMRRRIEGLTPEEIRNISREEMHMPTTMEDFETALKKVSKSVSAADLEKYEKWIAEFGS 482          
BLAST of fidgetin-like protein 1 vs. Ensembl Cavefish
Match: katnal1 (katanin catalytic subunit A1 like 1 [Source:NCBI gene;Acc:103039844])

HSP 1 Score: 238.039 bits (606), Expect = 8.870e-74
Identity = 135/300 (45.00%), Postives = 211/300 (70.33%), Query Frame = 1
Query:  223 VELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNET-EHESSRKIKTQFLVEMEGVGTG-ENEK----LLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIR----NLPPDQLVNLTLKELS-PIKYQDFVEALENVKSSVSSADLDKYLEFNTKYGS 1089
            V+ L  +I+     I+WDDIA LE  K++++E V+LPM  PD F GIR P KG+L+ GPPGTGKT++ K +A++  +TFF++S+S+LTSK+ G+ EK+VR++F +AR   P  IFIDEIDS+  +R  + EHE+SR++K++ LV+M+GVG   EN+     ++ + ATN P++IDEA+RRR  KR+YIPLP+AK R +++ K+   E    ++ ++  I E+ +GYSGAD+TN+C++A+M  +R     L P+++  L+ +EL  P+  +DF  AL+ +  SVS+ADL+KY  +  ++GS
Sbjct:  189 VDALERDIVSRNPNIHWDDIADLEDAKKLLREAVVLPMWMPDFFKGIRRPWKGVLMVGPPGTGKTMLAKAVATECGTTFFNVSSSTLTSKYRGESEKLVRLLFEMARFYAPTTIFIDEIDSICGRRGTSDEHEASRRVKSELLVQMDGVGGALENDDPSKMVMVLAATNFPWDIDEALRRRLEKRIYIPLPTAKGRAELL-KISLREVEVASDVDLAVIAEQIEGYSGADITNVCRDASMMAMRRRIQGLKPEEIRALSKEELQMPVTMEDFELALKKISKSVSAADLEKYEAWMNEFGS 487          
BLAST of fidgetin-like protein 1 vs. Ensembl Cavefish
Match: katnal1 (katanin catalytic subunit A1 like 1 [Source:NCBI gene;Acc:103039844])

HSP 1 Score: 235.728 bits (600), Expect = 1.133e-72
Identity = 141/319 (44.20%), Postives = 212/319 (66.46%), Query Frame = 1
Query:  223 VELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNET-EHESSRKIKTQFLVEMEGVGTG-ENEK----LLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLN-------------ITEEEVES------ILEKSDGYSGADMTNLCKEAAMGPIR----NLPPDQLVNLTLKELS-PIKYQDFVEALENVKSSVSSADLDKYLEFNTKYGS 1089
            V+ L  +I+     I+WDDIA LE  K++++E V+LPM  PD F GIR P KG+L+ GPPGTGKT++ K +A++  +TFF++S+S+LTSK+ G+ EK+VR++F +AR   P  IFIDEIDS+  +R  + EHE+SR++K++ LV+M+GVG   EN+     ++ + ATN P++IDEA+RRR  KR+YIPLP+A   +  + K L N SLN             + E EV S      I E+ +GYSGAD+TN+C++A+M  +R     L P+++  L+ +EL  P+  +DF  AL+ +  SVS+ADL+KY  +  ++GS
Sbjct:  189 VDALERDIVSRNPNIHWDDIADLEDAKKLLREAVVLPMWMPDFFKGIRRPWKGVLMVGPPGTGKTMLAKAVATECGTTFFNVSSSTLTSKYRGESEKLVRLLFEMARFYAPTTIFIDEIDSICGRRGTSDEHEASRRVKSELLVQMDGVGGALENDDPSKMVMVLAATNFPWDIDEALRRRLEKRIYIPLPTALGYQIQLIKYLSNSSLNYSAKGRAELLKISLREVEVASDVDLAVIAEQIEGYSGADITNVCRDASMMAMRRRIQGLKPEEIRALSKEELQMPVTMEDFELALKKISKSVSAADLEKYEAWMNEFGS 507          
BLAST of fidgetin-like protein 1 vs. Ensembl Sea Lamprey
Match: fignl1 (fidgetin-like 1 [Source:ZFIN;Acc:ZDB-GENE-030131-1862])

HSP 1 Score: 356.681 bits (914), Expect = 2.117e-118
Identity = 192/346 (55.49%), Postives = 250/346 (72.25%), Query Frame = 1
Query:   52 RGVRSEFIAPVIGNKTDQTYNDHSPSSSAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYGS 1089
            RG   +F++PV+         D S S+           N   S I  E LK  +P  VEL+ NE++D G P+ WDDIAGLE  K  I+EIV+ PMLRPD+FTG+R P KG+LLFGPPGTGKTLIGKCIASQS +TFFSISAS LTSKWVG+GEKMVR +F VAR  QPAVIFIDEIDSLLSQR + EH+SSR+IKT+FLV+++G  T  +E++L +GATNRP EIDEA RRR  KR+Y+PLP A ARR ++ +LL  +S  ++ EE+ +++E+S+G+SGAD+T LC+EAA+GPIR +P   +  +   ++ PI  QDF +AL+ V+ SVS  DLD Y+E+N  +G 
Sbjct:  329 RGPYGKFVSPVL-------REDGSESTGQC----TRGQNGEPSQIIDERLKNIDPKMVELINNEVMDHGPPVSWDDIAGLEFAKATIKEIVVWPMLRPDIFTGLRGPPKGILLFGPPGTGKTLIGKCIASQSGATFFSISASCLTSKWVGEGEKMVRALFAVARCRQPAVIFIDEIDSLLSQRADGEHDSSRRIKTEFLVQLDGATTARDERVLLVGATNRPQEIDEAARRRLAKRLYVPLPDAAARRCLLERLLAPQSWQLSAEELAAVVERSEGFSGADVTQLCREAALGPIRAVP--DITTVDALQVRPILIQDFAQALQVVRPSVSPRDLDLYVEWNRTFGC 661          
BLAST of fidgetin-like protein 1 vs. Ensembl Sea Lamprey
Match: spast (spastin [Source:NCBI gene;Acc:405851])

