Kinesin-like protein KIF26A

Overview
NameKinesin-like protein KIF26A
Smed IDSMED30011180
Length (bp)4701
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Kinesin-like protein KIF26A (SMED30011180) t-SNE clustered cells

Violin plots show distribution of expression levels for Kinesin-like protein KIF26A (SMED30011180) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Kinesin-like protein KIF26A (SMED30011180) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Kinesin-like protein KIF26A (SMED30011180) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011180

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30011180SMESG000051203.1 Contig2978newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30011180SMESG000051203.1 Contig2978uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30011180SMESG000061090.1 Contig2978newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30011180SMESG000061090.1 Contig2978uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynx progenitor cellSMED30011180SMESG000051203.1 SMED30011180smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30011180SMESG000051203.1 dd_Smed_v4_8860_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30011180SMESG000051203.1 dd_Smed_v4_8860_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011180SMESG000051203.1 dd_Smed_v4_8860_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30011180SMESG000051203.1 dd_Smed_v4_8860_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30011180SMESG000051203.1 dd_Smed_v4_8860_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30011180SMESG000051203.1 dd_Smed_v4_8860_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30011180SMESG000051203.1 dd_Smed_v4_8860_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011180SMESG000051203.1 Contig53649newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011180SMESG000051203.1 Contig53649uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynx musculatureSMED30011180SMESG000051203.1 dd_Smed_v4_8860_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Kinesin-like protein KIF26A vs. Ensembl Human
Match: KIF26A (kinesin family member 26A [Source:HGNC Symbol;Acc:HGNC:20226])

HSP 1 Score: 184.111 bits (466), Expect = 6.058e-46
Identity = 129/388 (33.25%), Postives = 197/388 (50.77%), Query Frame = 3
Query:  600 NLFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKN-NVCDLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRSNENESL-------THLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGSGRHGNEDQQ-------ILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTL-NQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRMRLKKYRSVGFXXXXXXXXXXXXXXXXXXRR---LRP-HMGIXXXXXXXXXXXXXXEVDLTSASELSCCETVIFKGDTNHSLSDK 1703
             +F FD++      Q  + + ++ D +  +  G D CIFSFGH  LGK+ +M+G D S   +GI+PCA+ W F+LI++ +R     R+ V +SA+EV  ++ ++ DLLA + P S     S    L +       L NQ EL A   ++AA  LD+ALA RS             +H+   +H+Y  R++      C    ++  +SRL L+DLGS                 LSL  +  VILAL    +HVPY+++ LT LL+++L      TTM+ H+S     ++ETL  VQLA +++R+R KK +         +S   SS    ++RR   LRP H    A            + D +S+SE SC +TVI+ G    +LSD+
Sbjct:  289 KMFAFDAVFPQDSEQAEVCSGTVADVLQSVVSGADGCIFSFGHMSLGKSYTMIGKDSSPQSLGIVPCAISWLFRLIEE-RRERTGTRFSVRVSAVEVCGRDQSLRDLLAEVAPGSLQDTQSPGVYLREDPVCGAQLQNQSELRAPTAEKAAFYLDAALAARSTSRAGCGEDARRSSHMLFTLHVYQYRME-----KCGRGGMSGGRSRLHLIDLGSCEAAAGRAGEAAGGPLCLSLSALGSVILALVNGAKHVPYRDHRLTMLLRESLATAGCRTTMIAHVSDAPAQHAETLSTVQLAARIHRLRRKKAKYA-----SSSSGGESSCEEGRARRPPHLRPFHPRTVALDPDRTPPCLPGDPDYSSSSEQSC-DTVIYVGPGGAALSDR 664          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Human
Match: KIF26A (kinesin family member 26A [Source:HGNC Symbol;Acc:HGNC:20226])

HSP 1 Score: 184.496 bits (467), Expect = 6.093e-46
Identity = 129/388 (33.25%), Postives = 197/388 (50.77%), Query Frame = 3
Query:  600 NLFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKN-NVCDLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRSNENESL-------THLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGSGRHGNEDQQ-------ILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTL-NQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRMRLKKYRSVGFXXXXXXXXXXXXXXXXXXRR---LRP-HMGIXXXXXXXXXXXXXXEVDLTSASELSCCETVIFKGDTNHSLSDK 1703
             +F FD++      Q  + + ++ D +  +  G D CIFSFGH  LGK+ +M+G D S   +GI+PCA+ W F+LI++ +R     R+ V +SA+EV  ++ ++ DLLA + P S     S    L +       L NQ EL A   ++AA  LD+ALA RS             +H+   +H+Y  R++      C    ++  +SRL L+DLGS                 LSL  +  VILAL    +HVPY+++ LT LL+++L      TTM+ H+S     ++ETL  VQLA +++R+R KK +         +S   SS    ++RR   LRP H    A            + D +S+SE SC +TVI+ G    +LSD+
Sbjct:  428 KMFAFDAVFPQDSEQAEVCSGTVADVLQSVVSGADGCIFSFGHMSLGKSYTMIGKDSSPQSLGIVPCAISWLFRLIEE-RRERTGTRFSVRVSAVEVCGRDQSLRDLLAEVAPGSLQDTQSPGVYLREDPVCGAQLQNQSELRAPTAEKAAFYLDAALAARSTSRAGCGEDARRSSHMLFTLHVYQYRME-----KCGRGGMSGGRSRLHLIDLGSCEAAAGRAGEAAGGPLCLSLSALGSVILALVNGAKHVPYRDHRLTMLLRESLATAGCRTTMIAHVSDAPAQHAETLSTVQLAARIHRLRRKKAKYA-----SSSSGGESSCEEGRARRPPHLRPFHPRTVALDPDRTPPCLPGDPDYSSSSEQSC-DTVIYVGPGGAALSDR 803          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Human
Match: KIF26B (kinesin family member 26B [Source:HGNC Symbol;Acc:HGNC:25484])

HSP 1 Score: 180.644 bits (457), Expect = 6.635e-45
Identity = 107/304 (35.20%), Postives = 166/304 (54.61%), Query Frame = 3
Query:  600 NLFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNK-NNVCDLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRSNENESL-------THLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGS-------GRHGNEDQQILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTL-NQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRM 1463
             +F FD++     SQ  +   ++ + +  +  G D C+F FGH+ LGK+ +M+G D S+ ++GIIPCA+ W FKLI++ K    + R+ V +SA+EV  K  N+ DLL+ +   S   G S    L +     T L NQ EL A   ++AA  LD+A+A+R +  +         +H+   +H+Y  R++           ++  +SRL L+DLGS        R G      LSL  +  VILAL    +H+PYKE+ L  LL+++L N N  TTM+ HIS+    Y+ETL  +Q+A ++ RM
Sbjct:  124 KMFAFDAVFPQDASQAEVCAGTVAEVIQSVVNGADGCVFCFGHAKLGKSYTMIGKDDSMQNLGIIPCAISWLFKLINERKEKTGA-RFSVRVSAVEVWGKEENLRDLLSEVATGSLQDGQSPGVYLCEDPICGTQLQNQSELRAPTAEKAAFFLDAAIASRRSHQQDCDEDDHRNSHVFFTLHIYQYRMEKSG-----KGGMSGGRSRLHLIDLGSCVKALSKNREGGSG-LCLSLSALGNVILALVNGSKHIPYKESKLAMLLRESLGNMNCRTTMIAHISAAVGSYAETLSTIQIASRVLRM 420          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Human
Match: KIF26B (kinesin family member 26B [Source:HGNC Symbol;Acc:HGNC:25484])

HSP 1 Score: 180.644 bits (457), Expect = 7.908e-45
Identity = 107/303 (35.31%), Postives = 166/303 (54.79%), Query Frame = 3
Query:  603 LFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNK-NNVCDLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRSNENESL-------THLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGS-------GRHGNEDQQILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTL-NQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRM 1463
            +F FD++     SQ  +   ++ + +  +  G D C+F FGH+ LGK+ +M+G D S+ ++GIIPCA+ W FKLI++ K    + R+ V +SA+EV  K  N+ DLL+ +   S   G S    L +     T L NQ EL A   ++AA  LD+A+A+R +  +         +H+   +H+Y  R++           ++  +SRL L+DLGS        R G      LSL  +  VILAL    +H+PYKE+ L  LL+++L N N  TTM+ HIS+    Y+ETL  +Q+A ++ RM
Sbjct:  506 MFAFDAVFPQDASQAEVCAGTVAEVIQSVVNGADGCVFCFGHAKLGKSYTMIGKDDSMQNLGIIPCAISWLFKLINERKEKTGA-RFSVRVSAVEVWGKEENLRDLLSEVATGSLQDGQSPGVYLCEDPICGTQLQNQSELRAPTAEKAAFFLDAAIASRRSHQQDCDEDDHRNSHVFFTLHIYQYRMEKSG-----KGGMSGGRSRLHLIDLGSCVKALSKNREGGSG-LCLSLSALGNVILALVNGSKHIPYKESKLAMLLRESLGNMNCRTTMIAHISAAVGSYAETLSTIQIASRVLRM 801          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Human
Match: KIF26B (kinesin family member 26B [Source:HGNC Symbol;Acc:HGNC:25484])

HSP 1 Score: 180.644 bits (457), Expect = 8.902e-45
Identity = 107/303 (35.31%), Postives = 166/303 (54.79%), Query Frame = 3
Query:  603 LFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNK-NNVCDLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRSNENESL-------THLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGS-------GRHGNEDQQILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTL-NQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRM 1463
            +F FD++     SQ  +   ++ + +  +  G D C+F FGH+ LGK+ +M+G D S+ ++GIIPCA+ W FKLI++ K    + R+ V +SA+EV  K  N+ DLL+ +   S   G S    L +     T L NQ EL A   ++AA  LD+A+A+R +  +         +H+   +H+Y  R++           ++  +SRL L+DLGS        R G      LSL  +  VILAL    +H+PYKE+ L  LL+++L N N  TTM+ HIS+    Y+ETL  +Q+A ++ RM
Sbjct:  352 MFAFDAVFPQDASQAEVCAGTVAEVIQSVVNGADGCVFCFGHAKLGKSYTMIGKDDSMQNLGIIPCAISWLFKLINERKEKTGA-RFSVRVSAVEVWGKEENLRDLLSEVATGSLQDGQSPGVYLCEDPICGTQLQNQSELRAPTAEKAAFFLDAAIASRRSHQQDCDEDDHRNSHVFFTLHIYQYRMEKSG-----KGGMSGGRSRLHLIDLGSCVKALSKNREGGSG-LCLSLSALGNVILALVNGSKHIPYKESKLAMLLRESLGNMNCRTTMIAHISAAVGSYAETLSTIQIASRVLRM 647          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Celegans
Match: klp-19 (Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc:O45935])

HSP 1 Score: 90.8929 bits (224), Expect = 6.452e-18
Identity = 87/308 (28.25%), Postives = 151/308 (49.03%), Query Frame = 3
Query:  606 FPFDSILTDSDSQEFIFTDSLVDPVLE-LFKGRDSCIFSFGHSGLGKTKSM-----VGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYF-VSISAIEVSNKNNVCDLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRSNENESLTHLQLIIH-LYHCRVDAVAERNCDSNNVTSKKSRLILLDL-GSGR------HGNEDQQILSLQG----ISKVILALYTSQRHVPYKENVLTQLLKDTLNQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRMRLK 1472
            F FD++  D+  QE ++  + + P+L+ +F G ++ + ++G +G GKT +M     VG+D      GIIP  +   F+ I     N  +   F V++S  EV   +NV DLL        + GD K          N  ++N   +P   L+ A   L      R+    ++  +    H ++   V+  A   CDS    +  ++L L+DL GS R       GN  ++ +++ G    +S+VI AL T Q+H+PY+ +V+T++L+D+L  N  T  L  IS  + +  ETL  ++ A +  +++ K
Sbjct:   46 FTFDAVFADTSDQESVYETTAL-PLLDRIFAGFNATVLAYGQTGSGKTYTMGTEDNVGTDEM--RRGIIPRLVSALFQRI----MNTEAPESFAVTVSMFEVYG-DNVYDLLRPDKVKLNVHGDEK----------NCTVVNLTAVPVIDLKGALKQLAVGCHYRTKAETAMNAMSSRSHAVFTVFVEKTATAECDS----AFSAKLQLVDLAGSERLKKTEAEGNRMKEGININGGLLILSQVIAALATKQKHIPYRNSVITRVLQDSLGGNSFTVFLACISPADSNSQETLNTLRYADRAKQIKNK 331          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Celegans
Match: klp-20 (Kinesin-like protein klp-20 [Source:UniProtKB/Swiss-Prot;Acc:Q965T6])

HSP 1 Score: 84.3445 bits (207), Expect = 3.789e-16
Identity = 78/298 (26.17%), Postives = 136/298 (45.64%), Query Frame = 3
Query:  606 FPFDSILTDSDSQEFIFTDSLVDPVLE-LFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKNNVCDLLANLNPLSKLSGDSKSQELSD-----QDQSNTILINQRELPASCLQEAACILDSALATRSNENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDL-GSGRHGNEDQQILSLQGISKVILALYT-----------SQRHVPYKENVLTQLLKDTLNQNFTTTMLLHISSKEQHYSETLQVVQLA 1445
            F FD++ + +  Q  ++ +    P++E + KG +  IF++G +G GKT +M G    +   GIIP +    F   D + +  H   + V +S +E+ N+  + DLL+  +     +G+ + +E  D     ++ SN  + N  ++ A  L E         AT  N   S +H    + +  CR   V +             +L L+DL GS R      Q   L+  +K+ L+L T              H+PY+ + LT+LL+D+L  N  T M+ ++     +Y ETL  ++ A
Sbjct:   52 FYFDAVFSPNTDQMTVY-NVAARPIVENVLKGYNGTIFAYGQTGTGKTFTMAGDLEPVEMRGIIPNSFAHIF---DHIAKCQHDTTFLVRVSYLEIYNEE-IRDLLSKDH-----NGNLEIKERPDVGVYVRNLSNPTVENASKMQA--LMEFGSKNRKVGATAMNLESSRSHAMFTVTIESCRNGLVTQ------------GKLQLVDLAGSERQSKTGAQGERLKEAAKINLSLSTLGNVISSLVDGKSTHIPYRNSKLTRLLQDSLGGNSKTVMIANVGPATYNYDETLSTLRYA 325          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Celegans
Match: klp-20 (Kinesin-like protein klp-20 [Source:UniProtKB/Swiss-Prot;Acc:Q965T6])

HSP 1 Score: 84.3445 bits (207), Expect = 3.789e-16
Identity = 78/298 (26.17%), Postives = 136/298 (45.64%), Query Frame = 3
Query:  606 FPFDSILTDSDSQEFIFTDSLVDPVLE-LFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKNNVCDLLANLNPLSKLSGDSKSQELSD-----QDQSNTILINQRELPASCLQEAACILDSALATRSNENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDL-GSGRHGNEDQQILSLQGISKVILALYT-----------SQRHVPYKENVLTQLLKDTLNQNFTTTMLLHISSKEQHYSETLQVVQLA 1445
            F FD++ + +  Q  ++ +    P++E + KG +  IF++G +G GKT +M G    +   GIIP +    F   D + +  H   + V +S +E+ N+  + DLL+  +     +G+ + +E  D     ++ SN  + N  ++ A  L E         AT  N   S +H    + +  CR   V +             +L L+DL GS R      Q   L+  +K+ L+L T              H+PY+ + LT+LL+D+L  N  T M+ ++     +Y ETL  ++ A
Sbjct:   52 FYFDAVFSPNTDQMTVY-NVAARPIVENVLKGYNGTIFAYGQTGTGKTFTMAGDLEPVEMRGIIPNSFAHIF---DHIAKCQHDTTFLVRVSYLEIYNEE-IRDLLSKDH-----NGNLEIKERPDVGVYVRNLSNPTVENASKMQA--LMEFGSKNRKVGATAMNLESSRSHAMFTVTIESCRNGLVTQ------------GKLQLVDLAGSERQSKTGAQGERLKEAAKINLSLSTLGNVISSLVDGKSTHIPYRNSKLTRLLQDSLGGNSKTVMIANVGPATYNYDETLSTLRYA 325          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Celegans
Match: klp-20 (Kinesin-like protein klp-20 [Source:UniProtKB/Swiss-Prot;Acc:Q965T6])

HSP 1 Score: 84.3445 bits (207), Expect = 3.789e-16
Identity = 78/298 (26.17%), Postives = 136/298 (45.64%), Query Frame = 3
Query:  606 FPFDSILTDSDSQEFIFTDSLVDPVLE-LFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKNNVCDLLANLNPLSKLSGDSKSQELSD-----QDQSNTILINQRELPASCLQEAACILDSALATRSNENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDL-GSGRHGNEDQQILSLQGISKVILALYT-----------SQRHVPYKENVLTQLLKDTLNQNFTTTMLLHISSKEQHYSETLQVVQLA 1445
            F FD++ + +  Q  ++ +    P++E + KG +  IF++G +G GKT +M G    +   GIIP +    F   D + +  H   + V +S +E+ N+  + DLL+  +     +G+ + +E  D     ++ SN  + N  ++ A  L E         AT  N   S +H    + +  CR   V +             +L L+DL GS R      Q   L+  +K+ L+L T              H+PY+ + LT+LL+D+L  N  T M+ ++     +Y ETL  ++ A
Sbjct:   52 FYFDAVFSPNTDQMTVY-NVAARPIVENVLKGYNGTIFAYGQTGTGKTFTMAGDLEPVEMRGIIPNSFAHIF---DHIAKCQHDTTFLVRVSYLEIYNEE-IRDLLSKDH-----NGNLEIKERPDVGVYVRNLSNPTVENASKMQA--LMEFGSKNRKVGATAMNLESSRSHAMFTVTIESCRNGLVTQ------------GKLQLVDLAGSERQSKTGAQGERLKEAAKINLSLSTLGNVISSLVDGKSTHIPYRNSKLTRLLQDSLGGNSKTVMIANVGPATYNYDETLSTLRYA 325          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Celegans
Match: bmk-1 (Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc:G5ECF4])