HSP 1 Score: 292.738 bits (748), Expect = 1.042e-95
Identity = 152/300 (50.67%), Postives = 223/300 (74.33%), Query Frame = 1
Query:  193 ENLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYGSS 1092
            +NL+  +     L+LNEI+D    + WDDIAG E  KQ +QEIV+LP LRP+LFTG+RAPAKGLLLFGPPG GKT++ K +AS+S +TFF+ISA+SLTSK+VG+GEK+VR +F+VAR LQP++IFIDE+DS+L +R E EHE+SR++KT+FLVE +GV +   +++L +GATNRP E+DEAV RRF KR+Y+ LP  +    I   L    +  ++  +   +   ++GYSG+D+T L K+AA+GPIR L P+Q+ N++  E+  I+  DF ++L+ +K SV++  L+ Y+++N++YG +
Sbjct:  178 KNLRNVDSKLASLILNEIVDSVLSVQWDDIAGQELAKQALQEIVILPSLRPELFTGLRAPAKGLLLFGPPGNGKTMLAKAVASESSATFFNISAASLTSKYVGEGEKLVRALFSVARELQPSIIFIDEVDSVLCERREGEHEASRRLKTEFLVEFDGVQSSGEDRVLVMGATNRPQELDEAVLRRFSKRIYVSLPEEEVPTAIAVSLSWKHANPLSHADRAHLARITEGYSGSDLTALAKDAALGPIRELDPEQVKNMSAHEVRNIRTSDFEDSLKKIKRSVNTVTLEGYIKWNSEYGDT 477          
BLAST of fidgetin-like protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007508.1 (pep scaffold:Pmarinus_7.0:GL478692:23769:36372:1 gene:ENSPMAG00000006768.1 transcript:ENSPMAT00000007508.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 285.419 bits (729), Expect = 9.259e-93
Identity = 144/290 (49.66%), Postives = 217/290 (74.83%), Query Frame = 1
Query:  223 VELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYGSS 1092
             +L++NEI+D    + WDDIAG +  KQ +QEIV+LP LRP+LFTG+R+PA+GLLLFGPPG GKTL+ K +A++  +TFF+ISASS+ SK+VG+GEK++R +F VAR +QP++IFIDEIDSLL +R E EH++SR++KT+FL++ +GV +   +++L +GATNRP E+DEAV RRF KR+Y+ +P   AR+QI+  LL      ++E+E+  +   + GYS +D+T L K+AA+GPIR L  +++ NL   ++  I+  DF E+L+ +K+SV+  +L  YL +N ++G +
Sbjct:  204 AQLIVNEIVDRSPQVKWDDIAGQKVAKQTLQEIVILPSLRPELFTGLRSPARGLLLFGPPGNGKTLLAKAVATECSATFFNISASSMMSKYVGEGEKLMRALFAVAREMQPSIIFIDEIDSLLCERKEGEHDTSRRMKTEFLMQFDGVKSEAEDRVLVMGATNRPQELDEAVLRRFPKRIYVDMPDEAARKQILNHLLSKHGSPLSEKELAVLARTTTGYSASDLTALAKDAALGPIRELSMEEVKNLAPDDVRGIRVSDFKESLKKIKASVNPQNLLIYLNWNKEFGDT 493          
BLAST of fidgetin-like protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003236.1 (pep scaffold:Pmarinus_7.0:GL477724:37443:44438:-1 gene:ENSPMAG00000002921.1 transcript:ENSPMAT00000003236.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 220.705 bits (561), Expect = 3.111e-68
Identity = 133/353 (37.68%), Postives = 210/353 (59.49%), Query Frame = 1
Query:  145 PIKMPKSNKYESIINHENLKQFEPAKVELLLNEILDFGKP-IYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXX-XXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLP---------------PDQLVNLTLKELSP----------------------IKYQDFVEALENVKSSVSSADLDKYLEFNTKYG 1086
            P+K  +SN   S  + E  +  E  K++  L   +   KP + W D+AGLE  K+ ++E V+LP+  P LFTG R P +G+LLFGPPGTGK+ + K +A+++ ++ F S+S+S L SKW+G+ EK+V+ +F +AR  +P++IFIDE+DSL   RNE E E++R+IKT+FLV+M+GVG  +N+ +L +GATN P+ +D A+RRRF KR+YIPLP  +AR  +    L N  L+++E +   + +K++GYSGAD++ + ++A M P+R +                P+  V+  L   SP                      +   D + +L   + +V+S DL K  +F   +G
Sbjct:   87 PVKESQSNDKGSDSDSEG-ENPEKKKMQEQLQSAIVMEKPNVKWSDVAGLEGAKEALKEAVILPIKFPHLFTGKRTPWRGILLFGPPGTGKSYLAKAVATEANNSTFFSVSSSDLVSKWLGESEKLVKNLFEMARQHKPSIIFIDEVDSLCGSRNENESEAARRIKTEFLVQMQGVGV-DNDGILVLGATNIPWTLDSAIRRRFEKRIYIPLPEEQARLSMFKLHLGNTPLSLSETDFRDLGKKTEGYSGADISIVVRDALMQPVRKVQSATHFKRVRGPSRDDPNMFVDDLLTPCSPGDPNAIEMTWMDVPGDKLLEPVVSTSDMLRSLATTRPTVNSEDLKKLQKFTDDFG 437          
BLAST of fidgetin-like protein 1 vs. Ensembl Sea Lamprey
Match: fign (fidgetin [Source:NCBI gene;Acc:553599])

HSP 1 Score: 216.853 bits (551), Expect = 3.174e-64
Identity = 124/302 (41.06%), Postives = 194/302 (64.24%), Query Frame = 1
Query:  193 ENLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGV--GTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAM-GPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYGS 1089
            E LK  EP+ VEL+  E+LD   P++WDD+AGLE  K  ++E ++ PMLRPD+++G     K  LLFGPPG+GK L+GKC+A Q  ++FF +S S+L SK   + EK++  MF VA   QP+VIFID I+++L+Q+ + ++E  R  + + L+ ++ +   +GE+ K+  IG+ + P E+D+A    F + VY+P P   AR QI+ + L   S +++ EE+  IL +++G+SGADM +LC +A M GP++      L + + +    I Y DF  AL  V++SVS  D++ Y E+N +YGS
Sbjct:  450 ERLKNIEPSLVELVTREMLDTSPPVHWDDVAGLEQAKNAMKESLVWPMLRPDVYSGDTL--KVALLFGPPGSGKRLLGKCVAGQMSASFFRVSGSALVSKRAVESEKLIDAMFAVAMCHQPSVIFIDCIEAVLAQQADRDNEVKR-ARARLLLHLDRIRLASGEDPKVALIGSVSHPKELDDATLGWFSRTVYVPPPDGPARHQILLRFLSRRSYSLSPEEMVLILSRTEGFSGADMASLCYKAFMQGPVQGSRTPDLHDPSRQ----IMYTDFDRALRAVRASVSQKDVEMYAEWNKQYGS 744          
BLAST of fidgetin-like protein 1 vs. Ensembl Yeast
Match: YTA6 (Putative ATPase of the CDC48/PAS1/SEC18 (AAA) family; localized to the cortex of mother cells but not to daughter cells; relocalizes from cytoplasm to plasma membrane foci upon DNA replication stress [Source:SGD;Acc:S000005995])

HSP 1 Score: 253.832 bits (647), Expect = 2.821e-78
Identity = 141/300 (47.00%), Postives = 214/300 (71.33%), Query Frame = 1
Query:  223 VELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGV--GTGENE--------KLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYGSS 1092
             E +LNEIL   + +YW+DIAGL + K  ++E V+ P LRPDLF G+R P +G+LLFGPPGTGKT+I K +A++S STFFS+SASSL SK++G+ EK+VR +F +A+ L P++IFIDEIDS+L+ R++ E+ESSR+IKT+ L++   +   T ++E        ++L +GATN P+ ID+A RRRF +++YIPLP  + R   + +L+  +  ++ + + E I E ++G+SG+D+T+L KEAAM PIR+L  D+L+     ++  I+ +DF  AL  +K SVSS  L KY E+++K+GS+
Sbjct:  454 CEQILNEILVTDEKVYWEDIAGLRNAKNSLKEAVVYPFLRPDLFKGLREPVRGMLLFGPPGTGKTMIAKAVATESNSTFFSVSASSLLSKYLGESEKLVRALFYMAKKLSPSIIFIDEIDSMLTARSDNENESSRRIKTELLIQWSSLSSATAQSEDRNNTLDSRVLVLGATNLPWAIDDAARRRFSRKLYIPLPDYETRLYHLKRLMAKQKNSLQDLDYELITEMTEGFSGSDLTSLAKEAAMEPIRDL-GDKLMFADFDKIRGIEIKDFQNALLTIKKSVSSESLQKYEEWSSKFGSN 752          
BLAST of fidgetin-like protein 1 vs. Ensembl Yeast
Match: SAP1 (Putative ATPase of the AAA family; interacts with the Sin1p transcriptional repressor in the two-hybrid system [Source:SGD;Acc:S000000849])

HSP 1 Score: 249.595 bits (636), Expect = 9.365e-76
Identity = 142/319 (44.51%), Postives = 215/319 (67.40%), Query Frame = 1
Query:  193 ENLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRN-ETEHESSRKIKTQFLVEM------------------EGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYGSS 1092
            ++L+  +    + +  EI+  G  ++WDDIAGLES K  ++E V+ P LRPDLF G+R P +G+LLFGPPGTGKT++ + +A++S STFFSISASSLTSK++G+ EK+VR +F +A+ L P++IF+DEIDS++  RN E E+ESSR+IK +FLV+                   +  G  ++ ++L + ATN P+ IDEA RRRFV+R YIPLP  + R     KLL ++   +TE + + +++ ++GYSG+D+T+L K+AAMGP+R+L  D+L+    + + PI   DF  +L  +K SVS   L KY ++ +++GSS
Sbjct:  578 DSLQGVDRQAAKQIFAEIVVHGDEVHWDDIAGLESAKYSLKEAVVYPFLRPDLFRGLREPVRGMLLFGPPGTGKTMLARAVATESHSTFFSISASSLTSKYLGESEKLVRALFAIAKKLSPSIIFVDEIDSIMGSRNNENENESSRRIKNEFLVQWSSLSSAAAGSNKSNTNNSDTNGDEDDTRVLVLAATNLPWSIDEAARRRFVRRQYIPLPEDQTRHVQFKKLLSHQKHTLTESDFDELVKITEGYSGSDITSLAKDAAMGPLRDL-GDKLLETEREMIRPIGLVDFKNSLVYIKPSVSQDGLVKYEKWASQFGSS 895          
BLAST of fidgetin-like protein 1 vs. Ensembl Yeast
Match: VPS4 (AAA-ATPase involved in multivesicular body (MVB) protein sorting; ATP-bound Vps4p localizes to endosomes and catalyzes ESCRT-III disassembly and membrane release; ATPase activity is activated by Vta1p; regulates cellular sterol metabolism [Source:SGD;Acc:S000006377])

HSP 1 Score: 199.904 bits (507), Expect = 1.384e-60
Identity = 131/356 (36.80%), Postives = 212/356 (59.55%), Query Frame = 1
Query:  121 SPSSSAAAPIKMPKSNKYESIINH-ENLKQFEPAKVELLLNEILDFGKP-IYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPP-----------DQLVNLT---------------------LKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYG 1086
            SPS+ + +     K ++ E   N  E+ K+   A    +L+E     KP + W+D+AGLE  K+ ++E V+LP+  P LF G R P  G+LL+GPPGTGK+ + K +A+++ STFFS+S+S L SKW+G+ EK+V+ +F +AR  +P++IFIDE+D+L   R E E E+SR+IKT+ LV+M GVG  +++ +L +GATN P+++D A+RRRF +R+YIPLP   AR  +    + +    +T+E+  ++   ++GYSG+D+  + K+A M PIR +             D+   LT                     LKE   +  +DF++A+++ + +V+  DL K  +F   +G
Sbjct:   85 SPSAGSGSNGGNKKISQEEGEDNGGEDNKKLRGALSSAILSE-----KPNVKWEDVAGLEGAKEALKEAVILPVKFPHLFKGNRKPTSGILLYGPPGTGKSYLAKAVATEANSTFFSVSSSDLVSKWMGESEKLVKQLFAMARENKPSIIFIDEVDALTGTRGEGESEASRRIKTELLVQMNGVGN-DSQGVLVLGATNIPWQLDSAIRRRFERRIYIPLPDLAARTTMFEINVGDTPCVLTKEDYRTLGAMTEGYSGSDIAVVVKDALMQPIRKIQSATHFKDVSTEDDETRKLTPCSPGDDGAIEMSWTDIEADELKE-PDLTIKDFLKAIKSTRPTVNEDDLLKQEQFTRDFG 433          
BLAST of fidgetin-like protein 1 vs. Ensembl Yeast
Match: MSP1 (Highly-conserved N-terminally anchored AAA-ATPase; distributed in the mitochondrial outer membrane and peroxisomes; involved in mitochondrial protein sorting; functions as an extraction engine in local organelle surveillance to remove and initiate degradation of mistargeted proteins, ensuring fidelity of organelle-specific localization of tail-anchored proteins; contains an N-terminal transmembrane domain and C-terminal cytoplasmic ATPase domain [Source:SGD;Acc:S000003260])

HSP 1 Score: 161.77 bits (408), Expect = 8.993e-47
Identity = 101/278 (36.33%), Postives = 169/278 (60.79%), Query Frame = 1
Query:  265 IYWDDIAGLESPKQIIQEIVMLPMLRPDLFTG---IRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNL--PPDQLV--------NLTLKELSPIKYQDFVEALE-NVKSSVSSADLD 1056
            I + DI GL+     + E V+ P++ P++++    ++AP+ G+LL+GPPG GKT++ K +A +S + F SI  SS+  KW G+  K+V  MF++A  LQP +IFIDEIDS L +R+ T+HE +  +K +F+   +G+    N +++ IGATNR  +ID+A  RR  KR  + LP +  R +I+  LLK+  L+  E +++ I + + G+SG+D+  LC+EAA+   +       QL+        + +  ++ P+K +DF + L  +  S++SS  LD
Sbjct:   88 ITFQDIGGLDPLISDLHESVIYPLMMPEVYSNSPLLQAPS-GVLLYGPPGCGKTMLAKALAKESGANFISIRMSSIMDKWYGESNKIVDAMFSLANKLQPCIIFIDEIDSFLRERSSTDHEVTATLKAEFMTLWDGLLN--NGRVMIIGATNRINDIDDAFLRRLPKRFLVSLPGSDQRYKILSVLLKDTKLDEDEFDLQLIADNTKGFSGSDLKELCREAALDAAKEYIKQKRQLIDSGTIDVNDTSSLKIRPLKTKDFTKKLRMDATSTLSSQPLD 362          
BLAST of fidgetin-like protein 1 vs. Ensembl Yeast
Match: CDC48 (AAA ATPase; subunit of polyUb-selective segregase complex involved in ERAD, INM-associated degradation (INMAD), mitotic spindle disassembly, macroautophagy, PMN, ribosome-associated degradation, ribophagy, homotypic ER membrane fusion, SCF complex disassembly, cell wall integrity during heat stress, and telomerase regulation; mobilizes membrane-anchored transcription factors by regulated Ub/proteasome-dependent processing (RUP); human ortholog VCP complements a cdc48 mutant [Source:SGD;Acc:S000002284])

HSP 1 Score: 150.214 bits (378), Expect = 2.642e-40
Identity = 106/319 (33.23%), Postives = 173/319 (54.23%), Query Frame = 1
Query:  265 IYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIR-APAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHE---SSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRR--RFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNL--------------PPDQLVNLTLK--------ELSPIKY---QDFVEALENVKSSVSSADLDKYLEFNTKYGSSLKQ-NNF**NFS 1125
            + WDD+ GL+  K+ ++E V  P+L PD +T    +P+KG+L +GPPGTGKTL+ K +A++  + F S+    L S W G+ E  +R +F  AR   P V+F+DE+DS+   R  +  +   +S ++  Q L EM+G+   +N  +  IGATNRP +ID A+ R  R  + +Y+PLP   AR  I+   L+   L     E+ +I + + G+SGAD+  + + AA   I++                  + V +T +        E+ P+ Y   + F EA++  K SVS A+L +Y  ++ +  +S  Q +NF  NF+
Sbjct:  484 VTWDDVGGLDEIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGPPGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDELDSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKN--VFVIGATNRPDQIDPAILRPGRLDQLIYVPLPDENARLSILNAQLRKTPLE-PGLELTAIAKATQGFSGADLLYIVQRAAKYAIKDSIEAHRQHEAEKEVKVEGEDVEMTDEGAKAEQEPEVDPVPYITKEHFAEAMKTAKRSVSDAELRRYEAYSQQMKASRGQFSNF--NFN 797          

HSP 2 Score: 143.665 bits (361), Expect = 5.064e-38
Identity = 90/227 (39.65%), Postives = 137/227 (60.35%), Query Frame = 1
Query:  265 IYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIR-APAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRR--RFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIR 936
            + +DDI G       I+E+V LP+  P LF  I   P +G+L++GPPGTGKTL+ + +A+++ + FF I+   + SK  G+ E  +R  F  A    PA+IFIDEIDS+  +R++T  E  R++ +Q L  M+G+    N  ++ I ATNRP  ID A+RR  RF + V I +P A  R +++    KN  L   + ++E++  ++ GY GAD+ +LC EAAM  IR
Sbjct:  211 VGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVANETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEIDSIAPKRDKTNGEVERRVVSQLLTLMDGMKARSN--VVVIAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEVLRIHTKNMKL-ADDVDLEALAAETHGYVGADIASLCSEAAMQQIR 434          
BLAST of fidgetin-like protein 1 vs. Ensembl Nematostella
Match: KATNA1 (Katanin p60 ATPase-containing subunit A1 [Source:UniProtKB/TrEMBL;Acc:A7RMS0])