HSP 1 Score: 74.7146 bits (182), Expect = 4.584e-13
Identity = 80/316 (25.32%), Postives = 147/316 (46.52%), Query Frame = 3
Query:  609 PFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVG------SDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKNNVCDLLANLNPLSKLSGDSKSQE----LSDQDQSNTILINQRELPA-------SCLQEAACILDSALATRSNENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLG-------SGRHGNEDQQI----LSLQGISKVILALYTSQRHVPYKENVLTQLLKDTLNQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRMRLK 1472
            PF        +QE I++D +   + ++  G +  +F++G +G GKT +M G      S       GIIP A+   F+ +++     +S+R    +S IE+ N+  + DLLA        S D++ +E      D ++   I+    E+P          LQ  A    +A AT  N + S +H   ++++       V   N  +     K+ +L L+DL        SG  GN  ++      SL  + +VI  L T+ +H+PY+E+ LT+LL+D+L  +  T+++  +S    ++ E+   ++ A +   ++ K
Sbjct:   54 PFFRTYDPDTTQEEIYSDLVSSQIKKVIAGFNCTVFAYGQTGTGKTFTMEGGRTDAKSSTDDPTTGIIPRAVEDIFEQLERCGCEEYSLR----VSYIELYNEE-LFDLLA--------STDNEDRERLRIFDDPNKKGVIVSGVEEVPVRNRSDVFKLLQLGAEKRRTA-ATLMNMHSSRSHSLFMVNV-------VIRENTTTGEELVKQGKLNLVDLAGSENIGRSGAQGNRAKEAGSINQSLLTLGRVIRLLTTNGQHIPYRESKLTRLLQDSLGGSTITSLIATLSPSSSNFEESQSTLEYAMRAANIKNK 348          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Fly
Match: CG14535 (gene:FBgn0031955 transcript:FBtr0343421)

HSP 1 Score: 119.398 bits (298), Expect = 1.606e-26
Identity = 102/391 (26.09%), Postives = 168/391 (42.97%), Query Frame = 3
Query:  432 RFPDNEKINSNKVRVVLKI-----NESRDTPSCLTINKSQNCVGVIDXXXXXXXXXXXXH-------VNLFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGS------------DRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKNNVC---DLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRSNENESL------------THLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLG--SGRHGNEDQQILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTLNQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRMRLKKYR 1481
            R    E     KV+V+L++     N     P  + ++K +  V + DP  +     +            +F FD++ T  D Q  +   +L + +  + +G D C+ + G+   G+ ++++G                   +G  PCA+ W +K I Q +R     R+ V +SA+ VS         DLL +    +  S DS    L D       L    EL A   + AA  LDSALA R   + S             + L   +H+Y   +            V   +SRL ++DLG  + R+G      L L GI  ++LA+ + QRH P+K++ LT LLKD L        ++     EQ Y + L  +Q+A +++R+R +K+R
Sbjct:   33 RLSSRECYGVGKVKVMLRVADRDRNSGGTEPDFMALDKKKRQVTLTDPRTACPPPQAAQERAPMVAAPKMFAFDNLFTGEDKQSDVCASALSEVIPAVLEGSDGCLLAMGYPATGQAQTVLGELGGGSGSGSASGSGVACSLGAAPCAIAWLYKGI-QERRQKSGARFSVRVSAVGVSATKPDALSQDLLISH---AAESDDSPGIYLRDD-----FLGGPTELRAPTAERAALFLDSALAGRLKSSGSTASGSSGCAAPLESALIFTLHVYQYSLS-------RKGGVAGGRSRLHIIDLGGCANRNGG-----LPLSGIGNILLAILSGQRHPPHKDHPLTPLLKDCLAPITCHVAIVAHVRPEQSYQDALSTIQIASRIHRLRRRKHR 402          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Fly
Match: CG14535 (gene:FBgn0031955 transcript:FBtr0079564)

HSP 1 Score: 119.398 bits (298), Expect = 1.606e-26
Identity = 102/391 (26.09%), Postives = 168/391 (42.97%), Query Frame = 3
Query:  432 RFPDNEKINSNKVRVVLKI-----NESRDTPSCLTINKSQNCVGVIDXXXXXXXXXXXXH-------VNLFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGS------------DRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKNNVC---DLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRSNENESL------------THLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLG--SGRHGNEDQQILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTLNQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRMRLKKYR 1481
            R    E     KV+V+L++     N     P  + ++K +  V + DP  +     +            +F FD++ T  D Q  +   +L + +  + +G D C+ + G+   G+ ++++G                   +G  PCA+ W +K I Q +R     R+ V +SA+ VS         DLL +    +  S DS    L D       L    EL A   + AA  LDSALA R   + S             + L   +H+Y   +            V   +SRL ++DLG  + R+G      L L GI  ++LA+ + QRH P+K++ LT LLKD L        ++     EQ Y + L  +Q+A +++R+R +K+R
Sbjct:   33 RLSSRECYGVGKVKVMLRVADRDRNSGGTEPDFMALDKKKRQVTLTDPRTACPPPQAAQERAPMVAAPKMFAFDNLFTGEDKQSDVCASALSEVIPAVLEGSDGCLLAMGYPATGQAQTVLGELGGGSGSGSASGSGVACSLGAAPCAIAWLYKGI-QERRQKSGARFSVRVSAVGVSATKPDALSQDLLISH---AAESDDSPGIYLRDD-----FLGGPTELRAPTAERAALFLDSALAGRLKSSGSTASGSSGCAAPLESALIFTLHVYQYSLS-------RKGGVAGGRSRLHIIDLGGCANRNGG-----LPLSGIGNILLAILSGQRHPPHKDHPLTPLLKDCLAPITCHVAIVAHVRPEQSYQDALSTIQIASRIHRLRRRKHR 402          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Fly
Match: Klp68D (gene:FBgn0004381 transcript:FBtr0332129)

HSP 1 Score: 82.8037 bits (203), Expect = 1.922e-15
Identity = 84/301 (27.91%), Postives = 139/301 (46.18%), Query Frame = 3
Query:  603 LFPFDSILTDSDSQEFIFTD---SLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKNNVCDLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRS------NENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDL-GSGRHGN---------EDQQI-LSLQGISKVILALYTSQRHVPYKENVLTQLLKDTLNQNFTTTMLLHISSKEQHYSETLQVVQLA 1445
            +F +D+    S +Q  ++ +    LV  VLE F G   CIF++G +G GKT +M G   +   +GIIP     TF+ I        + ++ V +S +E+         +  L  L  L  +SK  E+ ++  S   + N   +    +++   ++      R+      NE+ S +H   +I +  C          D+   T K  +L L+DL GS R            E  +I L+L  +  VI AL  S  HVPY+++ LT+LL+D+L  N  T M+ +I     +Y+ETL  ++ A
Sbjct:   66 VFTYDAAYDASATQTTLYHEVVFPLVSSVLEGFNG---CIFAYGQTGTGKTFTMEGVRGNDELMGIIP----RTFEQIWLHINRTENFQFLVDVSYLEI--------YMEELRDL--LKPNSKHLEVRERG-SGVYVPNLHAINCKSVEDMIKVMQVGNKNRTVGFTNMNEHSSRSHAIFMIKIEMC----------DTETNTIKVGKLNLIDLAGSERQSKTGASAERLKEASKINLALSSLGNVISALAESSPHVPYRDSKLTRLLQDSLGGNSKTIMIANIGPSNYNYNETLTTLRYA 338          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Fly
Match: Klp68D (gene:FBgn0004381 transcript:FBtr0076030)

HSP 1 Score: 82.8037 bits (203), Expect = 1.922e-15
Identity = 84/301 (27.91%), Postives = 139/301 (46.18%), Query Frame = 3
Query:  603 LFPFDSILTDSDSQEFIFTD---SLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKNNVCDLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRS------NENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDL-GSGRHGN---------EDQQI-LSLQGISKVILALYTSQRHVPYKENVLTQLLKDTLNQNFTTTMLLHISSKEQHYSETLQVVQLA 1445
            +F +D+    S +Q  ++ +    LV  VLE F G   CIF++G +G GKT +M G   +   +GIIP     TF+ I        + ++ V +S +E+         +  L  L  L  +SK  E+ ++  S   + N   +    +++   ++      R+      NE+ S +H   +I +  C          D+   T K  +L L+DL GS R            E  +I L+L  +  VI AL  S  HVPY+++ LT+LL+D+L  N  T M+ +I     +Y+ETL  ++ A
Sbjct:   66 VFTYDAAYDASATQTTLYHEVVFPLVSSVLEGFNG---CIFAYGQTGTGKTFTMEGVRGNDELMGIIP----RTFEQIWLHINRTENFQFLVDVSYLEI--------YMEELRDL--LKPNSKHLEVRERG-SGVYVPNLHAINCKSVEDMIKVMQVGNKNRTVGFTNMNEHSSRSHAIFMIKIEMC----------DTETNTIKVGKLNLIDLAGSERQSKTGASAERLKEASKINLALSSLGNVISALAESSPHVPYRDSKLTRLLQDSLGGNSKTIMIANIGPSNYNYNETLTTLRYA 338          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Fly
Match: Klp64D (gene:FBgn0004380 transcript:FBtr0077157)

HSP 1 Score: 77.0258 bits (188), Expect = 1.039e-13
Identity = 86/301 (28.57%), Postives = 140/301 (46.51%), Query Frame = 3
Query:  606 FPFDSILTDSDSQEFIFTDS---LVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKNNVCDLLANLNPLSKLSGDS-KSQELSD-----QDQSNTILINQRELPASCLQEAACILDSALATRSNENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDL----------GSGRHGNEDQQI-LSLQGISKVILALYTSQR-HVPYKENVLTQLLKDTLNQNFTTTMLLHISSKEQHYSETLQVVQLA 1445
            + FD++     +Q  ++ D+   +VD VLE + G    I ++G +G GKT +M G+  S    GIIP A    F  I + K N    ++ V +S +E+ N+  V DLL       K  G S + +E  D     +D S  ++ N  +L    +        +  AT+ N+  S +H      ++   V+       D  +V  +  +L L+DL           SG+   E  +I LSL  +  VI AL   +  H+PY+ + LT+LL+D+L  N  T M   IS  + +Y ET+  ++ A
Sbjct:   68 YYFDNVFDGGSNQMDLYVDTARPIVDKVLEGYNG---TILAYGQTGTGKTYTMSGNPDSPQTKGIIPNAFAHIFGHIAKAKENQ---KFLVRVSYMEIYNE-EVRDLLG------KDVGKSLEVKERPDIGVFVKDLSGYVVHNADDL--ENIMRLGNKNRAVGATKMNQESSRSHA-----IFSITVERSELGEGDVQHV--RMGKLQLVDLAGSERQSKTQASGQRLKEATKINLSLSVLGNVISALVDGKSTHIPYRNSKLTRLLQDSLGGNSKTVMCATISPADSNYMETISTLRYA 346          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Zebrafish
Match: kif26ba (kinesin family member 26Ba [Source:ZFIN;Acc:ZDB-GENE-070521-4])

HSP 1 Score: 181.8 bits (460), Expect = 2.775e-45
Identity = 108/308 (35.06%), Postives = 170/308 (55.19%), Query Frame = 3
Query:  603 LFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKN-NVCDLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATR-------SNENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLG------SGRHGNEDQQILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTL-NQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRMRLKKYR 1481
            +F FD+  +   SQ  +   ++ + +  +  G D C+F FGHS LGK+ +M+G D S+  +GIIPCA+ W FKLI++ K    + R+ V +SA+EV  K+ N+ DLL+ +   S   G S    L +       L NQ EL A   ++AA  LD+A+A+R         E    +H+   +H+Y  R++   +       ++  +SRL L+DLG      S    +     LSL  +  VILAL    +H+PYK++ LT LL+++L N N  TTM+ HISS   ++SETL  +Q+A ++ R++ KK +
Sbjct:  525 MFAFDAAFSHDASQAEVCAGTVAEVIQSVVNGADGCVFCFGHSKLGKSYTMIGKDDSMQSLGIIPCAISWLFKLINECKEKTGA-RFSVRVSAVEVWGKDENLKDLLSEVATGSLQDGQSPGVYLCEDPICGMQLQNQSELRAPTAEKAAFFLDAAIASRYSSKPDCDEEEHRNSHMLFTLHIYQYRMEKTGK-----GGMSGGRSRLHLIDLGSCVKVLSKIRDSATGLCLSLSALGNVILALVNGSKHIPYKDSKLTMLLRESLGNMNCRTTMIAHISSSPNNFSETLSTLQIASRVLRLKKKKAK 826          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Zebrafish
Match: kif26ba (kinesin family member 26Ba [Source:ZFIN;Acc:ZDB-GENE-070521-4])

HSP 1 Score: 181.415 bits (459), Expect = 2.970e-45
Identity = 131/385 (34.03%), Postives = 202/385 (52.47%), Query Frame = 3
Query:  603 LFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKN-NVCDLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATR-------SNENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLG------SGRHGNEDQQILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTL-NQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRMRLKKYRSVGFXXXXXXXXXXXXXXXXXXRR---LRPHMGIXXXXXXXXXXXXXXEVDLTSASELSCCETVIFKGDTNHSLSDK 1703
            +F FD+  +   SQ  +   ++ + +  +  G D C+F FGHS LGK+ +M+G D S+  +GIIPCA+ W FKLI++ K    + R+ V +SA+EV  K+ N+ DLL+ +   S   G S    L +       L NQ EL A   ++AA  LD+A+A+R         E    +H+   +H+Y  R++   +       ++  +SRL L+DLG      S    +     LSL  +  VILAL    +H+PYK++ LT LL+++L N N  TTM+ HISS   ++SETL  +Q+A ++ R++ KK + V    +  +S   SS    + RR   LR                 SS+ +  S+SE S C+TVI+ G    +LSDK
Sbjct:   85 MFAFDAAFSHDASQAEVCAGTVAEVIQSVVNGADGCVFCFGHSKLGKSYTMIGKDDSMQSLGIIPCAISWLFKLINECKEKTGA-RFSVRVSAVEVWGKDENLKDLLSEVATGSLQDGQSPGVYLCEDPICGMQLQNQSELRAPTAEKAAFFLDAAIASRYSSKPDCDEEEHRNSHMLFTLHIYQYRMEKTGK-----GGMSGGRSRLHLIDLGSCVKVLSKIRDSATGLCLSLSALGNVILALVNGSKHIPYKDSKLTMLLRESLGNMNCRTTMIAHISSSPNNFSETLSTLQIASRVLRLKKKKAK-VTMQYTSSSSGGESSCEEGRMRRPTQLRTIHSRNVVDSEMPLLHLSSDPEDYSSSEQS-CDTVIYVGPNGSALSDK 461          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Zebrafish
Match: kif26ab (kinesin family member 26Ab [Source:ZFIN;Acc:ZDB-GENE-100716-6])

HSP 1 Score: 179.874 bits (455), Expect = 8.858e-45
Identity = 108/303 (35.64%), Postives = 171/303 (56.44%), Query Frame = 3
Query:  603 LFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKN-NVCDLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRSN-------ENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGSGRH---GNEDQQ---ILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTL-NQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRMR 1466
            +F FD++ +   SQ  + + ++ + +  +  G D CIF FGH  +GKT +M+G+D S+  +GI PCA+ W FKLI++ K    + R+ V +SA+E+  K+ ++ DLL+++   S   G S    L +     T L NQ EL A   ++AA  LD+A+A RS        E+   +H+   +H+Y  R++           ++  +SRL L+DLGS       + D      LSL  +  VILAL    +HVPY+++ LT LL+D+L N N  TTM+ HIS    +Y+E+L  +QLA +++RMR
Sbjct:  432 MFAFDAVFSQDASQAEVCSGTVAEVIQSVVNGADGCIFCFGHVKVGKTYTMIGTDSSMQSLGIAPCAISWLFKLINERKEKTGT-RFSVRVSAVEIYGKDESLQDLLSDVPTGSLQDGQSPGVYLREDPICGTQLQNQCELRAPTAEKAALFLDAAIAARSTNHPDADEEDRRNSHMLFTLHIYQYRMEKSG-----KGGMSGGRSRLHLIDLGSCEKVLCKSRDAGGGLCLSLTALGNVILALANGAKHVPYRDSKLTMLLRDSLGNINCRTTMIAHISDSPANYAESLTTIQLASRIHRMR 728          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Zebrafish
Match: kif26aa (kinesin family member 26Aa [Source:ZFIN;Acc:ZDB-GENE-041001-148])