HSP 1 Score: 250.366 bits (638), Expect = 5.948e-79
Identity = 145/362 (40.06%), Postives = 238/362 (65.75%), Query Frame = 1
Query:  112 NDHSPSSSAAAPIKMPKS-------------------NKYESIINHENLKQFEPAK-----VELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQR-NETEHESSRKIKTQFLVEMEGVG----TGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEV-ESILEKSDGYSGADMTNLCKEAAMGPIR----NLPPDQLVNLTLKELS-PIKYQDFVEALENVKSSVSSADLDKYLEFNTKYGSS 1092
            +D+SP+   A P K P+                     +     + +  K+F+P+      VE L  +IL     ++W DIA L   K++++E V+LP+L PD F GIR P +G+L+ GPPGTGKT++ K +A++  +TFF++S+S+LTSK+ G+ EK+VRI+F +AR   P+ IF+DEIDS+ S+R +++EHE+SR++K++ LV+M+GVG     GE ++++ + ATN P+++DEA+RRR  KR+YIPLP+A+ R +++   L+   + ++E+ + E +  K DGYSGAD+TN+C++A+M  +R     L P+++ NL  +EL  P+  +DF  AL+ V  SVS AD+ KY+++ T++GS+
Sbjct:  125 DDYSPAGRHAPPAKRPEKPGDRRAGHSKERKEGEKDKGRKSDEKSEDGEKKFDPSGCDKDLVEALERDILQKNPNVHWADIADLHEAKKLLEEAVVLPLLMPDYFQGIRRPWRGVLMVGPPGTGKTMLAKAVATECGTTFFNVSSSTLTSKYRGESEKLVRILFEMARFYAPSTIFVDEIDSICSRRGSDSEHEASRRVKSELLVQMDGVGGSSDDGETKQVMVLAATNFPWDLDEALRRRLEKRIYIPLPTAEGRLELLKINLRG--VQMSEDVILEEVANKMDGYSGADITNVCRDASMMAMRRRIKGLTPEEIRNLPKEELDLPVNQEDFDMALKKVSKSVSDADIKKYVDWMTEFGST 484          
BLAST of fidgetin-like protein 1 vs. Ensembl Nematostella
Match: EDO35907 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK75])

HSP 1 Score: 219.55 bits (558), Expect = 1.352e-67
Identity = 127/331 (38.37%), Postives = 201/331 (60.73%), Query Frame = 1
Query:  211 EPAKVELLLNEILDFGKP-IYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXX-XXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRN---------------LPPDQLVNLTLKELSP----------------------IKYQDFVEALENVKSSVSSADLDKYLEFNTKYG 1086
            E  K++  LN  +   KP + W DIAGLES K+ ++E V+LP+  P LFTG R P +G+LL+GPPGTGK+ + K +A+++ ++   S+S+S L SKW+G+ E++V+ +F +AR  +P++IFIDE+DSL   R+E E ES+R+IKT+FLV+M+GVG  +N+++L +GATN P+ +D A+RRRF KR+YIPLP   AR ++    L      +  +E++ + +K+DGYSGAD++ + +EA M P+R                L PD++ +  L   SP                      +   D + +L   + +V+  DL K+ +F   +G
Sbjct:  110 ESKKLKGQLNSAIVMEKPNVKWSDIAGLESAKEALKEAVILPIKFPHLFTGKRTPWRGILLYGPPGTGKSYLAKAVATEANNSTFISVSSSDLVSKWLGESERLVKQLFELARENKPSIIFIDEVDSLCGSRSENESESARRIKTEFLVQMQGVGV-DNDQVLVLGATNIPWTLDSAIRRRFEKRIYIPLPEQAARSKMFELHLGGSKTLLGAQEIKQLGQKTDGYSGADISVVVREALMMPVRKVQQATHFKRVRGPSPLNPDEIQDDLLTPCSPGDSGAIEMNWMDVPSDKLLEPGVSMGDMLRSLVTTRPTVNEQDLKKFEKFTADFG 439          
BLAST of fidgetin-like protein 1 vs. Ensembl Nematostella
Match: EDO29570 (Spastin [Source:UniProtKB/Swiss-Prot;Acc:A7T395])

HSP 1 Score: 206.453 bits (524), Expect = 1.079e-61
Identity = 118/335 (35.22%), Postives = 198/335 (59.10%), Query Frame = 1
Query:  109 YNDHSPSSSAAAPIKMPKS---NKYESIINHENLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFG----PPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYGSS 1092
            YN     + +  P  M K    ++ +  I+H  LK  +P    ++++EIL+ G  +++ DIAG+++ K+ +QEIV+LP LRP+L+ G       L+LF     PPG+    + +   + S ++ F   +   +          V+ +  +A +L  ++  IDE+DSLL++R E EHE SR++KT+FLV  +GV     E++L +GATNRP E+D+A  RR VKR++IPLP  + R+ ++ KLL      ++  E++ +   ++ YSG+D+T L ++AA+GPIR+L  DQL ++   E+  I +QDFV +L+ ++ SV    L  Y ++N  YGS+
Sbjct:  207 YNPQVRRTKSTKPAMMAKQSCVDEQKKKISH--LKGIDPKLANIIMDEILESGPAVHFSDIAGVDNAKKALQEIVILPSLRPELWRG----DPTLVLFQVLPYPPGSSHITLPRASTATSFTSCFFSISKRSSLVHPVVASFFVKSLEDLASILTTSLFTIDEVDSLLTERREGEHEHSRRLKTEFLVSFDGVVADPEERILVMGATNRPQELDDAALRRMVKRIHIPLPDKETRKVLLTKLLAKHHNPLSGAEIDRLARMTEHYSGSDLTALARDAALGPIRDLNSDQLKSMAANEVRNITFQDFVNSLQIIRPSVGPETLKAYDDWNRLYGSN 535          
BLAST of fidgetin-like protein 1 vs. Ensembl Nematostella
Match: EDO36214 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJD2])

HSP 1 Score: 183.341 bits (464), Expect = 7.217e-55
Identity = 117/303 (38.61%), Postives = 185/303 (61.06%), Query Frame = 1
Query:  265 IYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNE----TEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLL-------KNESLNITEE---EVESILEKSDGYSGADMTNLCKEAAMGPIRNL--------------PPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYGS 1089
            + WDDI GL++ K++++E V+ P+  P LFTGI +P KGLLL+GPPGTGKTL+ K +A++  +TFF+ISASS+ SKW GD EK+VR++F +AR   P+ IF+DE++SL+SQR       EHE S ++KT+ LV+M+G+    ++ +  + A+N P+E+D A+ RR  KR+ + LP+ +AR+ ++ + L         + + I  E   ++ + + +++GYSG+D+  L KEAAM  +R +              P    V L      P++  D   AL + K S  +   DKY E+  +Y S
Sbjct:   34 VRWDDIIGLDAAKRLVKEAVVYPIKYPQLFTGILSPWKGLLLYGPPGTGKTLLAKAVATECNTTFFNISASSIVSKWRGDSEKLVRVLFELARFHAPSTIFLDELESLMSQRGTGGGGAEHEGSLRMKTELLVQMDGLAR-SDDLVFLLAASNLPWELDHAMLRRLEKRILVDLPTLEARKAMLMQNLPPVISASDGKGVEIRTEIDYDMLAKVTRAEGYSGSDIKLLAKEAAMRKVRKIFDILEGHHAGRSTQPRTWCVVLP----DPVETSDVEAALAHTKPSARTLT-DKYREWQKEYES 330          
BLAST of fidgetin-like protein 1 vs. Ensembl Nematostella
Match: EDO31428 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXZ8])