HSP 1 Score: 164.851 bits (416), Expect = 3.275e-40
Identity = 109/304 (35.86%), Postives = 165/304 (54.28%), Query Frame = 3
Query:  603 LFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKNNVC-DLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRSN-------ENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGS-------GRHGNEDQQILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTL-NQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRMR 1466
            +F FD+I T   SQ  + + ++ + +  +  G D CIF FG + LGK+ +M+G D S   +G+ PCA+ W FKLI++ K    + R+ + +SA+E+  +  V  DLLA+ +  +     S    L +     + L NQ EL A   + AA  LD+ALA RS        E+   +H+   +H+   R++  ++     N     +SRL LLDLGS        R G    Q LSL  +  VILAL    +HVPY+++ LT LL+++L N N  TTM+ HIS    +Y E+L  VQLA +++RMR
Sbjct:  114 MFTFDAIFTQDASQAEVCSGTVAEVIQSVVNGADGCIFCFGQANLGKSYTMIGRDSSTQSLGVAPCAISWLFKLIEERKEKTGT-RFSIRVSAVEICGREEVLRDLLADFSAGTSQDSQSAGISLREDPVCGSQLQNQSELRAYSAERAAFFLDAALAARSTTRPDCKEEDRRNSHMLFTLHISQYRMEKSSKAGMSGN-----RSRLHLLDLGSCESDLSQTRDGGRG-QCLSLGALGNVILALANGAKHVPYRDSKLTMLLRESLGNINCRTTMIAHISDSPANYVESLTTVQLASRIHRMR 410          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Zebrafish
Match: kif26aa (kinesin family member 26Aa [Source:ZFIN;Acc:ZDB-GENE-041001-148])

HSP 1 Score: 164.466 bits (415), Expect = 3.829e-40
Identity = 109/304 (35.86%), Postives = 165/304 (54.28%), Query Frame = 3
Query:  603 LFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKNNVC-DLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRSN-------ENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGS-------GRHGNEDQQILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTL-NQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRMR 1466
            +F FD+I T   SQ  + + ++ + +  +  G D CIF FG + LGK+ +M+G D S   +G+ PCA+ W FKLI++ K    + R+ + +SA+E+  +  V  DLLA+ +  +     S    L +     + L NQ EL A   + AA  LD+ALA RS        E+   +H+   +H+   R++  ++     N     +SRL LLDLGS        R G    Q LSL  +  VILAL    +HVPY+++ LT LL+++L N N  TTM+ HIS    +Y E+L  VQLA +++RMR
Sbjct:  264 MFTFDAIFTQDASQAEVCSGTVAEVIQSVVNGADGCIFCFGQANLGKSYTMIGRDSSTQSLGVAPCAISWLFKLIEERKEKTGT-RFSIRVSAVEICGREEVLRDLLADFSAGTSQDSQSAGISLREDPVCGSQLQNQSELRAYSAERAAFFLDAALAARSTTRPDCKEEDRRNSHMLFTLHISQYRMEKSSKAGMSGN-----RSRLHLLDLGSCESDLSQTRDGGRG-QCLSLGALGNVILALANGAKHVPYRDSKLTMLLRESLGNINCRTTMIAHISDSPANYVESLTTVQLASRIHRMR 560          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Xenopus
Match: gyg2 (glycogenin 2 [Source:Xenbase;Acc:XB-GENE-5854708])

HSP 1 Score: 184.111 bits (466), Expect = 6.771e-46
Identity = 109/303 (35.97%), Postives = 168/303 (55.45%), Query Frame = 3
Query:  603 LFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNK-NNVCDLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRSNENESL-------THLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGS-------GRHGNEDQQILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTL-NQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRM 1463
            +F FD++     SQ  +   ++ + +  +  G D C+F FGHS LGK+ +M+G D S+ ++GIIPCA+ W FKLI++ K    + R+ V +SA+EV  K  N+ DLL+ +   S   G S    L +       L NQ EL A   ++AA  LD+A+A+R +            +H+   +H+Y  R++           ++  +SRL L+DLGS        R G+   Q LSL  +  VILAL    +H+PYKE+ LT LL+++L N N  TTM+ HIS+   +Y+ETL  +Q+A ++ RM
Sbjct:  506 MFAFDAVFPQDASQAEVCAGTVAEVIQSVVNGADGCVFCFGHSKLGKSYTMIGKDDSMQNLGIIPCAISWLFKLINERKEKTGA-RFSVRVSAVEVWGKEENLRDLLSEVATGSLQDGQSPGVYLCEDPICGMQLQNQSELRAPTAEKAAFFLDAAIASRRSSQRDCDEDDHRNSHMLFTLHIYQYRMEKSG-----KGGMSGGRSRLHLIDLGSCVKVLSKSRDGSTG-QCLSLSALGNVILALVNGSKHIPYKESKLTMLLRESLGNMNCRTTMIAHISAAAGNYTETLSTIQIASRVLRM 801          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Xenopus
Match: gyg2 (glycogenin 2 [Source:Xenbase;Acc:XB-GENE-5854708])

HSP 1 Score: 183.726 bits (465), Expect = 7.135e-46
Identity = 109/303 (35.97%), Postives = 168/303 (55.45%), Query Frame = 3
Query:  603 LFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNK-NNVCDLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRSNENESL-------THLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGS-------GRHGNEDQQILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTL-NQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRM 1463
            +F FD++     SQ  +   ++ + +  +  G D C+F FGHS LGK+ +M+G D S+ ++GIIPCA+ W FKLI++ K    + R+ V +SA+EV  K  N+ DLL+ +   S   G S    L +       L NQ EL A   ++AA  LD+A+A+R +            +H+   +H+Y  R++           ++  +SRL L+DLGS        R G+   Q LSL  +  VILAL    +H+PYKE+ LT LL+++L N N  TTM+ HIS+   +Y+ETL  +Q+A ++ RM
Sbjct:  118 MFAFDAVFPQDASQAEVCAGTVAEVIQSVVNGADGCVFCFGHSKLGKSYTMIGKDDSMQNLGIIPCAISWLFKLINERKEKTGA-RFSVRVSAVEVWGKEENLRDLLSEVATGSLQDGQSPGVYLCEDPICGMQLQNQSELRAPTAEKAAFFLDAAIASRRSSQRDCDEDDHRNSHMLFTLHIYQYRMEKSG-----KGGMSGGRSRLHLIDLGSCVKVLSKSRDGSTG-QCLSLSALGNVILALVNGSKHIPYKESKLTMLLRESLGNMNCRTTMIAHISAAAGNYTETLSTIQIASRVLRM 413          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Xenopus
Match: gyg2 (glycogenin 2 [Source:Xenbase;Acc:XB-GENE-5854708])

HSP 1 Score: 183.726 bits (465), Expect = 7.152e-46
Identity = 109/303 (35.97%), Postives = 168/303 (55.45%), Query Frame = 3
Query:  603 LFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNK-NNVCDLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRSNENESL-------THLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGS-------GRHGNEDQQILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTL-NQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRM 1463
            +F FD++     SQ  +   ++ + +  +  G D C+F FGHS LGK+ +M+G D S+ ++GIIPCA+ W FKLI++ K    + R+ V +SA+EV  K  N+ DLL+ +   S   G S    L +       L NQ EL A   ++AA  LD+A+A+R +            +H+   +H+Y  R++           ++  +SRL L+DLGS        R G+   Q LSL  +  VILAL    +H+PYKE+ LT LL+++L N N  TTM+ HIS+   +Y+ETL  +Q+A ++ RM
Sbjct:  107 MFAFDAVFPQDASQAEVCAGTVAEVIQSVVNGADGCVFCFGHSKLGKSYTMIGKDDSMQNLGIIPCAISWLFKLINERKEKTGA-RFSVRVSAVEVWGKEENLRDLLSEVATGSLQDGQSPGVYLCEDPICGMQLQNQSELRAPTAEKAAFFLDAAIASRRSSQRDCDEDDHRNSHMLFTLHIYQYRMEKSG-----KGGMSGGRSRLHLIDLGSCVKVLSKSRDGSTG-QCLSLSALGNVILALVNGSKHIPYKESKLTMLLRESLGNMNCRTTMIAHISAAAGNYTETLSTIQIASRVLRM 402          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Xenopus
Match: gyg2 (glycogenin 2 [Source:Xenbase;Acc:XB-GENE-5854708])

HSP 1 Score: 183.726 bits (465), Expect = 7.298e-46
Identity = 109/303 (35.97%), Postives = 168/303 (55.45%), Query Frame = 3
Query:  603 LFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNK-NNVCDLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRSNENESL-------THLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGS-------GRHGNEDQQILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTL-NQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRM 1463
            +F FD++     SQ  +   ++ + +  +  G D C+F FGHS LGK+ +M+G D S+ ++GIIPCA+ W FKLI++ K    + R+ V +SA+EV  K  N+ DLL+ +   S   G S    L +       L NQ EL A   ++AA  LD+A+A+R +            +H+   +H+Y  R++           ++  +SRL L+DLGS        R G+   Q LSL  +  VILAL    +H+PYKE+ LT LL+++L N N  TTM+ HIS+   +Y+ETL  +Q+A ++ RM
Sbjct:   55 MFAFDAVFPQDASQAEVCAGTVAEVIQSVVNGADGCVFCFGHSKLGKSYTMIGKDDSMQNLGIIPCAISWLFKLINERKEKTGA-RFSVRVSAVEVWGKEENLRDLLSEVATGSLQDGQSPGVYLCEDPICGMQLQNQSELRAPTAEKAAFFLDAAIASRRSSQRDCDEDDHRNSHMLFTLHIYQYRMEKSG-----KGGMSGGRSRLHLIDLGSCVKVLSKSRDGSTG-QCLSLSALGNVILALVNGSKHIPYKESKLTMLLRESLGNMNCRTTMIAHISAAAGNYTETLSTIQIASRVLRM 350          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Xenopus
Match: gyg2 (glycogenin 2 [Source:Xenbase;Acc:XB-GENE-5854708])

HSP 1 Score: 183.726 bits (465), Expect = 8.230e-46
Identity = 109/303 (35.97%), Postives = 168/303 (55.45%), Query Frame = 3
Query:  603 LFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNK-NNVCDLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRSNENESL-------THLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGS-------GRHGNEDQQILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTL-NQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRM 1463
            +F FD++     SQ  +   ++ + +  +  G D C+F FGHS LGK+ +M+G D S+ ++GIIPCA+ W FKLI++ K    + R+ V +SA+EV  K  N+ DLL+ +   S   G S    L +       L NQ EL A   ++AA  LD+A+A+R +            +H+   +H+Y  R++           ++  +SRL L+DLGS        R G+   Q LSL  +  VILAL    +H+PYKE+ LT LL+++L N N  TTM+ HIS+   +Y+ETL  +Q+A ++ RM
Sbjct:  502 MFAFDAVFPQDASQAEVCAGTVAEVIQSVVNGADGCVFCFGHSKLGKSYTMIGKDDSMQNLGIIPCAISWLFKLINERKEKTGA-RFSVRVSAVEVWGKEENLRDLLSEVATGSLQDGQSPGVYLCEDPICGMQLQNQSELRAPTAEKAAFFLDAAIASRRSSQRDCDEDDHRNSHMLFTLHIYQYRMEKSG-----KGGMSGGRSRLHLIDLGSCVKVLSKSRDGSTG-QCLSLSALGNVILALVNGSKHIPYKESKLTMLLRESLGNMNCRTTMIAHISAAAGNYTETLSTIQIASRVLRM 797          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Mouse
Match: Kif26a (kinesin family member 26A [Source:MGI Symbol;Acc:MGI:2447072])

HSP 1 Score: 203.756 bits (517), Expect = 4.614e-52
Identity = 149/446 (33.41%), Postives = 223/446 (50.00%), Query Frame = 3
Query:  462 NKVRVVLKI------NESRDTPSCLTINKSQNCVGVIDXXXXXXXXXXXXHV------NLFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEV-SNKNNVCDLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRSN-------ENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGS-----GRHGNEDQQ--ILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTL-NQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRMRLKKYRSVGFXXXXXXXXXXXXXXXXXXRR---LRP-HMGIXXXXXXXXXXXXXXEVDLTSASELSCCETVIFKGDTNHSLSDK 1703
             KV+V+L+I        S ++ S L ++  +  V + DP           H        +F FD+I      Q  + + ++ D +  +  G D CIFSFGH  LGK+ +M+G D S   +GI+PCA+ W F+LID+ ++     R+ + +SA+EV  +  ++ DLLA +   S     S    L +     T L NQ EL A   ++AA  LD+ALA RS        E    +H+   +H+Y  RV+      C    ++  +SRL L+DLGS     GR G        LSL  +  VILAL    +HVPY+++ LT LL+++L   N  TTM+ HIS    H++ETL  VQLA +++R+R KK +         +S   SS    ++RR   LRP H               S + D +S+SE SC +TVI+ G    +LSD+
Sbjct:  363 GKVKVMLRIWPAQGVQRSAESTSFLKVDSRKKQVTLYDPAAGPPGCAGLRHAPTAPVPKMFAFDAIFPQDSEQAEVCSGTVADVLQSVVSGADGCIFSFGHMSLGKSYTMIGKDSSPQSLGIVPCAISWLFRLIDE-RKERLGTRFSIRVSAVEVCGHDQSLRDLLAEVASGSLQDTQSPGVYLREDPVCGTQLQNQNELRAPTAEKAAFYLDAALAARSTSRAGCGEEARRSSHMLFTLHVYQYRVE-----KCGQGGMSGGRSRLHLIDLGSCDAAVGRGGEASGGPLCLSLSALGSVILALVNGAKHVPYRDHRLTMLLRESLATTNCRTTMIAHISDSPAHHAETLSTVQLAARIHRLRRKKGKHA-----SSSSGGESSCEEGRARRPPHLRPFHPRAVVLDPDRSAPGLSGDPDYSSSSEQSC-DTVIYVGPGGMALSDR 796          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Mouse
Match: Kif26b (kinesin family member 26B [Source:MGI Symbol;Acc:MGI:2447076])

HSP 1 Score: 183.341 bits (464), Expect = 8.194e-46
Identity = 109/303 (35.97%), Postives = 167/303 (55.12%), Query Frame = 3
Query:  603 LFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNK-NNVCDLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRSNENESL-------THLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGS-------GRHGNEDQQILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTL-NQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRM 1463
            +F FD++     SQ  +   ++ + +  +  G D C+F FGH+ LGK+ +M+G D S+ ++GIIPCA+ W FKLI++ K    + R+ V ISA+EV  K  N+ DLL+ +   S   G S    L +     T L NQ EL A   ++AA  LD+A+A+R +  +         +H+   +H+Y  R++           ++  +SRL L+DLGS        R G      LSL  +  VILAL    +H+PYKE+ LT LL+++L N N  TTM+ HIS+    Y+ETL  +Q+A ++ RM
Sbjct:   59 MFAFDAVFPQDASQAEVCAGTVAEVIQSVVNGADGCVFCFGHAKLGKSYTMIGRDDSMQNLGIIPCAISWLFKLINERKEKTGA-RFSVRISAVEVWGKEENLRDLLSEVATGSLQDGQSPGVYLCEDPICGTQLQNQSELRAPTAEKAAFFLDAAIASRRSNQQDCDEDDHRNSHMLFTLHIYQYRMEKSG-----KGGMSGGRSRLHLIDLGSCVKALSKNREGGSG-LCLSLSALGNVILALVNGSKHIPYKESKLTMLLRESLGNVNCRTTMIAHISAAASSYAETLSTIQIASRVLRM 354          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Mouse
Match: Kif26b (kinesin family member 26B [Source:MGI Symbol;Acc:MGI:2447076])

HSP 1 Score: 183.341 bits (464), Expect = 8.506e-46
Identity = 109/303 (35.97%), Postives = 167/303 (55.12%), Query Frame = 3
Query:  603 LFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNK-NNVCDLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRSNENESL-------THLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGS-------GRHGNEDQQILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTL-NQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRM 1463
            +F FD++     SQ  +   ++ + +  +  G D C+F FGH+ LGK+ +M+G D S+ ++GIIPCA+ W FKLI++ K    + R+ V ISA+EV  K  N+ DLL+ +   S   G S    L +     T L NQ EL A   ++AA  LD+A+A+R +  +         +H+   +H+Y  R++           ++  +SRL L+DLGS        R G      LSL  +  VILAL    +H+PYKE+ LT LL+++L N N  TTM+ HIS+    Y+ETL  +Q+A ++ RM
Sbjct:  506 MFAFDAVFPQDASQAEVCAGTVAEVIQSVVNGADGCVFCFGHAKLGKSYTMIGRDDSMQNLGIIPCAISWLFKLINERKEKTGA-RFSVRISAVEVWGKEENLRDLLSEVATGSLQDGQSPGVYLCEDPICGTQLQNQSELRAPTAEKAAFFLDAAIASRRSNQQDCDEDDHRNSHMLFTLHIYQYRMEKSG-----KGGMSGGRSRLHLIDLGSCVKALSKNREGGSG-LCLSLSALGNVILALVNGSKHIPYKESKLTMLLRESLGNVNCRTTMIAHISAAASSYAETLSTIQIASRVLRM 801          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Mouse
Match: Kifc1 (kinesin family member C1 [Source:MGI Symbol;Acc:MGI:109596])

HSP 1 Score: 90.8929 bits (224), Expect = 6.184e-18
Identity = 88/306 (28.76%), Postives = 135/306 (44.12%), Query Frame = 3
Query:  606 FPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHI-GIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKNNVCDLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACIL-----DSALA-TRSNENESLTH--LQLIIHLYHCR-----------VDAVAERNCDSNNVTSKKSRLILLDLGSGRHG--NEDQQI-LSLQGISKVILALYTSQRHVPYKENVLTQLLKDTLNQNFTTTMLLHISSKEQHYSETLQVVQLAYKL 1454
            F FD +      QE +F + +   V     G   CIF++G +G GKT +M G  R    + G+IP A+   F +  ++  +     Y    S +E+ N+  V DLLA   P     G+ + +  S   +  T+  N R +P SC +E   +L     + A+A T  N+  S +H   QL I   H             VD       D             L LG G      E Q I  SL  +  VI+AL   + HVPY+ + LT LL+++L  +    M ++IS  E++ SE+L  ++ A K+
Sbjct:  310 FSFDRVFPPGSKQEEVF-EEIAMLVQSALDGYPVCIFAYGQTGSGKTFTMEGGPRGDPQLEGLIPRAMRHLFSVAQEM--SGQGWTYSFVASYVEIYNE-TVRDLLAT-GPRKGQGGECEIRRASPGSEELTV-TNARYVPVSCEKEVEALLHLAHQNRAVAHTAQNKRSSRSHSVFQLQISGEHAARGLQCGAPLNLVDLAGSERLDPG-----------LHLGPGERDRLRETQAINSSLSTLGLVIMALSNKESHVPYRNSKLTYLLQNSLGGSAKMLMFVNISPLEENVSESLNSLRFASKV 598          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Mouse
Match: Kifc5b (kinesin family member C5B [Source:MGI Symbol;Acc:MGI:2137414])

HSP 1 Score: 90.8929 bits (224), Expect = 7.052e-18
Identity = 88/306 (28.76%), Postives = 135/306 (44.12%), Query Frame = 3
Query:  606 FPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHI-GIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKNNVCDLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACIL-----DSALA-TRSNENESLTH--LQLIIHLYHCR-----------VDAVAERNCDSNNVTSKKSRLILLDLGSGRHG--NEDQQI-LSLQGISKVILALYTSQRHVPYKENVLTQLLKDTLNQNFTTTMLLHISSKEQHYSETLQVVQLAYKL 1454
            F FD +      QE +F + +   V     G   CIF++G +G GKT +M G  R    + G+IP A+   F +  ++  +     Y    S +E+ N+  V DLLA   P     G+ + +  S   +  T+  N R +P SC +E   +L     + A+A T  N+  S +H   QL I   H             VD       D             L LG G      E Q I  SL  +  VI+AL   + HVPY+ + LT LL+++L  +    M ++IS  E++ SE+L  ++ A K+
Sbjct:  371 FSFDRVFPPGSKQEEVF-EEIAMLVQSALDGYPVCIFAYGQTGSGKTFTMEGGPRGDPQLAGLIPRAMRHLFSVAQEM--SGQGWTYSFVASYVEIYNE-TVRDLLAT-GPRKGQGGECEIRRASPGSEELTV-TNARYVPVSCEKEVEALLHLAHQNRAVAHTAQNKRSSRSHSVFQLQISGEHAARGLQCGAPLNLVDLAGSERLDPG-----------LPLGPGERDRLRETQAINSSLSTLGLVIMALSNKESHVPYRNSKLTYLLQNSLGGSAKMLMFVNISPLEENVSESLNSLRFASKV 659          
BLAST of Kinesin-like protein KIF26A vs. UniProt/SwissProt
Match: sp|Q52KG5|KI26A_MOUSE (Kinesin-like protein KIF26A OS=Mus musculus OX=10090 GN=Kif26a PE=1 SV=2)

HSP 1 Score: 203.756 bits (517), Expect = 3.227e-51
Identity = 149/446 (33.41%), Postives = 223/446 (50.00%), Query Frame = 3
Query:  462 NKVRVVLKI------NESRDTPSCLTINKSQNCVGVIDXXXXXXXXXXXXHV------NLFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEV-SNKNNVCDLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRSN-------ENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGS-----GRHGNEDQQ--ILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTL-NQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRMRLKKYRSVGFXXXXXXXXXXXXXXXXXXRR---LRP-HMGIXXXXXXXXXXXXXXEVDLTSASELSCCETVIFKGDTNHSLSDK 1703
             KV+V+L+I        S ++ S L ++  +  V + DP           H        +F FD+I      Q  + + ++ D +  +  G D CIFSFGH  LGK+ +M+G D S   +GI+PCA+ W F+LID+ ++     R+ + +SA+EV  +  ++ DLLA +   S     S    L +     T L NQ EL A   ++AA  LD+ALA RS        E    +H+   +H+Y  RV+      C    ++  +SRL L+DLGS     GR G        LSL  +  VILAL    +HVPY+++ LT LL+++L   N  TTM+ HIS    H++ETL  VQLA +++R+R KK +         +S   SS    ++RR   LRP H               S + D +S+SE SC +TVI+ G    +LSD+
Sbjct:  363 GKVKVMLRIWPAQGVQRSAESTSFLKVDSRKKQVTLYDPAAGPPGCAGLRHAPTAPVPKMFAFDAIFPQDSEQAEVCSGTVADVLQSVVSGADGCIFSFGHMSLGKSYTMIGKDSSPQSLGIVPCAISWLFRLIDE-RKERLGTRFSIRVSAVEVCGHDQSLRDLLAEVASGSLQDTQSPGVYLREDPVCGTQLQNQNELRAPTAEKAAFYLDAALAARSTSRAGCGEEARRSSHMLFTLHVYQYRVE-----KCGQGGMSGGRSRLHLIDLGSCDAAVGRGGEASGGPLCLSLSALGSVILALVNGAKHVPYRDHRLTMLLRESLATTNCRTTMIAHISDSPAHHAETLSTVQLAARIHRLRRKKGKHA-----SSSSGGESSCEEGRARRPPHLRPFHPRAVVLDPDRSAPGLSGDPDYSSSSEQSC-DTVIYVGPGGMALSDR 796          
BLAST of Kinesin-like protein KIF26A vs. UniProt/SwissProt
Match: sp|Q9ULI4|KI26A_HUMAN (Kinesin-like protein KIF26A OS=Homo sapiens OX=9606 GN=KIF26A PE=1 SV=3)

HSP 1 Score: 184.496 bits (467), Expect = 2.926e-45
Identity = 129/388 (33.25%), Postives = 197/388 (50.77%), Query Frame = 3
Query:  600 NLFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKN-NVCDLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRSNENESL-------THLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGSGRHGNEDQQ-------ILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTL-NQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRMRLKKYRSVGFXXXXXXXXXXXXXXXXXXRR---LRP-HMGIXXXXXXXXXXXXXXEVDLTSASELSCCETVIFKGDTNHSLSDK 1703
             +F FD++      Q  + + ++ D +  +  G D CIFSFGH  LGK+ +M+G D S   +GI+PCA+ W F+LI++ +R     R+ V +SA+EV  ++ ++ DLLA + P S     S    L +       L NQ EL A   ++AA  LD+ALA RS             +H+   +H+Y  R++      C    ++  +SRL L+DLGS                 LSL  +  VILAL    +HVPY+++ LT LL+++L      TTM+ H+S     ++ETL  VQLA +++R+R KK +         +S   SS    ++RR   LRP H    A            + D +S+SE SC +TVI+ G    +LSD+
Sbjct:  428 KMFAFDAVFPQDSEQAEVCSGTVADVLQSVVSGADGCIFSFGHMSLGKSYTMIGKDSSPQSLGIVPCAISWLFRLIEE-RRERTGTRFSVRVSAVEVCGRDQSLRDLLAEVAPGSLQDTQSPGVYLREDPVCGAQLQNQSELRAPTAEKAAFYLDAALAARSTSRAGCGEDARRSSHMLFTLHVYQYRME-----KCGRGGMSGGRSRLHLIDLGSCEAAAGRAGEAAGGPLCLSLSALGSVILALVNGAKHVPYRDHRLTMLLRESLATAGCRTTMIAHVSDAPAQHAETLSTVQLAARIHRLRRKKAKYA-----SSSSGGESSCEEGRARRPPHLRPFHPRTVALDPDRTPPCLPGDPDYSSSSEQSC-DTVIYVGPGGAALSDR 803          
BLAST of Kinesin-like protein KIF26A vs. UniProt/SwissProt
Match: sp|Q7TNC6|KI26B_MOUSE (Kinesin-like protein KIF26B OS=Mus musculus OX=10090 GN=Kif26b PE=1 SV=3)

HSP 1 Score: 183.341 bits (464), Expect = 5.950e-45
Identity = 109/303 (35.97%), Postives = 167/303 (55.12%), Query Frame = 3
Query:  603 LFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNK-NNVCDLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRSNENESL-------THLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGS-------GRHGNEDQQILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTL-NQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRM 1463
            +F FD++     SQ  +   ++ + +  +  G D C+F FGH+ LGK+ +M+G D S+ ++GIIPCA+ W FKLI++ K    + R+ V ISA+EV  K  N+ DLL+ +   S   G S    L +     T L NQ EL A   ++AA  LD+A+A+R +  +         +H+   +H+Y  R++           ++  +SRL L+DLGS        R G      LSL  +  VILAL    +H+PYKE+ LT LL+++L N N  TTM+ HIS+    Y+ETL  +Q+A ++ RM
Sbjct:  506 MFAFDAVFPQDASQAEVCAGTVAEVIQSVVNGADGCVFCFGHAKLGKSYTMIGRDDSMQNLGIIPCAISWLFKLINERKEKTGA-RFSVRISAVEVWGKEENLRDLLSEVATGSLQDGQSPGVYLCEDPICGTQLQNQSELRAPTAEKAAFFLDAAIASRRSNQQDCDEDDHRNSHMLFTLHIYQYRMEKSG-----KGGMSGGRSRLHLIDLGSCVKALSKNREGGSG-LCLSLSALGNVILALVNGSKHIPYKESKLTMLLRESLGNVNCRTTMIAHISAAASSYAETLSTIQIASRVLRM 801          
BLAST of Kinesin-like protein KIF26A vs. UniProt/SwissProt
Match: sp|Q2KJY2|KI26B_HUMAN (Kinesin-like protein KIF26B OS=Homo sapiens OX=9606 GN=KIF26B PE=1 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 3.798e-44
Identity = 107/303 (35.31%), Postives = 166/303 (54.79%), Query Frame = 3
Query:  603 LFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNK-NNVCDLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRSNENESL-------THLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGS-------GRHGNEDQQILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTL-NQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRM 1463
            +F FD++     SQ  +   ++ + +  +  G D C+F FGH+ LGK+ +M+G D S+ ++GIIPCA+ W FKLI++ K    + R+ V +SA+EV  K  N+ DLL+ +   S   G S    L +     T L NQ EL A   ++AA  LD+A+A+R +  +         +H+   +H+Y  R++           ++  +SRL L+DLGS        R G      LSL  +  VILAL    +H+PYKE+ L  LL+++L N N  TTM+ HIS+    Y+ETL  +Q+A ++ RM
Sbjct:  506 MFAFDAVFPQDASQAEVCAGTVAEVIQSVVNGADGCVFCFGHAKLGKSYTMIGKDDSMQNLGIIPCAISWLFKLINERKEKTGA-RFSVRVSAVEVWGKEENLRDLLSEVATGSLQDGQSPGVYLCEDPICGTQLQNQSELRAPTAEKAAFFLDAAIASRRSHQQDCDEDDHRNSHVFFTLHIYQYRMEKSG-----KGGMSGGRSRLHLIDLGSCVKALSKNREGGSG-LCLSLSALGNVILALVNGSKHIPYKESKLAMLLRESLGNMNCRTTMIAHISAAVGSYAETLSTIQIASRVLRM 801          
BLAST of Kinesin-like protein KIF26A vs. UniProt/SwissProt
Match: sp|Q9VLW2|KI26L_DROME (Kinesin-like protein CG14535 OS=Drosophila melanogaster OX=7227 GN=CG14535 PE=2 SV=2)