HSP 1 Score: 169.088 bits (427), Expect = 4.541e-50
Identity = 108/281 (38.43%), Postives = 161/281 (57.30%), Query Frame = 1
Query:  328 LPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQP-AVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGT-GENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNL--------------PPDQ-----LVNLTLKELSPIKY-------QDFVEALENVKSSVSSADLDKYLEFNTKYG 1086
            +P+  P LFTG R P + +LL+GPPGTGKT + + +AS+  STF+S+S++ L S WVG+ EK++R +F  AR  +  +VIFIDEIDS+  +R+  E E +R++KT+ L +MEG  +   + +   + ATN P+E+D A  RRF KR+YIPLP   AR  +I   L      +TE +   + EK+ G+SG+D+ N   +A   P+R L              PP        V   LK+L P K        +DF+ +L +  S+++  DLDK+  F   YG
Sbjct:    1 MPLQFPHLFTGGRKPWRRVLLYGPPGTGKTRLAQAVASEVNSTFYSVSSADLISSWVGESEKLIRELFHDARKREGRSVIFIDEIDSVCRKRSTREEEHTRRVKTELLNQMEGTDSLSLSGQYFLLCATNCPWELDSAFIRRFQKRIYIPLPEQDARISLIKMHLGTTPACLTERDWCVLGEKTRGFSGSDLANCTSDAVFEPVRELQRSTHWKQQAGKSAPPCSEGEPGCVTCLLKDLPPQKVTPRPVVLEDFIRSLSHNGSTITDEDLDKFTVFTKSYG 281          
BLAST of fidgetin-like protein 1 vs. Ensembl Medaka
Match: fignl1 (fidgetin like 1 [Source:NCBI gene;Acc:101168425])

HSP 1 Score: 364.77 bits (935), Expect = 3.832e-121
Identity = 193/345 (55.94%), Postives = 251/345 (72.75%), Query Frame = 1
Query:   52 RGVRSEFIAPVIGNKTDQTYNDHSPSSSAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYG 1086
            RG  S+F++P+   + +   N  S SS+   PI              E LK FEP  +EL+++EI+D G PI WDDIAGLE  K  I+EIV+ PMLRPD+FTG+R P KG+LLFGPPGTGKTLIGKCIA QS +TFFSISASSLTSKWVG+GEKMVR +F +A   QPAVIFIDEIDSLLSQR + EH+SSR+IKT+FLV+++G  T   +++L +GATNRP EIDEA RRR  KR+YIPLP A ARRQI++ L+  E   + E E+ES++  ++G+SGADMT LC+EAA+GPIR++    +  +T  ++ PI + DF EAL+ V+ SVS+ DL+ Y E+N  +G
Sbjct:  302 RGTFSKFVSPI--PRQEDEDNAASQSSTQEPPIL------------DERLKNFEPKIIELIMSEIMDHGPPIGWDDIAGLEFAKNTIKEIVVWPMLRPDIFTGLRGPPKGILLFGPPGTGKTLIGKCIACQSGATFFSISASSLTSKWVGEGEKMVRALFAIAGCHQPAVIFIDEIDSLLSQRTDGEHDSSRRIKTEFLVQLDGAATASEDRILVVGATNRPQEIDEAARRRLAKRLYIPLPEAAARRQIVFNLMAQEKSQLREPELESVVRATEGFSGADMTQLCREAALGPIRSIQLSDIATITADQVRPILFSDFQEALKTVRPSVSAKDLELYEEWNQTFG 632          
BLAST of fidgetin-like protein 1 vs. Ensembl Medaka
Match: spast (spastin [Source:NCBI gene;Acc:101167644])

HSP 1 Score: 299.286 bits (765), Expect = 1.170e-97
Identity = 151/302 (50.00%), Postives = 226/302 (74.83%), Query Frame = 1
Query:  187 NHENLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYGSS 1092
            + +N K  +     L++NEI+D G  + +DDIAG    KQ +QEIV+LP LRP+LFTG+RAPA+GLLLFGPPG GKT++ K +A++S +TFF+ISA+SLTSK+VG+GEK+VR +F VAR LQP+VIFIDE+DSLL +R E EH++SR++KT+FL+E +GV +G ++++L +GATNRP E+DEA+ RRF KR+Y+ LP  K R  ++  LL      +   ++  + + + G+SG+D+T+L K+AA+GPIR L PDQ+ N++  E+  I+ +DF ++L+ +K +VS A LD Y ++N ++G +
Sbjct:  170 DMKNFKNVDSKLANLIMNEIVDRGSSVCFDDIAGQARAKQALQEIVILPALRPELFTGLRAPARGLLLFGPPGNGKTMLAKAVAAESNATFFNISAASLTSKYVGEGEKLVRALFAVARELQPSVIFIDEVDSLLCERREGEHDASRRLKTEFLIEFDGVQSGGDDRVLVMGATNRPQELDEAILRRFAKRIYVSLPDEKTRFTLLKNLLGKHGNPLGTNDITYLSKVTAGFSGSDLTSLAKDAALGPIRELGPDQVRNMSASEVRNIQKKDFEDSLKRIKPTVSPATLDMYAKWNKEFGDT 471          
BLAST of fidgetin-like protein 1 vs. Ensembl Medaka
Match: katna1 (katanin catalytic subunit A1 [Source:NCBI gene;Acc:101169256])

HSP 1 Score: 241.506 bits (615), Expect = 4.304e-75
Identity = 139/306 (45.42%), Postives = 209/306 (68.30%), Query Frame = 1
Query:  223 VELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNET-EHESSRKIKTQFLVEMEGV-GTGENEK----LLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVES------ILEKSDGYSGADMTNLCKEAAMGPIRN----LPPDQLVNLTLKELS-PIKYQDFVEALENVKSSVSSADLDKYLEFNTKYGS 1089
            VE L  +I+     + WDDIA LE  K++++E V+LPM  P+ F GIR P KG+L+ GPPGTGKTL+ K +A++ ++TFF++S+S+LTSK+ G+ EK+VR++F +AR   P  IFIDEIDS+ S+R  + EHE+SR++K + LV+M+GV G  ENE     ++ + ATN P++IDEA+RRR  KR+YIPLPS   R +++        +N+ E E+ S      I E+ DGYSGAD+TN+C++A++  +R     L PD++ NL+  E+  P   +DF  AL+ V  SVS++DL+KY ++  ++GS
Sbjct:  192 VEALERDIISQNPNVKWDDIADLEDAKKLLKEAVVLPMWMPEFFKGIRRPWKGVLMVGPPGTGKTLLAKAVATECRTTFFNVSSSTLTSKYRGESEKLVRLLFEMARFYAPTTIFIDEIDSMCSRRGTSEEHEASRRVKAELLVQMDGVGGASENEDPSKMVMVLAATNFPWDIDEALRRRLEKRIYIPLPSTTGRVELL-------RINLRELELASNVVLDKIAEQMDGYSGADITNVCRDASLMAMRRRIEGLTPDEIRNLSRDEMHMPTTMEDFESALKKVSKSVSASDLEKYEKWIEEFGS 490          
BLAST of fidgetin-like protein 1 vs. Ensembl Medaka
Match: katnal1 (katanin p60 ATPase-containing subunit A-like 1 [Source:NCBI gene;Acc:101163120])

HSP 1 Score: 239.195 bits (609), Expect = 3.120e-74
Identity = 135/300 (45.00%), Postives = 210/300 (70.00%), Query Frame = 1
Query:  223 VELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNET-EHESSRKIKTQFLVEMEGVGTGE-----NEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIR----NLPPDQLVNLTLKELS-PIKYQDFVEALENVKSSVSSADLDKYLEFNTKYGS 1089
            VE L  +I+     I+W+DIA LE  K++++E V+LPM  PD F GIR P KG+L+ GPPGTGKT++ K +A++  +TFF++S+S+LTSK+ G+ EK+VR++F +AR   PA IFIDEIDS+  +R  + EHE+SR++K++ LV+M+GVG  +     ++ ++ + ATN P++IDEA+RRR  KR+YIPLP+A  R +++   LK   L   + E++ I +K +GYSGAD+TN+C++A+M  +R     L P+++  L+  EL  P+  +DF E L+ +  SVS+ADL+KY  +  ++GS
Sbjct:  188 VESLERDIVSRNPNIHWEDIADLEDAKKLLREAVVLPMWMPDFFKGIRRPWKGVLMIGPPGTGKTMLAKAVATECGTTFFNVSSSTLTSKYRGESEKLVRLLFEMARFYAPATIFIDEIDSICGRRGTSDEHEASRRVKSELLVQMDGVGGAQENDDPSKMVMVLAATNFPWDIDEALRRRLEKRIYIPLPTAVGRVELLKINLKEVEL-APDVELDLIAQKIEGYSGADITNVCRDASMMAMRRRIHGLSPEEIRALSKDELQMPVTMEDFNETLKKISKSVSAADLEKYEAWMAEFGS 486          
BLAST of fidgetin-like protein 1 vs. Ensembl Medaka
Match: ENSORLT00000001882.2 (vacuolar protein sorting-associated protein 4B [Source:NCBI gene;Acc:101171319])