HSP 1 Score: 119.398 bits (298), Expect = 1.610e-25
Identity = 102/391 (26.09%), Postives = 168/391 (42.97%), Query Frame = 3
Query:  432 RFPDNEKINSNKVRVVLKI-----NESRDTPSCLTINKSQNCVGVIDXXXXXXXXXXXXH-------VNLFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGS------------DRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKNNVC---DLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRSNENESL------------THLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLG--SGRHGNEDQQILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTLNQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRMRLKKYR 1481
            R    E     KV+V+L++     N     P  + ++K +  V + DP  +     +            +F FD++ T  D Q  +   +L + +  + +G D C+ + G+   G+ ++++G                   +G  PCA+ W +K I Q +R     R+ V +SA+ VS         DLL +    +  S DS    L D       L    EL A   + AA  LDSALA R   + S             + L   +H+Y   +            V   +SRL ++DLG  + R+G      L L GI  ++LA+ + QRH P+K++ LT LLKD L        ++     EQ Y + L  +Q+A +++R+R +K+R
Sbjct:   33 RLSSRECYGVGKVKVMLRVADRDRNSGGTEPDFMALDKKKRQVTLTDPRTACPPPQAAQERAPMVAAPKMFAFDNLFTGEDKQSDVCASALSEVIPAVLEGSDGCLLAMGYPATGQAQTVLGELGGGSGSGSASGSGVACSLGAAPCAIAWLYKGI-QERRQKSGARFSVRVSAVGVSATKPDALSQDLLISH---AAESDDSPGIYLRDD-----FLGGPTELRAPTAERAALFLDSALAGRLKSSGSTASGSSGCAAPLESALIFTLHVYQYSLS-------RKGGVAGGRSRLHIIDLGGCANRNGG-----LPLSGIGNILLAILSGQRHPPHKDHPLTPLLKDCLAPITCHVAIVAHVRPEQSYQDALSTIQIASRIHRLRRRKHR 402          
BLAST of Kinesin-like protein KIF26A vs. TrEMBL
Match: A0A1S3HWK5 (kinesin-like protein KIF26B OS=Lingula unguis OX=7574 GN=LOC106158841 PE=3 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 1.118e-51
Identity = 162/448 (36.16%), Postives = 239/448 (53.35%), Query Frame = 3
Query:  456 NSNKVRVVLKINE---SRDTPSCLTINKSQNCVGVIDXXXXXXXXXXXXHVN-----LFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKNNVC-DLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRS---NENESLT-HLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGSG-RHGNEDQQILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTLNQ-NFTTTMLLHISSKEQHYSETLQVVQLAYKLYRMRLKKYRSVGFXXXXXXXXXXXXXXXXXXRRLRP--HMG-IXXXXXXXXXXXXXXEVDLTSASELSCCETVIFKGDTNHSLSDKSPDRMSGKRKLRSV 1745
             + KV+V+L+I     S DT S L+ +  +  V V DP+ S  + ++          +F FD + +  DS   I + SL D +  +  G D C+F +GHS LGK+ +M+G D S   +GI+PCA+ W F+LI++ K +    R+ V +SA+EV+ K     DLL+ +      S  S    L +     T L NQ EL A    +AA  LD+A A R+   NE ES T H    +H+Y  RV+   +    +  V   +SRL L+DLGSG +  +   Q LSL  +  VILAL   QRHVP++++ LTQLL++ L   +    M+ H+S   ++Y+ETLQV+QLA +++RMR +    V F  S+ +   SS       RR+RP   MG +      S    ++S  D TS+SE S C+TVI+ G    +LSD  PD    +R   SV
Sbjct:  182 GTGKVKVMLRIAPTDISNDTGSILSSDPRKKQVTVYDPSTSGYATSAHRRTGAAAPKMFAFDQVFSQDDSLTEICSSSLSDIIQSVVNGADGCLFCYGHSKLGKSYTMIGKDGSQQTLGIVPCAIAWLFRLINEQK-DKTGARFSVRVSAVEVAGKQETLRDLLSQVASAETGSNTSPGVYLREDPICGTQLENQSELRAPTADKAAFYLDAACAARTTPDNEEESRTSHFLFTLHVYQYRVEKNGKTGSGA-GVAGGRSRLHLIDLGSGCKAKDSSGQALSLSALGNVILALLNGQRHVPHRDSKLTQLLREALGSLSCRACMIAHVSPTIRNYNETLQVIQLAARIHRMRRRT--KVKF-SSNSSDDSSSCDDSGFGRRMRPGIRMGTLREGIYYSNAVGSTSGEDYTSSSEQS-CDTVIYTGANGQALSD--PDLTDNERPPVSV 621          
BLAST of Kinesin-like protein KIF26A vs. TrEMBL
Match: A0A267GJP5 (Kinesin motor domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010098g2 PE=3 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 7.005e-51
Identity = 168/501 (33.53%), Postives = 249/501 (49.70%), Query Frame = 3
Query:  504 TPSCLTINKSQNCVGVIDXXXXXXXXXXXXHV-NLFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHS-MRYFVSISAIEVSNKN-NVCDLLANLNPLSKLSGDSKSQELSDQDQ-SNTILINQRELPASCLQEAACILDSALATRS---NENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGSGRHGNEDQ-QILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTLNQ-NFTTTMLLHISSKEQHYSETLQVVQLAYKLYRMRLKKYRSVGFXXXXXXXXXXXXXXXXXXRRLR-PHMGIXXXXXXXXXXXXXXEVDLTSASELSCCETVIFKG----DTNHSLSDKSPDRMSGKRKLRSVSSDSDNGFSDMEKSKSLAYNSGNSLSPTIRHRMSPRTNARAWPSTND------SSNCSIEHSSETWVDGPKAV 1946
             PS L ++  +  V V D TP       + +V   F +DS+ T+ +S   +   +L D +  +  G D C+F FG+  LGKT +M+GSD S   +G+IPCA+ W F LI + +R  HS  RY V +SA+EV  ++ ++ DLLA     +  SG + ++    +D  S   L NQ EL A   ++AA  LD+AL  RS    +   ++HL   +HLY  RV    ER+     V   +SRL L+DLGSGR   +     LSL  +  V+++L   QR +P +E+ L QLL++ L        M+  +SS  QH +E+LQ++Q A K+ R+R    R    + +   SS   S    ++ R+R P MG+  A       ++ SEVD +S+SE S C+TVIF G    D  H     +        ++ S S DSD G                        R  PRTNARA PS         ++  ++    E W+DGPKA+
Sbjct:  415 APSNLAVDSRRKQVTVFDTTPQYHRSQGSHNVPKAFIYDSVFTEENSLPELCASALPDIIQGVVNGTDGCVFVFGYGNLGKTHTMMGSDVSPGSLGVIPCAIAWLFHLIQEQQRQQHSTARYSVRVSAVEVQGRDEDLRDLLAG---EAGSSGAASAEVYLREDPISGAQLENQSELRAPTAEKAAHYLDAALYARSQMQQQQNGMSHLLFTLHLYQYRV----ERSGHGRGVAGGRSRLHLIDLGSGRTSRDSGYPALSLAALGNVLISLVNGQRQIPNRESKLGQLLREALGSLTCRACMICQVSSSLQHSTESLQILQFANKIQRLR---RRGGKLTSNSSDSSSCDSFGVRRAGRMRPPQMGLVMASARLNAVTSQSEVDYSSSSEQS-CDTVIFAGGYMTDNEHPPGAAAAAVARRLAQV-SSSEDSDTGTETGGSGGGSG-------------RRVPRTNARARPSLGGRLVGKITAVEALSMQPEQWIDGPKAM 890          
BLAST of Kinesin-like protein KIF26A vs. TrEMBL
Match: A0A210PKW8 (Kinesin-like protein KIF26A OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT09819 PE=3 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 5.644e-50
Identity = 166/490 (33.88%), Postives = 249/490 (50.82%), Query Frame = 3
Query:  462 NKVRVVLKINES----RDTPSCLTINKSQNCVGVIDXXXXXXXXXXXXHV------NLFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKNNVC-DLLANLNP-LSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRS--NENESL-THLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGSGRHGNEDQQI-LSLQGISKVILALYTSQRHVPYKENVLTQLLKDTL-NQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRMRLKKYRSVGFXXXXXXXXXXXXXXXXXXRRLRPHMGIXXXXXXXX--XXXXXXEVDLTSASELSCCETVIFKGDTNHSLSDKS------------------PDRMSGKRKLRSVSSDSDNGFSDMEKSKSLAYNSGNSL 1820
             KV+V+LKI  S        S L I+  +  V V DPT +  +  +           +F FD++ +  DSQ  +   SL + +  +  G D C+F++G+S LGK+ +MVG D+S   +GIIPCA+ W F+LI++ K      R+ V +SA+EV+ K     DLL+++   +   SG +    L +     T L NQ EL A   + A   LD+A+A R+  +E ES  +HL   +H+Y  R++   +       V   +SRL L+DLGS     +   + LSL  +  VI+AL   QRHVP++++ + QLL+D+L N +  T M+ H+SS   HY+ETLQV+QLA K++RMR +K +         +S+ S  SS    R  RP  G            +S+ S+ D TS+SE S C+TVI+ G    SLSD+                   P R  G R      S+SD+G S     +    N G S+
Sbjct:  670 GKVKVMLKICPSTHYGEQGNSFLAIDPRKKQVTVYDPTAAGFTTAAHRRTATTTAPKMFAFDAVFSPDDSQTEVCASSLTEIIQGVVNGADGCLFTYGYSKLGKSYTMVGQDQSAHTLGIIPCAIAWLFRLINEQKEKT-GARFSVRVSAVEVTGKAECLKDLLSDVAAGVESGSGTAPGVYLREDPICGTQLENQSELRAPTAERATYYLDAAIAARTKLDEEESRSSHLLFTLHVYQYRIEKANQAGLP--GVAGGRSRLHLIDLGSSSKSKDPGNVSLSLSALGNVIMALLNGQRHVPHRDSKVAQLLRDSLGNISCRTCMIAHVSSAVPHYNETLQVIQLAAKIHRMRRRKTK--------FSSTSSDDSSTDDGRLRRPFRGFRMGTLREDILYTSSHSDPDHTSSSEQS-CDTVIYVGANGQSLSDRELTDHEGPPRSVPRTNPRLPRRPGGSRSSGDEGSNSDSGRSHHSDFRIRKPNMGTSI 1147          
BLAST of Kinesin-like protein KIF26A vs. TrEMBL
Match: A0A0R3SED9 (Kinesin motor domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS3124 PE=3 SV=2)

HSP 1 Score: 204.912 bits (520), Expect = 3.480e-49
Identity = 166/520 (31.92%), Postives = 263/520 (50.58%), Query Frame = 3
Query:  603 LFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEV-SNKNNVCDLLANLNPLSKLSGD-------SKSQELSDQDQS---------------------NTILINQRELPASCLQEAACILDSALATRSNENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGSGRHGNED----------QQILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTLNQNFTTTMLL-HISSKEQHYSETLQVVQLAYKLYRMRLKKYR--------------SVGFXXXXXXXXXXXXXXXXXXRRLRPHMGIXXXXXXXXXXXXXXEVDLTSASELSCC-ETVIFKGDTNHSLSDKSPDRMSGKRKLRSV------SSDSDNGF----SDMEKS---KSLAYN-SGNSLSP-TIRHRMSPRTNARAWPSTNDSSNCS--IEHSSETWVDGPKAV 1946
            +F FDS+ T  D    + + +L D V  +  G DSC+  FGH+   K+++M+GSD S++ +G+IPCA+ W F+LI++ K    + R+ V +SA+EV  ++ +  DLL      S L GD       + S  L D   S                     + ++    E+ A     AA +LD ALA R+ +N +L+H    +H+Y  +V    E+N     V+  +SRL LL LG GR+G+++           + LSL  I+ V+L L T QR +P++E+ +TQLL++ +  N     ++ H S ++QHYSETLQV+QLA KL+R+R ++                S+G + SD ++S     S L +   RP +G         +S  +S  D TS+SE SC  +TVI+ G  + +     P  ++    + S       +S  + G     S  EK+   +SL+++ SG +L P  +  R++PRTNA AWP           +  + ETWVDGP A+
Sbjct:  312 MFSFDSVFTQDDPLAEVCSAALTDAVYSVVHGTDSCVLCFGHAKTSKSRTMLGSDTSVTSLGVIPCAIAWLFRLIEEQKEATKT-RFSVRVSAVEVFGHEESFKDLLQE----SALEGDDDHLPGPAPSSYLRDNSPSPKNRSISNPATAADNTPAARLSQVMDKLTEIRAPAAGHAAHLLDVALANRA-QNTALSHTLFTLHVYQYKV----EKNGAETEVSGGRSRLQLLYLGCGRYGSKEIGQGQEQSSTPKSLSLANIANVLLGLLTGQRQLPHRESAVTQLLREGMTGNHAQPCIIAHASGQQQHYSETLQVIQLASKLHRLRRRRVGSSGGSSAGGSNWNTSIGGTASDSSTSSRGFRSRLST---RPRLG--------RSSFGASTTDYTSSSEQSCAGDTVIYLGGASETEGSLGPRGLADGSVVHSADEWKKYASSGEEGTLQRSSSAEKTRIGRSLSHSESGGTLRPGGLIKRVTPRTNATAWPRAAAVRKGKEMVSSTEETWVDGPNAM 810          
BLAST of Kinesin-like protein KIF26A vs. TrEMBL
Match: A0A1I8I4F2 (Kinesin motor domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 4.439e-49
Identity = 168/504 (33.33%), Postives = 246/504 (48.81%), Query Frame = 3
Query:  504 TPSCLTINKSQNCVGVIDXXXXXXXXXXXXHV-NLFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHS-MRYFVSISAIEVSNKN-NVCDLLANLNPLSKLSGDSKSQE----LSDQDQSNTILINQRELPASCLQEAACILDSALATRS---NENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGSGRHGNEDQ-QILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTLNQ-NFTTTMLLHISSKEQHYSETLQVVQLAYKLYRMRLKKYRSVGFXXXXXXXXXXXXXXXXXXRRLR-PHMGIXXXXXXXXXXXXXXEVDLTSASELSCCETVIFKG----DTNHSLSDKSPDRMSGKRKLRSVSSDSDNGFSDMEKSKSLAYNSGNSLSPTIRHRMSPRTNARAWPSTND------SSNCSIEHSSETWVDGPKAV 1946
             PS L ++  +  V V D TP       + +V   F +DS+ T+ +S   +   +L D +  +  G D C+F FG+  LGKT +M+GSD S   +G+IPCA+ W F LI + +R  HS  RY V +SA+EV  ++ ++ DLLA         G S +      L +   S   L NQ EL A   ++AA  LD+AL  RS    +   ++HL   +HLY  RV    ER+     V   +SRL L+DLGSGR   +     LSL  +  V+++L   QR +P +E+ L QLL++ L        M+  +SS  QH +E+LQ++Q A K+ R+R    R    + +   SS   S    ++ R+R P MG+  A       ++ SEVD +S+SE S C+TVIF G    D  H     +        ++ S S DSD G                        R  PRTNARA PS         ++  ++    E W+DGPKA+
Sbjct:   21 APSNLAVDSRRKQVTVFDTTPQYHRSQGSHNVPKAFIYDSVFTEENSLPELCASALPDIIQGVVNGTDGCVFVFGYGNLGKTHTMMGSDVSPGSLGVIPCAIAWLFHLIQEQQRQQHSTARYSVRVSAVEVQGRDEDLRDLLAGEAGGGGGGGSSGAASAEVYLREDPISGAQLENQSELRAPTAEKAAHYLDAALYARSQMQQQQNGMSHLLFTLHLYQYRV----ERSGHGRGVAGGRSRLHLIDLGSGRTSRDSGYPALSLAALGNVLISLVNGQRQIPNRESKLGQLLREALGSLTCRACMICQVSSSLQHSTESLQILQFANKIQRLR---RRGGKLTSNSSDSSSCDSFGVRRAGRMRPPQMGLVMASARLNAVTSQSEVDYSSSSEQS-CDTVIFAGGYMTDNEHPPGAAAAAVARRLAQV-SSSEDSDTGTETGGSGGGSG-------------RRVPRTNARARPSLGGRLVGKITAVEALSMQPEQWIDGPKAM 502          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Cavefish
Match: kif26aa (kinesin family member 26Aa [Source:ZFIN;Acc:ZDB-GENE-041001-148])

HSP 1 Score: 184.882 bits (468), Expect = 2.474e-46
Identity = 135/382 (35.34%), Postives = 202/382 (52.88%), Query Frame = 3
Query:  606 FPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKNNV-CDLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRS-------NENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGS-------GRHGNEDQQILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTL-NQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRMRLKKYRSVGFXXXXXXXXXXXXXXXXXXRRLRPHMGIXXXXXXXXXXXXXXEVDLTSASELSCCETVIFKGDTNHSLSDK 1703
            F FD++ T   SQ  + + ++ + +  +  G D CIF FGH+ LGK+ +M+G D +  ++G+ PCA+ W FKLI++ ++     R+ V +SA+E+S +  V  DLLA+  P +          L +   S + L NQ EL A   + AA  LDSALA RS       +E    +H+   +H+   R++  A+       ++  +SRL LLDLGS        R G    Q LSL  +  VILAL    +HVPY+++ LT LL+++L N N  TTM+ HIS    +Y+E+L  VQLA +++RMR KK +    S S    S        Q   LRP      A      +  SS+ D +S+SE SC +TVI+ G     +SD+
Sbjct:  455 FNFDAVFTQDASQAEVCSGTVAEVIQSVVNGADGCIFCFGHANLGKSYTMIGRDSTTQNLGVAPCAISWLFKLIEE-RKEKAGARFSVRVSAVEISGREEVLTDLLADFAPSTSQDSQGAGVYLREDPVSGSQLQNQSELRACSAERAAFFLDSALAARSTSKPECEDEQRCNSHMLFTLHITQYRMEKSAK-----GGMSGGRSRLHLLDLGSCESDLSKTRDGG-GGQCLSLSALGNVILALANGAKHVPYRDSKLTMLLRESLGNINCRTTMIAHISDSPANYTESLSTVQLASRIHRMRKKKSKYT--SSSSGGESSCEEGQIRQPAHLRPFHPRTVALDPEHPALLSSDPDYSSSSEHSC-DTVIYVGPGGAPMSDR 826          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Cavefish
Match: kif26aa (kinesin family member 26Aa [Source:ZFIN;Acc:ZDB-GENE-041001-148])

HSP 1 Score: 184.496 bits (467), Expect = 2.893e-46
Identity = 135/382 (35.34%), Postives = 202/382 (52.88%), Query Frame = 3
Query:  606 FPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKNNV-CDLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRS-------NENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGS-------GRHGNEDQQILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTL-NQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRMRLKKYRSVGFXXXXXXXXXXXXXXXXXXRRLRPHMGIXXXXXXXXXXXXXXEVDLTSASELSCCETVIFKGDTNHSLSDK 1703
            F FD++ T   SQ  + + ++ + +  +  G D CIF FGH+ LGK+ +M+G D +  ++G+ PCA+ W FKLI++ ++     R+ V +SA+E+S +  V  DLLA+  P +          L +   S + L NQ EL A   + AA  LDSALA RS       +E    +H+   +H+   R++  A+       ++  +SRL LLDLGS        R G    Q LSL  +  VILAL    +HVPY+++ LT LL+++L N N  TTM+ HIS    +Y+E+L  VQLA +++RMR KK +    S S    S        Q   LRP      A      +  SS+ D +S+SE SC +TVI+ G     +SD+
Sbjct:  429 FNFDAVFTQDASQAEVCSGTVAEVIQSVVNGADGCIFCFGHANLGKSYTMIGRDSTTQNLGVAPCAISWLFKLIEE-RKEKAGARFSVRVSAVEISGREEVLTDLLADFAPSTSQDSQGAGVYLREDPVSGSQLQNQSELRACSAERAAFFLDSALAARSTSKPECEDEQRCNSHMLFTLHITQYRMEKSAK-----GGMSGGRSRLHLLDLGSCESDLSKTRDGG-GGQCLSLSALGNVILALANGAKHVPYRDSKLTMLLRESLGNINCRTTMIAHISDSPANYTESLSTVQLASRIHRMRKKKSKYT--SSSSGGESSCEEGQIRQPAHLRPFHPRTVALDPEHPALLSSDPDYSSSSEHSC-DTVIYVGPGGAPMSDR 800          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Cavefish
Match: kif26ab (kinesin family member 26A [Source:NCBI gene;Acc:103039212])

HSP 1 Score: 182.57 bits (462), Expect = 1.072e-45
Identity = 121/367 (32.97%), Postives = 195/367 (53.13%), Query Frame = 3
Query:  447 EKINSNKVRVVLKI------NESRDTPSCLTINKSQNCVGVIDXXXXXXXXXXXXHVNL-----FPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKN-NVCDLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRSN-------ENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGS-------GRHGNEDQQILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTL-NQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRMR 1466
            E     KV+V+++I       ES D+ S L +++ +  + + +P+   +   +     L     F FD++ T   SQ  + + ++ + +  +  G D CIF FGH  LGKT +M+G D S   +GI PCA+ W FKLI + K    + R+ V +SA+E+  K+ ++ DLL++++  S   G S    L +     T L NQ EL A   ++AA  LD+A+A RS        E+   +H+   +H+Y  R++           ++  +SRL L+DLGS        R G      LSL  +  VILAL    +HVPY+++ LT LL+D+L N N  TTM+ H+S    HY+++L  +QLA +++R+R
Sbjct:  388 ENPGMGKVKVMMRICPSLGVQESSDSMSFLKVDQRKKQLTLYEPSLLAQPTAAHRRTPLAAPKMFAFDAVFTQDASQAEVCSGTVAEVIQSVVNGADGCIFCFGHVKLGKTYTMIGKDSSAQSLGIAPCAISWLFKLISERKEKTGT-RFSVRVSAVEIYGKDESLQDLLSDVSSGSLQDGQSPGVYLREDPICGTQLQNQSELRAPTAEKAAHFLDAAIAARSTSRPDADEEDRRNSHMLFTLHIYQYRMEKSG-----KGGMSGGRSRLHLIDLGSCEKVLSKSRDGG-GGLCLSLTALGNVILALANGAKHVPYRDSKLTMLLRDSLGNINCRTTMIAHVSDSPAHYADSLTTIQLASRIHRVR 747          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Cavefish
Match: kif26ab (kinesin family member 26A [Source:NCBI gene;Acc:103039212])