HSP 1 Score: 224.942 bits (572), Expect = 7.628e-70
Identity = 120/275 (43.64%), Postives = 187/275 (68.00%), Query Frame = 1
Query:  265 IYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXX-XXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYG 1086
            I W+D+AGLE  K+ ++E V+LP+  P LFTG R P +G+LLFGPPGTGK+ + K +A+++ ++ F S+S+S L SKW+G+ EK+V+ +F +AR  +P++IFIDEIDSL   R+E E E++R+IKT+FLV+M+GVG  +NE +L +GATN P+ +D A+RRRF KR+YIPLP   AR  +    L +   N+TE +  ++  K+DGYSGAD++ + ++A M P+R           ++  +  K  D + ++ + K +V+  DL+K  +F   +G
Sbjct:  122 IKWNDVAGLEGAKEALKEAVILPIKFPHLFTGKRTPWRGILLFGPPGTGKSYLAKAVATEANNSTFFSVSSSDLVSKWLGESEKLVKNLFALAREHRPSIIFIDEIDSLCGSRSENESEAARRIKTEFLVQMQGVGN-DNEGILVLGATNIPWTLDSAIRRRFEKRIYIPLPEEHARSSMFKLHLGSTPNNLTEADFVTLGRKTDGYSGADISVIVRDALMQPVRR----------VQSATHFKKADMLRSVGSTKPTVNEQDLEKLKKFTEDFG 385          
BLAST of fidgetin-like protein 1 vs. Planmine SMEST
Match: SMESG000045800.1 (SMESG000045800.1)

HSP 1 Score: 684.485 bits (1765), Expect = 0.000e+0
Identity = 352/353 (99.72%), Postives = 353/353 (100.00%), Query Frame = 1
Query:   52 RGVRSEFIAPVIGNKTDQTYNDHSPSSSAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYGSSLKQNNF 1110
            RGVRSEFIAPVIGNKTDQTYNDHSPSSSAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIASQSKSTFFSISASSLTSKWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEE+ESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYGSSLKQNNF
Sbjct:  193 RGVRSEFIAPVIGNKTDQTYNDHSPSSSAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIASQSKSTFFSISASSLTSKWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEELESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYGSSLKQNNF 545          
BLAST of fidgetin-like protein 1 vs. Planmine SMEST
Match: SMESG000070700.1 (SMESG000070700.1)

HSP 1 Score: 273.092 bits (697), Expect = 7.627e-87
Identity = 153/346 (44.22%), Postives = 229/346 (66.18%), Query Frame = 1
Query:   73 IAPVIGNKTDQTYNDHSPSSSAAAPIKMPKSNK----YESIINHEN----LKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADLDKYLEFNTKYG 1086
            I P +    ++ +     S + + P K    +K     + +IN E+    LK  +   VE +LNE+LD  K + ++DIAG E+ KQ + E V+ P LRP+LFTG+R+PAKG+LLFGPPG GKTL+ K +A++S+  FF+ISA+SL SKWVG+GEKMVR +F VA  + P+VIF+DE+DSLLS RN  +   SR++ TQFL E++G  T    K+L + ATNRP E+D+A  RRF K++YI +P A +R+ +  KLL  ++  + + ++E ++E + GYS +D+TNL K AAM PIR L  +Q+ ++T+  + P+K  DF+ AL+ +K SV    L KY  +N+++G
Sbjct:  196 IKPSVRTPVNRPFTTQGRSMTTSGPPKPQVDDKPVGGTQKVINKESIWKTLKNVDKECVETILNEVLD-SKVVKFEDIAGNETAKQCLLETVIYPKLRPELFTGLRSPAKGILLFGPPGNGKTLLAKAVANESQCVFFNISAASLMSKWVGEGEKMVRALFAVAHYVSPSVIFLDEVDSLLSARNSDDKSVSRRMLTQFLQEIDGAATDGEGKVLVMAATNRPDELDDAALRRFQKKIYIKMPEASSRKFLFKKLLTQQNTKLKDNDIEKLVELTKGYSSSDLTNLAKTAAMIPIRELSFEQICSVTVDSMRPLKLNDFMLALKQIKPSVPPQSLLKYDRWNSQFG 540          
BLAST of fidgetin-like protein 1 vs. Planmine SMEST
Match: SMESG000069747.1 (SMESG000069747.1)

HSP 1 Score: 220.705 bits (561), Expect = 1.968e-67
Identity = 123/324 (37.96%), Postives = 224/324 (69.14%), Query Frame = 1
Query:  181 IINHENLKQFEPA------KVELLLNEILDFGKPIYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXXXXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNE-TEHESSRKIKTQFLVEMEGVGTGENEK------LLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEE-EVESILEKSDGYSGADMTNLCKEAAMGPIRNLPPDQLVNLTLKELS------PIKYQDFVEALENVKSSVSSADLDKYLEFNTKYGSS 1092
            +I  + +K++ P+       +++L  +I+     + WDDIA L+  K++++E ++LP+L P+ FTG+R P KG+L+FGPPGTGKTL+ K +A++ ++TFFS+++SSLTSKW G+ EK++RI+F +AR   P+ IFIDEID++ S+R++ + +ES+R++ ++ L++++G+ +   ++      +  +GATN P+++DEA+RRR  KR+YIPLP    RR ++   LK  +++++++ ++++I EK  GYSG+D+T +C++AAM  +R +   + V   LK+L+      PI  +DF  ++  +  SVS AD++KY ++  ++G++
Sbjct:  152 VIQKKEIKKYVPSFPAEQGLIDILEKDIVQRNLNVNWDDIADLDEAKRLLKEAIVLPLLLPNYFTGLRKPWKGVLMFGPPGTGKTLLAKAVATECQTTFFSVTSSSLTSKWRGESEKLIRILFDMARFYAPSTIFIDEIDAIGSKRDDGSGNESNRRVMSELLIQIDGISSSNGQEYDATKSVTILGATNLPWDLDEALRRRLEKRIYIPLPGGVGRRVLLDINLK--AIDLSDDVDLDAIAEKLTGYSGSDITQVCRDAAMMQLRRVVEGKSVE-ELKKLAAGDTTLPISMEDFETSVSRINKSVSQADIEKYEKWMAEFGAT 472          
BLAST of fidgetin-like protein 1 vs. Planmine SMEST
Match: SMESG000075482.1 (SMESG000075482.1)

HSP 1 Score: 212.231 bits (539), Expect = 1.873e-64
Identity = 139/399 (34.84%), Postives = 229/399 (57.39%), Query Frame = 1
Query:   16 DSL*LKTIYYFSRGVR-SEFIAPVIGNKTDQTYNDHSPSSSAAAPIKMPKSNKYESIINHENLKQFEPAKVELLLNEILDFGKP-IYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXX-XXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNE--SLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNLP---------------PDQLVNLTLKELSP----------------------IKYQDFVEALENVKSSVSSADLDKYLEFNTKYG 1086
            DS+  K I Y  R  +  EF+    G K       H  S +        K+   +S    ++ K  E  K++  LN+ +   KP ++WDD+AGL + K+ ++E V+LP+  P LFTG R P KG+LL+GPPGTGK+ + K +A+++ ++ F S+S+S+L SKW+G+ EK+V+ +F +AR  +P++IFIDEIDSL S R + + ES+++IKT+FLV+M+GV + +N+ +L + ATN P+ +D A+RRRF KR+YI LP A AR ++    + N+     +T+++   + ++S+GYSGAD++   ++A M P+R +                P+ +V+  L   SP                      +   D ++AL   K +V+  DL+K ++F   +G
Sbjct:   54 DSIRAKCIQYLERAEKLKEFLNAEGGGK-----KKHEKSLAGEGANDKKKNGDSDS----DSEKDVEKKKLQSQLNDAIVVEKPNVHWDDVAGLLNAKEALKEAVILPIKFPHLFTGKRTPWKGILLYGPPGTGKSYLAKAVATEANNSTFFSVSSSNLVSKWLGESEKLVKNLFHLAREKKPSIIFIDEIDSLCSNRGDNDSESAKRIKTEFLVQMQGV-SSDNDNVLILAATNIPWALDSAIRRRFEKRIYIALPEAPARTEMFKLSMGNKPGQHTLTQQDFVELGKRSEGYSGADISIAVRDALMFPVRKVQTATHFKRARGPSPRNPELIVDDLLTPCSPGDPDAIAMNWQSMEGEKLLEPAVTLNDMMKALARNKPTVNQKDLEKLIQFTNDFG 442          
BLAST of fidgetin-like protein 1 vs. Planmine SMEST
Match: SMESG000009448.1 (SMESG000009448.1)