HSP 1 Score: 182.57 bits (462), Expect = 1.115e-45
Identity = 109/304 (35.86%), Postives = 169/304 (55.59%), Query Frame = 3
Query:  603 LFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKN-NVCDLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRSN-------ENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGS-------GRHGNEDQQILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTL-NQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRMR 1466
            +F FD++ T   SQ  + + ++ + +  +  G D CIF FGH  LGKT +M+G D S   +GI PCA+ W FKLI + K    + R+ V +SA+E+  K+ ++ DLL++++  S   G S    L +     T L NQ EL A   ++AA  LD+A+A RS        E+   +H+   +H+Y  R++           ++  +SRL L+DLGS        R G      LSL  +  VILAL    +HVPY+++ LT LL+D+L N N  TTM+ H+S    HY+++L  +QLA +++R+R
Sbjct:  424 MFAFDAVFTQDASQAEVCSGTVAEVIQSVVNGADGCIFCFGHVKLGKTYTMIGKDSSAQSLGIAPCAISWLFKLISERKEKTGT-RFSVRVSAVEIYGKDESLQDLLSDVSSGSLQDGQSPGVYLREDPICGTQLQNQSELRAPTAEKAAHFLDAAIAARSTSRPDADEEDRRNSHMLFTLHIYQYRMEKSG-----KGGMSGGRSRLHLIDLGSCEKVLSKSRDGG-GGLCLSLTALGNVILALANGAKHVPYRDSKLTMLLRDSLGNINCRTTMIAHVSDSPAHYADSLTTIQLASRIHRVR 720          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Cavefish
Match: kif26ab (kinesin family member 26A [Source:NCBI gene;Acc:103039212])

HSP 1 Score: 182.57 bits (462), Expect = 1.167e-45
Identity = 109/304 (35.86%), Postives = 169/304 (55.59%), Query Frame = 3
Query:  603 LFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKN-NVCDLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRSN-------ENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGS-------GRHGNEDQQILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTL-NQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRMR 1466
            +F FD++ T   SQ  + + ++ + +  +  G D CIF FGH  LGKT +M+G D S   +GI PCA+ W FKLI + K    + R+ V +SA+E+  K+ ++ DLL++++  S   G S    L +     T L NQ EL A   ++AA  LD+A+A RS        E+   +H+   +H+Y  R++           ++  +SRL L+DLGS        R G      LSL  +  VILAL    +HVPY+++ LT LL+D+L N N  TTM+ H+S    HY+++L  +QLA +++R+R
Sbjct:  426 MFAFDAVFTQDASQAEVCSGTVAEVIQSVVNGADGCIFCFGHVKLGKTYTMIGKDSSAQSLGIAPCAISWLFKLISERKEKTGT-RFSVRVSAVEIYGKDESLQDLLSDVSSGSLQDGQSPGVYLREDPICGTQLQNQSELRAPTAEKAAHFLDAAIAARSTSRPDADEEDRRNSHMLFTLHIYQYRMEKSG-----KGGMSGGRSRLHLIDLGSCEKVLSKSRDGG-GGLCLSLTALGNVILALANGAKHVPYRDSKLTMLLRDSLGNINCRTTMIAHVSDSPAHYADSLTTIQLASRIHRVR 722          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001911.1 (pep scaffold:Pmarinus_7.0:GL476451:251877:270556:1 gene:ENSPMAG00000001737.1 transcript:ENSPMAT00000001911.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 89.3521 bits (220), Expect = 1.087e-19
Identity = 47/142 (33.10%), Postives = 75/142 (52.82%), Query Frame = 3
Query:  600 NLFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKNNVCDLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELP 1025
             +FPFD++ +   SQ  +   ++ + +  +  G D CIF FG++ LGKT +M+GS  S   +G+ PCA+ W F+LI++ K    + R+ V +SA+EVS +            L  L  D  S    D +QS  + +  RE P
Sbjct:  128 KIFPFDAVFSQDASQAEVCAGAVPEIIQSVVNGADGCIFCFGNAKLGKTYTMLGSGDSSQALGVAPCAISWLFRLIEERKERTGA-RFSVRVSAVEVSGRGEA---------LGDLLSDVASGTTQDDNQSPGVFL--REDP 257          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Sea Lamprey
Match: kif6 (kinesin family member 6 [Source:ZFIN;Acc:ZDB-GENE-061027-130])

HSP 1 Score: 85.5001 bits (210), Expect = 5.157e-17
Identity = 84/303 (27.72%), Postives = 148/303 (48.84%), Query Frame = 3
Query:  606 FPFDSILTDSDSQEFIFTDSLVDPVLE-LFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKNNVCDLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELP---ASCLQEAACIL----DSALATRSNENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLG-------SGRHG---NEDQQI-LSLQGISKVILALYTSQR-HVPYKENVLTQLLKDTLNQNFTTTMLLHISSKEQHYSETLQVVQLAYKL 1454
            F F  I      QE IF +++  PV + +  G +  IF++G +G GKT ++ G     +  GIIP  L + F   +Q +++ + + Y   IS +E+ N+N   DLL   +  SKL    K   + D DQ    +++ + L    AS  +EA  +L     + +   +  N++ T    I  L+ C          +  + T  +S+L L+DL        +G  G    E + I LSL  + +VI+AL    R HVPY+ +++T +L+D+L  N  TTM+  ++  +++  E++   + A ++
Sbjct:   56 FQFKKIFDQQAKQEEIF-ETIARPVADSVLSGYNGTIFAYGQTGSGKTFTITGGAERFADRGIIPRILGYLF---EQFQKDTNRV-YTAHISYLEIYNENGY-DLLNPRHEASKLEDLPKVTLMEDTDQ----IVHLKNLSLHQASSQEEALNLLFLGDTNRMIAETPMNQASTRSHCIFTLHVC--------GREPGSTTLCRSKLHLVDLAGSERVSKTGVGGILLTEAKYINLSLHYLEQVIIALSEKNRSHVPYRNSMMTSVLRDSLGGNCMTTMIATLAVDKRNIDESISTCRFAQRV 340          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010492.1 (pep scaffold:Pmarinus_7.0:GL478879:14589:34633:-1 gene:ENSPMAG00000009502.1 transcript:ENSPMAT00000010492.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.9518 bits (193), Expect = 2.053e-15
Identity = 77/302 (25.50%), Postives = 145/302 (48.01%), Query Frame = 3
Query:  606 FPFDSILTDSDSQEFIFTDSLVDPVL-ELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKNNVCDLLA--NLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRSNENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDL-GSGRHGNED---QQIL-------SLQGISKVILALYTSQRHVPYKENVLTQLLKDTLNQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRMRL 1469
            F FD +   + +QE +F D+L  P++     G + CI ++G +G GKT +M+G+  +       P   + + K +  + +  H+++Y + IS +E+ N+  V DLL      PL ++ G ++S  ++    + TI+ ++ ++    + E A    +  +T+ N + S +HL   + L             D  + ++    LIL DL GS R    +   Q+++       SL  + +V LAL     HVPY+ + LT LL+  L  N    + + +S+ + +  ETL  +Q    + ++ L
Sbjct:  102 FAFDQVFPPNATQEQVFADTL--PLITSCVDGYNVCILAYGQTGSGKTHTMMGTSNA-------PGVNVRSVKELLNICKERHNVKYTLKISMLEIYNET-VRDLLGKPGSGPL-EVRGQARS--VTVPGLTTTIVTSEEDIVR--VMETAHKHRTVASTKMNIHSSRSHLLTTLSL----------EGLDVVSGSASHGSLILGDLAGSERISRTEATGQRLVEAAAINKSLTSLGQVFLALRNGSLHVPYRNSKLTHLLQPALGGNAKACVFVTVSADDANRGETLSTLQFGSSIRQVAL 378          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Sea Lamprey
Match: kif3a (kinesin family member 3A [Source:ZFIN;Acc:ZDB-GENE-050417-71])

HSP 1 Score: 77.7962 bits (190), Expect = 1.231e-14
Identity = 86/305 (28.20%), Postives = 145/305 (47.54%), Query Frame = 3
Query:  606 FPFDSILTDSDSQEFIF---TDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHI-GIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKNNVCDLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILD---------SALATRSNENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDL-GSGRH---GNEDQQI-------LSLQGISKVILALYTSQR-HVPYKENVLTQLLKDTLNQNFTTTMLLHISSKEQHYSETLQVVQLA 1445
            F FD++      Q  ++      +VD VLE + G    IF++G +G GKT +M G  R++  + GIIP +    F  I + + +    R+ V +S +E+ N+  V DLL          G  ++Q L  +++ + + +  ++L A  +  A  +           S  +T  NE+ S +H    I +  C     +E+  D N +  +  +L L+DL GS R    G   Q++       LSL  +  VI AL   +  HVPY+ + LT+LL+D+L  N  T M  +I   + +Y ET+  ++ A
Sbjct:   62 FTFDTVFGTESKQVDVYNLTARPIVDSVLEGYNG---TIFAYGQTGTGKTFTMEGI-RAVPELRGIIPNSFAHIFGHIAKAEGDT---RFLVRVSYLEIYNEE-VKDLL----------GKDQTQRLEVKERPD-VGVYVKDLSAFVVNNADDMDRIMTLGHKNRSVGSTNMNEHSSRSHAIFTITI-EC-----SEKGVDGN-MHVRMGKLHLVDLAGSERQTKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYA 340          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Sea Lamprey
Match: kifc3 (kinesin family member C3 [Source:ZFIN;Acc:ZDB-GENE-030131-3724])

HSP 1 Score: 75.8702 bits (185), Expect = 2.584e-14
Identity = 79/300 (26.33%), Postives = 135/300 (45.00%), Query Frame = 3
Query:  606 FPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKNNVCDLLANLNPLSKLSGDSKSQELSDQDQSNTILI-NQRELPASCLQEAACILDSALATRS------NENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGS----------GRHGNEDQQI-LSLQGISKVILALYTSQRHVPYKENVLTQLLKDTLNQNFTTTMLLHISSKEQHYSETLQVVQLAYK 1451
            F  D +     SQE +F + + D V     G + CIF++G +G GKT +M  +  +    GI   AL   F+   +++      RY +S+S +E+ N+  + DLL +        G  +       D S  + +   R+ P + L +   ++    + R+      NE+ S +H  +++         V+  N  S   TS + RL L+DL            G    E Q I  SL  +  VI AL   Q HVP++ + LT LL+D+L +   T M++ ++   +H +ET+  +  A +
Sbjct:  127 FQLDRVFPPHASQEEVFRE-VQDLVTSCVDGYNICIFAYGQTGSGKTYTMERAQGTAKAPGINQRALQHLFQ---EMEERQDEWRYTLSLSMLEIYNET-LRDLLGS-------EGHGRLDIRLCPDGSGELCVPGLRQEPVTSLGDVHRLVSLGHSNRATHCTNMNEHSSRSHALILV--------TVSATN--SITGTSTRGRLNLVDLAGSERLAKSRAEGDRLREAQNINRSLAALGDVIQALRAKQAHVPFRNSKLTYLLQDSLARESKTLMVIQVAPAARHAAETICSLHFAQR 404          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Yeast
Match: KAR3 (Minus-end-directed microtubule motor; functions in mitosis and meiosis, localizes to the spindle pole body and localization is dependent on functional Cik1p, required for nuclear fusion during mating; potential Cdc28p substrate [Source:SGD;Acc:S000006345])

HSP 1 Score: 83.9593 bits (206), Expect = 1.108e-16
Identity = 103/347 (29.68%), Postives = 158/347 (45.53%), Query Frame = 3
Query:  465 KVRVVLKINESRDTPSCLTINKSQNCVGVIDXXXXXXXXXXXXHVNLFPFDSILTDSDSQEFIFTD--SLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKNNVCDLLANLNPLSKLSGDSKSQELSDQDQSNTILIN------QRELPASCLQEAACILDSALATRSNENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGSGRHGNEDQQI-LSLQGISKVILALY---TSQRHVPYKENVLTQLLKDTLNQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRMRL 1469
            ++R  LK  E+ DT S + +N+  +  GV   +       +T  V+ F FD I    D+   +F +   LV   L+   G + CIF++G +G GKT +M+         GIIP  +   F  I++LK       Y V+   IE+ N+N V  L ++ N     S   K +   DQ+   T + N      + E     + + A  L S  +T SNE+ S +H   IIHL        A      N V    S  I +    G    E Q I  SL  +  VI AL    +++RH+P++ + LT LL+ +L  +  T M ++IS    H +ETL  ++ A K+   RL
Sbjct:  392 RIRPALKNLENSDT-SLINVNEFDDNSGV--QSMEVTKIQNTAQVHEFKFDKIFDQQDTNVDVFKEVGQLVQSSLD---GYNVCIFAYGQTGSGKTFTMLNPGD-----GIIPSTISHIFNWINKLK--TKGWDYKVNCEFIEIYNENIVDLLRSDNNNKEDTSIGLKHEIRHDQETKTTTITNVTSCKLESEEMVEIILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNAKTGAHSYGTLNLVDLAGSERINVSQVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLMFVNISPSSSHINETLNSLRFASKVNSTRL 725          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Yeast
Match: KIP3 (Kinesin-related antiparallel sliding motor protein; involved in mitotic spindle positioning; sliding activity promotes bipolar spindle assembly and maintenance of genome stability; inhibits spindle elongation, destabilizing late anaphase spindle microtubules that polymerize beyond the midzone [Source:SGD;Acc:S000003184])

HSP 1 Score: 71.633 bits (174), Expect = 7.906e-13
Identity = 82/313 (26.20%), Postives = 145/313 (46.33%), Query Frame = 3
Query:  606 FPFDSILTDSDSQEFIF---TDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKNNVCDLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACIL------DSALATRSNENESLTHLQLIIHLYHCR--VDAVAERN---------CDSNNVTSKKSRLILLDLGSGRHGNEDQQILSLQG-ISKVILALYTSQRHVPYKENVLTQLLKDTLNQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRMRLKKYR 1481
            F FD +  ++ SQ  ++   T  L+D VL+   G +S +F++G +G GKT ++ G+    S  GII  A+   F  I  LK       + +S+S +E+ N+  + DLL    P       SK   + +  Q++  + N      + +++   ++       +   T +NE  S +H  L IH+      VD  ++             S    + ++R I L  G     N ++ +L+L   I+ + L   +   H+PY+++ LT+LLK +L  N  T M++ IS    HY ETL  ++ A +   ++ K  R
Sbjct:  153 FVFDKLFDETSSQARVYKETTSPLLDSVLD---GFNSTVFAYGATGCGKTYTVSGTP---SQPGIIFLAMEELFNKITDLKDEKD---FEISLSYLEIYNER-IRDLLKPETP-------SKRLVIREDTQNHIKVANLSYHHPNTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNKLVDLTSQHTFATLSIIDLAGSERAAATRNRGIRLHEG----ANINRSLLALGNCINALCLNDGSRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTKIIR 444          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Yeast
Match: KIP1 (Kinesin-related motor protein; required for mitotic spindle assembly, chromosome segregation, and 2 micron plasmid partitioning; functionally redundant with Cin8p for chromosomal but not plasmid functions [Source:SGD;Acc:S000000159])

HSP 1 Score: 71.2478 bits (173), Expect = 1.043e-12
Identity = 80/315 (25.40%), Postives = 136/315 (43.17%), Query Frame = 3
Query:  606 FPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSI-------------SHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKNNVCDLLANLNPLSKLSGDSKSQELSDQDQSNT---------ILINQRELPASCLQEAACILDSALATRSNENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGSG----RHGNEDQQIL-------SLQGISKVILALYTSQRHVPYKENVLTQLLKDTLNQNFTTTMLLHISSKEQHYSETLQVVQLAYK 1451
            + FD +      QE +F  +  + + E+  G +  IF++G +G GKT +M G D +I              H GIIP  L+  FK +  L +      Y V IS +E+ N+N    L  + +    ++   +   + D + +N+         I IN      + L + +     A AT+ N+  S +H    I       D+   ++   N    K  +L L+DL       R G E+++         SL  + +VI AL     H+PY+E+ LT+LL+D+L     T ++  IS  +    ET   ++ A +
Sbjct:  102 YQFDQVFGAESDQETVFNATAKNYIKEMLHGYNCTIFAYGQTGTGKTYTMSG-DINILGDVQSTDNLLLGEHAGIIPRVLVDLFKELSSLNK-----EYSVKISFLELYNENLKDLLSDSEDDDPAVNDPKRQIRIFDNNNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVA-ATKCNDLSSRSHTVFTITTNIVEQDS---KDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATR 406          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Nematostella
Match: EDO49027 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHS1])