HSP 1 Score: 207.608 bits (527), Expect = 9.788e-63
Identity = 128/315 (40.63%), Postives = 200/315 (63.49%), Query Frame = 1
Query:  265 IYWDDIAGLESPKQIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIXXXXXXXXX-XXXXXXXXXXWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRNETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTNLCKEAAMGPIRNL--------------------------------PPDQ-LVNLTLKELSP-------IKYQDFVEALENVKSSVSSADLDKYLEFNTKYG 1086
            I+W+DIAGL   K+ +QE V+LP+  PDLFTG R P +G+LL+GPPGTGK+ + K +A++++++ F +IS+S L SKW+G+ EK+V+ +F +AR  +P++IFIDEIDS+   R+E+E ES+R+IKT+FLV+MEGVG  +N+K+L + ATN P+ +D A+RRRF KR+YIPLP   AR  +    L +    I+E ++ S+ ++++GYSG+D+ NL +EA M P++ +                                P D+  V +T K++         +   D ++AL + K +V+S DL K  EF  ++G
Sbjct:  119 IHWNDIAGLHGAKEALQEAVILPLKFPDLFTGKRKPWRGILLYGPPGTGKSYLAKAVATEAENSTFFAISSSDLVSKWLGESEKLVKNLFELAREHRPSIIFIDEIDSMCGSRSESESESARRIKTEFLVQMEGVG-AQNDKVLVLAATNIPWALDSAIRRRFEKRIYIPLPDLGARALLFRLSLGDTPNTISEADINSLSKRTEGYSGSDIANLVREAIMQPVKKVMSATHFKKVSKEHANKLRPNNKNITEYWTPCSPGDKAAVEMTWKDIKAEQLLEPVVNMSDMIKALGSNKPTVNSNDLKKLQEFTEEFG 432          
The following BLAST results are available for this feature:
BLAST of fidgetin-like protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FIGNL12.007e-11861.41fidgetin like 1 [Source:HGNC Symbol;Acc:HGNC:13286... [more]
FIGNL12.007e-11861.41fidgetin like 1 [Source:HGNC Symbol;Acc:HGNC:13286... [more]
FIGNL12.007e-11861.41fidgetin like 1 [Source:HGNC Symbol;Acc:HGNC:13286... [more]
FIGNL12.007e-11861.41fidgetin like 1 [Source:HGNC Symbol;Acc:HGNC:13286... [more]
FIGNL12.007e-11861.41fidgetin like 1 [Source:HGNC Symbol;Acc:HGNC:13286... [more]
back to top
BLAST of fidgetin-like protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
figl-14.885e-9054.69Fidgetin-like protein 1 [Source:UniProtKB/Swiss-P... [more]
figl-14.885e-9054.69Fidgetin-like protein 1 [Source:UniProtKB/Swiss-P... [more]
spas-14.029e-7740.92Probable spastin homolog spas-1 [Source:UniProtKB... [more]
spas-13.193e-7646.02Probable spastin homolog spas-1 [Source:UniProtKB... [more]
vps-43.434e-6539.31Related to yeast Vacuolar Protein Sorting factor ... [more]
back to top
BLAST of fidgetin-like protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fign2.475e-9350.68gene:FBgn0031519 transcript:FBtr0077603[more]
Fign2.475e-9350.68gene:FBgn0031519 transcript:FBtr0331372[more]
spas9.605e-8447.99gene:FBgn0039141 transcript:FBtr0445311[more]
spas3.511e-8347.99gene:FBgn0039141 transcript:FBtr0445310[more]
spas1.262e-8147.99gene:FBgn0039141 transcript:FBtr0321260[more]
back to top
BLAST of fidgetin-like protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fignl12.435e-12055.20fidgetin-like 1 [Source:ZFIN;Acc:ZDB-GENE-030131-1... [more]
fignl12.435e-12055.20fidgetin-like 1 [Source:ZFIN;Acc:ZDB-GENE-030131-1... [more]
spast1.222e-9952.00spastin [Source:NCBI gene;Acc:405851][more]
fign1.479e-7539.18fidgetin [Source:NCBI gene;Acc:553599][more]
fign1.603e-7539.18fidgetin [Source:NCBI gene;Acc:553599][more]
back to top
BLAST of fidgetin-like protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fignl18.246e-12056.07fidgetin-like 1 [Source:NCBI gene;Acc:100124890][more]
spast9.156e-9647.73spastin [Source:NCBI gene;Acc:549207][more]
spast2.007e-9547.73spastin [Source:NCBI gene;Acc:549207][more]
spast2.467e-9248.04spastin [Source:NCBI gene;Acc:549207][more]
spast7.786e-8447.67spastin [Source:NCBI gene;Acc:549207][more]
back to top
BLAST of fidgetin-like protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fignl11.971e-12055.20fidgetin-like 1 [Source:MGI Symbol;Acc:MGI:1890648... [more]
Fignl11.971e-12055.20fidgetin-like 1 [Source:MGI Symbol;Acc:MGI:1890648... [more]
Fignl11.971e-12055.20fidgetin-like 1 [Source:MGI Symbol;Acc:MGI:1890648... [more]
Fignl11.971e-12055.20fidgetin-like 1 [Source:MGI Symbol;Acc:MGI:1890648... [more]
Spast1.054e-9651.00spastin [Source:MGI Symbol;Acc:MGI:1858896][more]
back to top
BLAST of fidgetin-like protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6GX84|FIGL1_RAT4.799e-12055.75Fidgetin-like protein 1 OS=Rattus norvegicus OX=10... [more]
sp|Q6DDU8|FIGL1_XENLA8.531e-12062.42Fidgetin-like protein 1 OS=Xenopus laevis OX=8355 ... [more]
sp|Q8BPY9|FIGL1_MOUSE1.379e-11955.20Fidgetin-like protein 1 OS=Mus musculus OX=10090 G... [more]
sp|A4IHT0|FIGL1_XENTR4.369e-11956.07Fidgetin-like protein 1 OS=Xenopus tropicalis OX=8... [more]
sp|Q6PIW4|FIGL1_HUMAN9.639e-11861.41Fidgetin-like protein 1 OS=Homo sapiens OX=9606 GN... [more]
back to top
BLAST of fidgetin-like protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3FGH41.522e-12958.69Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A1S3IGH92.097e-12859.48fidgetin-like protein 1 OS=Lingula unguis OX=7574 ... [more]
A0A1S3JHD23.126e-12859.48fidgetin-like protein 1 OS=Lingula unguis OX=7574 ... [more]
A0A3P7Y3473.539e-12858.09AAA domain-containing protein OS=Schistosoma matth... [more]
A0A183ND793.861e-12858.09AAA domain-containing protein OS=Schistosoma matth... [more]
back to top
BLAST of fidgetin-like protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spast7.072e-10049.69spastin [Source:NCBI gene;Acc:405851][more]
fignl12.199e-9849.42fidgetin-like 1 [Source:ZFIN;Acc:ZDB-GENE-030131-1... [more]
katna14.615e-7743.56katanin catalytic subunit A1 [Source:NCBI gene;Acc... [more]
katnal18.870e-7445.00katanin catalytic subunit A1 like 1 [Source:NCBI g... [more]
katnal11.133e-7244.20katanin catalytic subunit A1 like 1 [Source:NCBI g... [more]
back to top
BLAST of fidgetin-like protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fignl12.117e-11855.49fidgetin-like 1 [Source:ZFIN;Acc:ZDB-GENE-030131-1... [more]
spast1.042e-9550.67spastin [Source:NCBI gene;Acc:405851][more]
ENSPMAT00000007508.19.259e-9349.66pep scaffold:Pmarinus_7.0:GL478692:23769:36372:1 g... [more]
ENSPMAT00000003236.13.111e-6837.68pep scaffold:Pmarinus_7.0:GL477724:37443:44438:-1 ... [more]
fign3.174e-6441.06fidgetin [Source:NCBI gene;Acc:553599][more]
back to top
BLAST of fidgetin-like protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
YTA62.821e-7847.00Putative ATPase of the CDC48/PAS1/SEC18 (AAA) fami... [more]
SAP19.365e-7644.51Putative ATPase of the AAA family; interacts with ... [more]
VPS41.384e-6036.80AAA-ATPase involved in multivesicular body (MVB) p... [more]
MSP18.993e-4736.33Highly-conserved N-terminally anchored AAA-ATPase;... [more]
CDC482.642e-4033.23AAA ATPase; subunit of polyUb-selective segregase ... [more]
back to top
BLAST of fidgetin-like protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
KATNA15.948e-7940.06Katanin p60 ATPase-containing subunit A1 [Source:... [more]
EDO359071.352e-6738.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO295701.079e-6135.22Spastin [Source:UniProtKB/Swiss-Prot;Acc:A7T395][more]
EDO362147.217e-5538.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO314284.541e-5038.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of fidgetin-like protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fignl13.832e-12155.94fidgetin like 1 [Source:NCBI gene;Acc:101168425][more]
spast1.170e-9750.00spastin [Source:NCBI gene;Acc:101167644][more]
katna14.304e-7545.42katanin catalytic subunit A1 [Source:NCBI gene;Acc... [more]
katnal13.120e-7445.00katanin p60 ATPase-containing subunit A-like 1 [So... [more]
ENSORLT00000001882.27.628e-7043.64vacuolar protein sorting-associated protein 4B [So... [more]
back to top
BLAST of fidgetin-like protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000045800.10.000e+099.72SMESG000045800.1[more]
SMESG000070700.17.627e-8744.22SMESG000070700.1[more]
SMESG000069747.11.968e-6737.96SMESG000069747.1[more]
SMESG000075482.11.873e-6434.84SMESG000075482.1[more]
SMESG000009448.19.788e-6340.63SMESG000009448.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011181 ID=SMED30011181|Name=fidgetin-like protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1134bp
GTGATTGAAAGATGTGATTCTCTATAATTAAAAACCATATATTATTTCAG
CAGAGGGGTGCGAAGCGAATTTATTGCGCCCGTCATAGGCAATAAAACAG
ATCAAACGTATAATGACCATTCTCCATCATCAAGTGCCGCCGCTCCAATA
AAGATGCCAAAAAGCAATAAATATGAATCCATAATTAACCATGAAAATTT
AAAGCAATTTGAACCCGCCAAAGTGGAATTGCTTCTTAATGAAATTTTGG
ATTTTGGAAAGCCAATTTACTGGGATGACATAGCCGGCCTTGAATCTCCT
AAGCAAATTATTCAGGAAATTGTTATGTTGCCAATGCTAAGACCTGATCT
TTTCACTGGAATAAGGGCTCCTGCTAAAGGATTGCTGCTATTCGGACCCC
CGGGTACTGGAAAAACTCTTATAGGAAAATGTATTGCATCGCAAAGTAAA
TCAACATTTTTCTCAATAAGTGCATCTTCATTAACTTCAAAATGGGTTGG
TGATGGAGAAAAAATGGTTCGCATAATGTTTACAGTAGCTCGGTTGTTAC
AACCAGCAGTTATTTTCATTGATGAAATAGATTCACTACTTAGTCAAAGA
AATGAAACTGAGCACGAATCGAGTCGGAAAATCAAAACTCAATTCCTTGT
AGAAATGGAAGGTGTTGGTACTGGTGAAAATGAAAAACTGTTATTCATTG
GTGCTACTAACCGCCCATATGAAATCGACGAAGCGGTTCGCCGTAGATTT
GTAAAGCGAGTATATATTCCTCTTCCTTCAGCAAAAGCTCGTAGACAAAT
AATATATAAACTTTTAAAGAATGAATCTTTAAACATAACTGAAGAAGAAG
TAGAATCGATTTTAGAAAAATCTGATGGTTATTCTGGAGCTGATATGACA
AATCTATGTAAAGAAGCTGCCATGGGCCCAATTAGAAATTTACCTCCTGA
TCAATTAGTCAATCTTACGTTAAAGGAGTTATCGCCGATAAAATATCAAG
ATTTTGTAGAAGCATTAGAAAATGTTAAGTCATCCGTATCCTCAGCAGAT
CTCGATAAATATTTAGAGTTCAATACAAAATATGGCAGCTCCCTAAAGCA
AAATAATTTCTAATAAAATTTTTCAACAAAAAAA
back to top

protein sequence of SMED30011181-orf-1

>SMED30011181-orf-1 ID=SMED30011181-orf-1|Name=SMED30011181-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=320bp
MPKSNKYESIINHENLKQFEPAKVELLLNEILDFGKPIYWDDIAGLESPK
QIIQEIVMLPMLRPDLFTGIRAPAKGLLLFGPPGTGKTLIGKCIASQSKS
TFFSISASSLTSKWVGDGEKMVRIMFTVARLLQPAVIFIDEIDSLLSQRN
ETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEIDEAVRRRFV
KRVYIPLPSAKARRQIIYKLLKNESLNITEEEVESILEKSDGYSGADMTN
LCKEAAMGPIRNLPPDQLVNLTLKELSPIKYQDFVEALENVKSSVSSADL
DKYLEFNTKYGSSLKQNNF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000070intestinal phagocyte
PLANA:0000429neoblast
PLANA:0002089reproductive organ
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR041569AAA_lid_3
IPR003593AAA+_ATPase
IPR015415Vps4_C
IPR003959ATPase_AAA_core
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0000287magnesium ion binding
GO:0008568microtubule-severing ATPase activity
GO:0016787hydrolase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0000228nuclear chromosome
GO:0005634nucleus
GO:0005737cytoplasm
GO:0070062extracellular exosome
Vocabulary: biological process
TermDefinition
GO:0001649osteoblast differentiation
GO:0010569regulation of double-strand break repair via homologous recombination
GO:0031122cytoplasmic microtubule organization
GO:0033687osteoblast proliferation
GO:0043066negative regulation of apoptotic process
GO:0046034ATP metabolic process
GO:0051726regulation of cell cycle
GO:0071479cellular response to ionizing radiation
GO:2001243negative regulation of intrinsic apoptotic signaling pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003593AAA+ ATPase domainSMARTSM00382AAA_5coord: 73..209
e-value: 6.7E-19
score: 78.8
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 37..307
e-value: 5.4E-108
score: 362.5
NoneNo IPR availableGENE3DG3DSA:1.10.8.60coord: 208..291
e-value: 5.4E-108
score: 362.5
NoneNo IPR availablePANTHERPTHR23074AAA ATPASEcoord: 12..312
NoneNo IPR availablePANTHERPTHR23074:SF17FIDGETIN-LIKE PROTEIN 1coord: 12..312
NoneNo IPR availableCDDcd00009AAAcoord: 71..207
e-value: 9.00039E-23
score: 90.2831
NoneNo IPR availableCDDcd18038DEXXQc_Helz-likecoord: 50..88
e-value: 0.00452971
score: 35.6728
IPR003959ATPase, AAA-type, corePFAMPF00004AAAcoord: 77..207
e-value: 4.4E-38
score: 130.7
IPR041569AAA ATPase, AAA+ lid domainPFAMPF17862AAA_lid_3coord: 233..262
e-value: 2.4E-8
score: 33.7
IPR015415Vps4 oligomerisation, C-terminalPFAMPF09336Vps4_Ccoord: 274..311
e-value: 4.7E-8
score: 32.9
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 36..304