HSP 1 Score: 133.65 bits (335), Expect = 3.289e-34
Identity = 86/255 (33.73%), Postives = 134/255 (52.55%), Query Frame = 3
Query:  603 LFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKN-NVCDLLANLNPLSKLSGD--SKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRSN-------ENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGS-----GRHGNEDQQILSLQGISKVILALYTSQRHVPYK 1322
            +F FD I     SQ  + + SLVD +  +  G D C+F++GH+GLGKT +M+G D S   IG++PCAL W F+LI   K+   + ++ V +SA+E+  ++ N  DLLA        + +  S S  L +       L+N  EL AS  ++AA  LD+ALA R+        +    +H+   +H+Y  RV+  ++       V   +SRL L+DL S     G   +     +S+ G+  VI+AL    +HVP+K
Sbjct:   50 MFAFDGIYEPDASQSEVCSGSLVDIIQTVVNGSDGCLFTYGHAGLGKTFTMMGRDESDQTIGVLPCALAWLFRLISDQKQKTGT-KFSVRVSAVEIVGRSENWRDLLAATTSTENGTNETVSPSVFLREGKSGGMQLLNPSELRASSAEKAAFYLDAALAARTRPSGDNGPDETKNSHMFFTVHIY--RVEKHSKST--GGKVHGGRSRLHLIDLASCEGYTGSKKDGGASSMSIAGLGNVIIALINGAKHVPHK 299          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Nematostella
Match: EDO34961 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMV5])

HSP 1 Score: 91.6633 bits (226), Expect = 2.630e-19
Identity = 83/294 (28.23%), Postives = 140/294 (47.62%), Query Frame = 3
Query:  606 FPFDSILTDSDSQEFIFTD--SLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKNNVCDLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSAL------ATRSNENESLTHLQLIIHLYHCRVDAVAERNCDS--NNVTSKKSRLILLDLGSGRHGNEDQQI-LSLQGISKVILALYTSQRHVPYKENVLTQLLKDTLNQNFTTTMLLHISSKEQHYSETLQVVQLAYKL 1454
            F FD +   +  Q  +F +   LV   L+   G + CIF++G +G GKT +M G   ++ H G+IP ++   F  ++  K      +Y + +S +E+ N+  + DLL + +   K   + K    S+   S  ++ N +        +   +L +A       AT  NE  S +H   I+ L     +++ E +C    N V    S  +     SG    E + I  SL  +S VI+AL   + HVPY+ + LT LLK++L  N  + M ++IS +E+   ETL  ++ A K+
Sbjct:   92 FSFDKVFQHTSKQAQVFEEISQLVQSALD---GYNVCIFAYGQTGSGKTYTMEGDHNNLEHRGMIPRSMEQVF--LNTHKLQEKGWKYKMDVSFLEIYNET-IRDLLGSGDETIK--HEIKMVNGSNSTNSQVMVTNLKTFEVEDESQVYSLLKTASQNRAVGATACNERSSRSHSVFIMKL--TGENSITEESCSGTLNLVDLAGSERLGQSCASGDRLKETKNINKSLSTLSSVIIALANKEGHVPYRNSKLTYLLKNSLGGNSKSLMFVNISPREESLQETLCSLRFATKV 375          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Nematostella
Match: EDO39610 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9N5])

HSP 1 Score: 87.8113 bits (216), Expect = 4.701e-18
Identity = 83/301 (27.57%), Postives = 141/301 (46.84%), Query Frame = 3
Query:  603 LFPFDSILTDSDSQEFIFTDSLVDPVLE-LFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIP-CALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKNNVCDLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRS------NENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLG----------SGRHGNEDQQI-LSLQGISKVILALYTSQ-RHVPYKENVLTQLLKDTLNQNFTTTMLLHISSKEQHYSETLQVVQLA 1445
            +F FD +     + E ++++ +V P+++ + +G +  +F++G +  GKT +M GS +  S +GI P C       +  + +R N    Y + +S +E+ N+  + DLL   N  S L       E+ +       +     +   C ++ A IL+   A RS      N + S +H   II L    V+   E  C  N       +L L+DL           +G    E  +I LSL  +  VI AL   + +H+PY+++ LT+LL+D+L  N  T M+  IS    +Y ETL  ++ A
Sbjct:   51 VFTFDGVYGSQCNTEKLYSE-IVHPIVDGVLEGYNGTVFAYGQTSCGKTFTMQGSAQPESQVGITPRCCRHILNSMQGKGRRRNRE--YLLHVSYLEIYNEE-IRDLLVK-NTRSNL-------EIKEHPDKGMYVKGLSSITVDCYEDMAEILEIGSANRSVGSTCMNTDSSRSHSIFIIDL-QVNVNKGGEGECVRN------GKLNLVDLAGSERQSKSGATGERFREATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRLLQDSLGGNSKTLMVACISPGSNNYEETLSTLRYA 332          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Nematostella
Match: EDO38591 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCK0])

HSP 1 Score: 89.3521 bits (220), Expect = 1.059e-17
Identity = 96/316 (30.38%), Postives = 145/316 (45.89%), Query Frame = 3
Query:  597 VNLFPFDSILTDSDSQEFIFT------DSLVDPVLE-LFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKNNVCDLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACIL------DSALATRSNENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDL-GSGRH---GNEDQQI-------LSLQGISKVI--LALYTSQRH-------VPYKENVLTQLLKDTLNQNFTTTMLLHISSKEQHYSETLQVVQLA 1445
            V+ F FD      D+ +  F       + L   VLE  F+G ++CIF++G +G GKT +M+G+       GIIP   +  F+ I Q   +NH + Y V +S IE+ N+  V DLL          G S S  + +       +    +L  S  ++   I+       +  ATR N   S +H    I L      A  E +  + ++  K S+L L+DL GS R    G E  ++        SL  + +VI  LA  ++ +H       VPY+++VLT LLKD L  N  T M+  IS    +Y ETL  ++ A
Sbjct:   52 VHNFAFDHCFWSIDAAKTKFAAQDKVYECLGSDVLENAFEGYNACIFAYGQTGSGKTYTMMGAGEDK---GIIPRLCVNLFRGISQ--NDNHDITYKVEVSYIEIYNEK-VRDLLCP-------RGGSASLRVREHKVMGPYVEGLTKLVVSSFEDIEAIMMEGNKSRTVAATRMNTESSRSHAVFNILL------ARTEYDHQTESIGEKVSKLSLVDLAGSERACKTGAEGDRLKEGSNINRSLVTLGQVISSLAEQSAGKHGKKGAHFVPYRDSVLTWLLKDNLGGNSKTVMVATISPSADNYEETLSTLRYA 348          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Nematostella
Match: EDO39270 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAG0])

HSP 1 Score: 87.4261 bits (215), Expect = 2.083e-17
Identity = 90/356 (25.28%), Postives = 161/356 (45.22%), Query Frame = 3
Query:  459 SNKVRVVLKINESRDTPSCLTINKSQN-----CVGVIDXXXXXXXXXXXXHVNLFPFDSILTDSDSQEFIFTDSLVDPVLE-LFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKNNVCDLLANLNPLSKLSGDSKSQELS-DQDQSNTILINQ-RELPASCLQEAACILDSA------LATRSNENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGSG----RHGNEDQQIL-------SLQGISKVILALYTSQRHVPYKENVLTQLLKDTLNQNFTTTMLLHISSKEQHYSETLQVVQLAYK 1451
            S+KVRV+ ++       S  +   S       CV  +D                + FD    D  +QE I+  S + PV++ +  G ++ +F++G +G GKT +M+G   +    G+IP ++   FK I   K  + S  + ++ S +E+  +  V DLL           ++K Q+L   QD+  +I I +  E+     ++   +   A       AT+ N + S +H  L+I +         ++      +T K   + L+DL       R GNE  ++        SL  + +V+ AL T Q  VPY+ + LT+LL+D+L  +  T ++ +I+ +   Y +TL  ++ A K
Sbjct:   14 SSKVRVIARLRPESPEYSAKSNRHSAGDMPPRCVRAVDSKSLEVWNWRNGSSIQYQFDGFFNDQSTQEEIYRFS-ISPVMQYVLLGENTSVFAYGPTGAGKTHTMLG---TADEPGVIPRSVCNIFKAIQTEKAKSPSWNFEITFSYLEIY-QEKVNDLL-----------NTKKQDLPIRQDREGSIFIPELSEISIKSFEDFDAVFKDASQNRTTAATKLNPHSSRSHSILLIKVVR------GQQVAPFRKLTGK---MYLVDLAGSEDNRRTGNEGIRLKESGAINGSLFALGQVVDALNTGQPRVPYRNSKLTRLLQDSLGGSAHTCVIANIAPEPDLYYDTLNTLKFASK 344          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Medaka
Match: kif26ab (kinesin family member 26A [Source:NCBI gene;Acc:101162644])

HSP 1 Score: 176.792 bits (447), Expect = 7.034e-44
Identity = 109/304 (35.86%), Postives = 167/304 (54.93%), Query Frame = 3
Query:  603 LFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKN-NVCDLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRSN-------ENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGS-------GRHGNEDQQILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTL-NQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRMR 1466
            +F FD++ T   SQ  + + ++ + V  +  G D CIFSFG   LGKT +M+G D S   +GI+PCA+ W FKLI++ K    + R+ V +SA+E+  K+  + DLL+ ++  S   G S    L +     T L NQ EL A    +AA  LD+A+A RS        E    +H+   +H+Y  R++           ++  +SRL LLDLGS        R G      LSL  +  VI+AL    +HVPY+++ LT LL+++L N N  TTM+ HIS    +++++L  +QLA +++RMR
Sbjct:  454 IFAFDAVFTQDASQAEVCSGTVAEVVQSVVNGADGCIFSFGQVKLGKTYTMIGKDSSTQSLGIVPCAISWLFKLINERKEKTGT-RFSVRVSAVEIFGKDEELKDLLSEVSTGSLQEGQSPGIHLKEDPICGTQLQNQSELRAPTADKAAFYLDAAIAARSTSRPNVEEEERRNSHMLFTLHVYQYRMEKSG-----KGGMSGGRSRLHLLDLGSCEKVLSKSRDGG-GGLCLSLNALGNVIMALTNGAKHVPYRDSKLTMLLRESLGNINCRTTMIAHISDVPANHADSLTTIQLASRIHRMR 750          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Medaka
Match: kif26ab (kinesin family member 26A [Source:NCBI gene;Acc:101162644])

HSP 1 Score: 176.407 bits (446), Expect = 8.004e-44
Identity = 109/304 (35.86%), Postives = 167/304 (54.93%), Query Frame = 3
Query:  603 LFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKN-NVCDLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRSN-------ENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGS-------GRHGNEDQQILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTL-NQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRMR 1466
            +F FD++ T   SQ  + + ++ + V  +  G D CIFSFG   LGKT +M+G D S   +GI+PCA+ W FKLI++ K    + R+ V +SA+E+  K+  + DLL+ ++  S   G S    L +     T L NQ EL A    +AA  LD+A+A RS        E    +H+   +H+Y  R++           ++  +SRL LLDLGS        R G      LSL  +  VI+AL    +HVPY+++ LT LL+++L N N  TTM+ HIS    +++++L  +QLA +++RMR
Sbjct:  434 IFAFDAVFTQDASQAEVCSGTVAEVVQSVVNGADGCIFSFGQVKLGKTYTMIGKDSSTQSLGIVPCAISWLFKLINERKEKTGT-RFSVRVSAVEIFGKDEELKDLLSEVSTGSLQEGQSPGIHLKEDPICGTQLQNQSELRAPTADKAAFYLDAAIAARSTSRPNVEEEERRNSHMLFTLHVYQYRMEKSG-----KGGMSGGRSRLHLLDLGSCEKVLSKSRDGG-GGLCLSLNALGNVIMALTNGAKHVPYRDSKLTMLLRESLGNINCRTTMIAHISDVPANHADSLTTIQLASRIHRMR 730          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Medaka
Match: kif26ab (kinesin family member 26A [Source:NCBI gene;Acc:101162644])

HSP 1 Score: 176.407 bits (446), Expect = 8.895e-44
Identity = 109/304 (35.86%), Postives = 167/304 (54.93%), Query Frame = 3
Query:  603 LFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKN-NVCDLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRSN-------ENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGS-------GRHGNEDQQILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTL-NQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRMR 1466
            +F FD++ T   SQ  + + ++ + V  +  G D CIFSFG   LGKT +M+G D S   +GI+PCA+ W FKLI++ K    + R+ V +SA+E+  K+  + DLL+ ++  S   G S    L +     T L NQ EL A    +AA  LD+A+A RS        E    +H+   +H+Y  R++           ++  +SRL LLDLGS        R G      LSL  +  VI+AL    +HVPY+++ LT LL+++L N N  TTM+ HIS    +++++L  +QLA +++RMR
Sbjct:  454 IFAFDAVFTQDASQAEVCSGTVAEVVQSVVNGADGCIFSFGQVKLGKTYTMIGKDSSTQSLGIVPCAISWLFKLINERKEKTGT-RFSVRVSAVEIFGKDEELKDLLSEVSTGSLQEGQSPGIHLKEDPICGTQLQNQSELRAPTADKAAFYLDAAIAARSTSRPNVEEEERRNSHMLFTLHVYQYRMEKSG-----KGGMSGGRSRLHLLDLGSCEKVLSKSRDGG-GGLCLSLNALGNVIMALTNGAKHVPYRDSKLTMLLRESLGNINCRTTMIAHISDVPANHADSLTTIQLASRIHRMR 750          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Medaka
Match: kif26ab (kinesin family member 26A [Source:NCBI gene;Acc:101162644])

HSP 1 Score: 176.407 bits (446), Expect = 9.070e-44
Identity = 109/304 (35.86%), Postives = 167/304 (54.93%), Query Frame = 3
Query:  603 LFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKN-NVCDLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRSN-------ENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGS-------GRHGNEDQQILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTL-NQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRMR 1466
            +F FD++ T   SQ  + + ++ + V  +  G D CIFSFG   LGKT +M+G D S   +GI+PCA+ W FKLI++ K    + R+ V +SA+E+  K+  + DLL+ ++  S   G S    L +     T L NQ EL A    +AA  LD+A+A RS        E    +H+   +H+Y  R++           ++  +SRL LLDLGS        R G      LSL  +  VI+AL    +HVPY+++ LT LL+++L N N  TTM+ HIS    +++++L  +QLA +++RMR
Sbjct:  454 IFAFDAVFTQDASQAEVCSGTVAEVVQSVVNGADGCIFSFGQVKLGKTYTMIGKDSSTQSLGIVPCAISWLFKLINERKEKTGT-RFSVRVSAVEIFGKDEELKDLLSEVSTGSLQEGQSPGIHLKEDPICGTQLQNQSELRAPTADKAAFYLDAAIAARSTSRPNVEEEERRNSHMLFTLHVYQYRMEKSG-----KGGMSGGRSRLHLLDLGSCEKVLSKSRDGG-GGLCLSLNALGNVIMALTNGAKHVPYRDSKLTMLLRESLGNINCRTTMIAHISDVPANHADSLTTIQLASRIHRMR 750          
BLAST of Kinesin-like protein KIF26A vs. Ensembl Medaka
Match: kif26ba (kinesin family member 26B [Source:NCBI gene;Acc:101169595])

HSP 1 Score: 171.014 bits (432), Expect = 4.034e-42
Identity = 132/398 (33.17%), Postives = 200/398 (50.25%), Query Frame = 3
Query:  603 LFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKN-NVCDLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATR--------SNENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGS----------------GRHGNEDQQI---LSLQGISKVILALYTSQRHVPYKENVLTQLLKDTL-NQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRMRLKKYRSVGFXXXXXXXXXXXXXXXXXXR--RLRPHMGIXXXXXXXXXXXXXXEVDLTSASELSCCETVIFKGDTNHSLSDK 1703
            +F FD+      SQ  +   ++ + +  +  G D C+F FGHS LGK+ +M+G D S+  +GIIPCA+ W FKLI++ K    + R+ V +SA+EV  K  N+ DLL+ +   S   G S    L +       L NQ EL A   ++AA +LD+A+A R        + E    +H+   +H+Y  R++   +       ++  +SRL LLDLGS                 R  +        LSL  +  VILAL    +H+PYK++ LT LL+++L N N  TTM+ HIS   + +SETL  +Q+A ++ RM+ KK +      S  +   SS   G   R   LRP    G           SS+ +  S+SE SC +TVI+ G    ++SD+
Sbjct:  562 IFTFDAAFPPDASQAEVCAGTVAEVIQSVVNGADGCVFCFGHSKLGKSYTMIGRDDSLQTLGIIPCAISWLFKLINERKEKTGA-RFSVRVSAVEVWGKEENLKDLLSEVATGSLQDGQSPGVYLCEDPICGMQLQNQSELRAPTPEKAAWLLDAAIAARHSSQRPNTTEEEHRNSHMLFTLHIYQYRMEKTGK-----GGMSGGRSRLHLLDLGSCDVKELGGGGGGGGGKNRENSSPSSAPLCLSLSALGNVILALVNGSKHIPYKDSKLTMLLRESLGNMNCRTTMIAHISVLPRDFSETLSTIQIASRVLRMKKKKTKVTVQYTSSSSGGESSCEEGRMRRPTHLRPFHHRGDTDSDLPLLKLSSDPEEYSSSEQSC-DTVIYVGPNGAAVSDR 952          
BLAST of Kinesin-like protein KIF26A vs. Planmine SMEST
Match: SMESG000051203.1 (SMESG000051203.1)

HSP 1 Score: 2375.13 bits (6154), Expect = 0.000e+0
Identity = 1379/1385 (99.57%), Postives = 1383/1385 (99.86%), Query Frame = 3
Query:  267 MPQLCRFRLERKISSDKLRKHNAARQKSPPKFHKLFLNNDVVLPTKLQQFLSEGLRFPDNEKINSNKVRVVLKINESRDTPSCLTINKSQNCVGVIDXXXXXXXXXXXXHVNLFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKNNVCDLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRSNENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGSGRHGNEDQQILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTLNQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRMRLKKYRSVGFXXXXXXXXXXXXXXXXXXRRLRPHMGIXXXXXXXXXXXXXXEVDLTSASELSCCETVIFKGDTNHSLSDKSPDRMSGKRKLRSVSSDSDNGFSDMEKSKSLAYNSGNSLSPTIRHRMSPRTNARAWPSTNDSSNCSIEHSSETWVDGPKAVYNAANGGNPILDDRNYMNKVTEIGMNIVQDLTVKPTMISKETQCDDVWXXXXXXXXXXXXXNTLDRKDHRPLSDISECTEETESNLATDSDLNKMNMIDQTEPTNVLDDLLESTFGLSPIHQGNQFKPLELSFLDSQEAHLQFIEKMKNPIEIPHSEIANHSIINLSDNLNFTEPVKEIQKPIRRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWIENVEYETQSSKSSKLDSTFHQYAHDGNQLHYTHHHSQPDISYQRDLFDINSIFAPSVHYQHQYSQNISWMHPDPLQAQYSLYDGYNLTLTNPSIPTSSSLSRTNSHYHHVPPAAVTQISSLHHMVTQQESCTNGQPIIYSPKPRRAHTHLSNISLPVNCLSVTXXXXXXXXXXTIFVGTHVPVIENLNTSCSFNTPPANSPVPVQIPPKPKCKTLPRDLFXXXXXXXXXXXXXXXXXXXAAAXXXXXXXXXXXXXXXXXXXXLFAPFISLXXXXXXXXXXXXXXPIISDSENSKSITNRSESLENQPICRFIVSDKIQPPIILASPYRLVTSPKTDILPTESSGNGSDCSSFHNRELAKSRLNDPLTRHKSRRGSTQNMPKNMPKQRPTSSGYGSIIIKGDXXXXXXXXXXXXXXXXGLTSNKNHGGHSRLKHSISLSNYKSITDANITNLSKNFSTDMSNPSSVISREANFNDSVKTAEDLLLQERLKMSLNEERKFVIQLVETNRLRGVMVDSEIMNLMCFKCLDNFDVNNPIKRNECEKLIEKLDQEIEHLKPVLSQAQNHLTLITSFISHPQSR 4421
            MPQLCRFRLERKISSDKLRKHNAARQKSPPKFHKLFLNNDVVLPTKLQQFLSEGLRFPDNEKINSNKVRVVLKINESRDTPSCLTINKSQNCVGVIDPTPSRRSQTSTTHVNLFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGS RSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKNNVCDLLA+LNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRSNENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGSGRHGNEDQQILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTLNQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRMRLKKYRSVGFSVSDETSSCSSSSSGLQSRRLRPHMGIGAARRSSGNSSASSEVDLTSASELSCCETVIFKGDTNHSLSDKSPDRMSGKRKLRSVSSDSDNGFSDMEKSKSLAYNSGNSLSPTIRHRMSPRTNARAWPSTNDSSNCSIEHSSETWVDGPKAVYNAANGGNPILDDRNYMNKVTEIGMNIVQDLTVKPTMISKETQCDDVWDSGSSITDGSSHSNTLDRKDHRPLSDISECTEETESNLATDSDLNKMNMIDQTEPTNVLDDLLESTFGLSPIHQGNQFKPLELSFLDSQEAHLQFIEKMKNPIEIPHSEIANHSIINLSDNLNFTEPVKE+QKPIRRDSSKTKKHSHLSSDSKKISKSEGKEKKSKPKCKKCSKSSDDNRSKSMTSSSSTNFSRVSSWIENVEYETQSSKSSKLDSTFHQYAHDGNQLHYTHHHSQPDISYQRDLFDINSIFAPSVHYQHQYSQNISWMHPDPLQAQYSLYDGYNLTLTNPSIPTSSSLSRTNSHYHHVPPAAVTQISSLHHMVTQQESCTNGQPII+SPKPRRAHTHLSNISLPVNCLSVTQLPLPPLPQPTIFVGTHVPVIENLNTSCSFNTPPANSPVPVQIPPKPKCKTLPRDLFSSSISSLKNSNKSDLHSSKAAAISDLKMKDKSKKDTKNIISILFAPFISLKKKINKNKNTNETNP+ISDSENSKSITNRSESLENQPICRFIVSDKIQPPIILASPYRLVTSPKTDILPTESSGNGSDCSSFHNRELAKSRLNDPLTRHKSRRGSTQNMPKNMPKQRPTSSGYGSIIIKGDSEVSSHNDSSSEYSASGLTSNKNHGGHSRLKHSISLSNYKSITDANITNLSKNFSTDMSNPSSVISREANFNDSVKTAEDLLLQERLKMSLNEERK VIQLVETNRLRGVMVDSEIMNLMCFKCLDNFDVNNPIKRNECEKLIEKLDQEIEHLKPVLSQAQNHLTLITSFISHPQSR
Sbjct:    1 MPQLCRFRLERKISSDKLRKHNAARQKSPPKFHKLFLNNDVVLPTKLQQFLSEGLRFPDNEKINSNKVRVVLKINESRDTPSCLTINKSQNCVGVIDPTPSRRSQTSTTHVNLFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSGRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKNNVCDLLAHLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRSNENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGSGRHGNEDQQILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTLNQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRMRLKKYRSVGFSVSDETSSCSSSSSGLQSRRLRPHMGIGAARRSSGNSSASSEVDLTSASELSCCETVIFKGDTNHSLSDKSPDRMSGKRKLRSVSSDSDNGFSDMEKSKSLAYNSGNSLSPTIRHRMSPRTNARAWPSTNDSSNCSIEHSSETWVDGPKAVYNAANGGNPILDDRNYMNKVTEIGMNIVQDLTVKPTMISKETQCDDVWDSGSSITDGSSHSNTLDRKDHRPLSDISECTEETESNLATDSDLNKMNMIDQTEPTNVLDDLLESTFGLSPIHQGNQFKPLELSFLDSQEAHLQFIEKMKNPIEIPHSEIANHSIINLSDNLNFTEPVKEVQKPIRRDSSKTKKHSHLSSDSKKISKSEGKEKKSKPKCKKCSKSSDDNRSKSMTSSSSTNFSRVSSWIENVEYETQSSKSSKLDSTFHQYAHDGNQLHYTHHHSQPDISYQRDLFDINSIFAPSVHYQHQYSQNISWMHPDPLQAQYSLYDGYNLTLTNPSIPTSSSLSRTNSHYHHVPPAAVTQISSLHHMVTQQESCTNGQPIIHSPKPRRAHTHLSNISLPVNCLSVTQLPLPPLPQPTIFVGTHVPVIENLNTSCSFNTPPANSPVPVQIPPKPKCKTLPRDLFSSSISSLKNSNKSDLHSSKAAAISDLKMKDKSKKDTKNIISILFAPFISLKKKINKNKNTNETNPLISDSENSKSITNRSESLENQPICRFIVSDKIQPPIILASPYRLVTSPKTDILPTESSGNGSDCSSFHNRELAKSRLNDPLTRHKSRRGSTQNMPKNMPKQRPTSSGYGSIIIKGDSEVSSHNDSSSEYSASGLTSNKNHGGHSRLKHSISLSNYKSITDANITNLSKNFSTDMSNPSSVISREANFNDSVKTAEDLLLQERLKMSLNEERKLVIQLVETNRLRGVMVDSEIMNLMCFKCLDNFDVNNPIKRNECEKLIEKLDQEIEHLKPVLSQAQNHLTLITSFISHPQSR 1385          
BLAST of Kinesin-like protein KIF26A vs. Planmine SMEST
Match: SMESG000051203.1 (SMESG000051203.1)

HSP 1 Score: 2209.11 bits (5723), Expect = 0.000e+0
Identity = 1302/1320 (98.64%), Postives = 1309/1320 (99.17%), Query Frame = 3
Query:  465 KVRVVLKINESRDTP-SCLTINKSQNCVGVIDXXXXXXXXXXXXHVNLFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKNNVCDLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRSNENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGSGRHGNEDQQILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTLNQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRMRLKKYRSVGFXXXXXXXXXXXXXXXXXXRRLRPHMGIXXXXXXXXXXXXXXEVDLTSASELSCCETVIFKGDTNHSLSDKSPDRMSGKRKLRSVSSDSDNGFSDMEKSKSLAYNSGNSLSPTIRHRMSPRTNARAWPSTNDSSNCSIEHSSETWVDGPKAVYNAANGGNPILDDRNYMNKVTEIGMNIVQDLTVKPTMISKETQCDDVWXXXXXXXXXXXXXNTLDRKDHRPLSDISECTEETESNLATDSDLNKMNMIDQTEPTNVLDDLLESTFGLSPIHQGNQFKPLELSFLDSQEAHLQFIEKMKNPIEIPHSEIANHSIINLSDNLNFTEPVKEIQKPIRRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWIENVEYETQSSKSSKLDSTFHQYAHDGNQLHYTHHHSQPDISYQRDLFDINSIFAPSVHYQHQYSQNISWMHPDPLQAQYSLYDGYNLTLTNPSIPTSSSLSRTNSHYHHVPPAAVTQISSLHHMVTQQESCTNGQPIIYSPKPRRAHTHLSNISLPVNCLSVTXXXXXXXXXXTIFVGTHVPVIENLNTSCSFNTPPANSPVPVQIPPKPKCKTLPRDLFXXXXXXXXXXXXXXXXXXXAAAXXXXXXXXXXXXXXXXXXXXLFAPFISLXXXXXXXXXXXXXXPIISDSENSKSITNRSESLENQPICRFIVSDKIQPPIILASPYRLVTSPKTDILPTESSGNGSDCSSFHNRELAKSRLNDPLTRHKSRRGSTQNMPKNMPKQRPTSSGYGSIIIKGDXXXXXXXXXXXXXXXXGLTSNKNHGGHSRLKHSISLSNYKSITDANITNLSKNFSTDMSNPSSVISREANFNDSVKTAEDLLLQERLKMSLNEERKFVIQLVETNRLRGVMVDSEIMNLMCFKCLDNFDVNNPIKRNECEKLIEKLDQEIEHLKPVLSQAQNHLTLITSFISHPQSR 4421
            +V V L + +S  T   CLTINKSQNCVGVIDPTPSRRSQTSTTHVNLFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGS RSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKNNVCDLLA+LNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRSNENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGSGRHGNEDQQILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTLNQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRMRLKKYRSVGFSVSDETSSCSSSSSGLQSRRLRPHMGIGAARRSSGNSSASSEVDLTSASELSCCETVIFKGDTNHSLSDKSPDRMSGKRKLRSVSSDSDNGFSDMEKSKSLAYNSGNSLSPTIRHRMSPRTNARAWPSTNDSSNCSIEHSSETWVDGPKAVYNAANGGNPILDDRNYMNKVTEIGMNIVQDLTVKPTMISKETQCDDVWDSGSSITDGSSHSNTLDRKDHRPLSDISECTEETESNLATDSDLNKMNMIDQTEPTNVLDDLLESTFGLSPIHQGNQFKPLELSFLDSQEAHLQFIEKMKNPIEIPHSEIANHSIINLSDNLNFTEPVKE+QKPIRRDSSKTKKHSHLSSDSKKISKSEGKEKKSKPKCKKCSKSSDDNRSKSMTSSSSTNFSRVSSWIENVEYETQSSKSSKLDSTFHQYAHDGNQLHYTHHHSQPDISYQRDLFDINSIFAPSVHYQHQYSQNISWMHPDPLQAQYSLYDGYNLTLTNPSIPTSSSLSRTNSHYHHVPPAAVTQISSLHHMVTQQESCTNGQPII+SPKPRRAHTHLSNISLPVNCLSVTQLPLPPLPQPTIFVGTHVPVIENLNTSCSFNTPPANSPVPVQIPPKPKCKTLPRDLFSSSISSLKNSNKSDLHSSKAAAISDLKMKDKSKKDTKNIISILFAPFISLKKKINKNKNTNETNP+ISDSENSKSITNRSESLENQPICRFIVSDKIQPPIILASPYRLVTSPKTDILPTESSGNGSDCSSFHNRELAKSRLNDPLTRHKSRRGSTQNMPKNMPKQRPTSSGYGSIIIKGDSEVSSHNDSSSEYSASGLTSNKNHGGHSRLKHSISLSNYKSITDANITNLSKNFSTDMSNPSSVISREANFNDSVKTAEDLLLQERLKMSLNEERK VIQLVETNRLRGVMVDSEIMNLMCFKCLDNFDVNNPIKRNECEKLIEKLDQEIEHLKPVLSQAQNHLTLITSFISHPQSR
Sbjct:   14 RVYVFLTMKKSTRTKFDCLTINKSQNCVGVIDPTPSRRSQTSTTHVNLFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSGRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKNNVCDLLAHLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRSNENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGSGRHGNEDQQILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTLNQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRMRLKKYRSVGFSVSDETSSCSSSSSGLQSRRLRPHMGIGAARRSSGNSSASSEVDLTSASELSCCETVIFKGDTNHSLSDKSPDRMSGKRKLRSVSSDSDNGFSDMEKSKSLAYNSGNSLSPTIRHRMSPRTNARAWPSTNDSSNCSIEHSSETWVDGPKAVYNAANGGNPILDDRNYMNKVTEIGMNIVQDLTVKPTMISKETQCDDVWDSGSSITDGSSHSNTLDRKDHRPLSDISECTEETESNLATDSDLNKMNMIDQTEPTNVLDDLLESTFGLSPIHQGNQFKPLELSFLDSQEAHLQFIEKMKNPIEIPHSEIANHSIINLSDNLNFTEPVKEVQKPIRRDSSKTKKHSHLSSDSKKISKSEGKEKKSKPKCKKCSKSSDDNRSKSMTSSSSTNFSRVSSWIENVEYETQSSKSSKLDSTFHQYAHDGNQLHYTHHHSQPDISYQRDLFDINSIFAPSVHYQHQYSQNISWMHPDPLQAQYSLYDGYNLTLTNPSIPTSSSLSRTNSHYHHVPPAAVTQISSLHHMVTQQESCTNGQPIIHSPKPRRAHTHLSNISLPVNCLSVTQLPLPPLPQPTIFVGTHVPVIENLNTSCSFNTPPANSPVPVQIPPKPKCKTLPRDLFSSSISSLKNSNKSDLHSSKAAAISDLKMKDKSKKDTKNIISILFAPFISLKKKINKNKNTNETNPLISDSENSKSITNRSESLENQPICRFIVSDKIQPPIILASPYRLVTSPKTDILPTESSGNGSDCSSFHNRELAKSRLNDPLTRHKSRRGSTQNMPKNMPKQRPTSSGYGSIIIKGDSEVSSHNDSSSEYSASGLTSNKNHGGHSRLKHSISLSNYKSITDANITNLSKNFSTDMSNPSSVISREANFNDSVKTAEDLLLQERLKMSLNEERKLVIQLVETNRLRGVMVDSEIMNLMCFKCLDNFDVNNPIKRNECEKLIEKLDQEIEHLKPVLSQAQNHLTLITSFISHPQSR 1333          

HSP 2 Score: 66.6254 bits (161), Expect = 1.467e-10
Identity = 29/30 (96.67%), Postives = 30/30 (100.00%), Query Frame = 1
Query:  385 MLFYQRNCSNFCRRVYVFLTMKKSTRTKFE 474
            MLFYQRNCSNFCRRVYVFLTMKKSTRTKF+
Sbjct:    1 MLFYQRNCSNFCRRVYVFLTMKKSTRTKFD 30          
BLAST of Kinesin-like protein KIF26A vs. Planmine SMEST
Match: SMESG000051203.1 (SMESG000051203.1)

HSP 1 Score: 2208.34 bits (5721), Expect = 0.000e+0
Identity = 1297/1303 (99.54%), Postives = 1301/1303 (99.85%), Query Frame = 3
Query:  513 CLTINKSQNCVGVIDXXXXXXXXXXXXHVNLFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKNNVCDLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRSNENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGSGRHGNEDQQILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTLNQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRMRLKKYRSVGFXXXXXXXXXXXXXXXXXXRRLRPHMGIXXXXXXXXXXXXXXEVDLTSASELSCCETVIFKGDTNHSLSDKSPDRMSGKRKLRSVSSDSDNGFSDMEKSKSLAYNSGNSLSPTIRHRMSPRTNARAWPSTNDSSNCSIEHSSETWVDGPKAVYNAANGGNPILDDRNYMNKVTEIGMNIVQDLTVKPTMISKETQCDDVWXXXXXXXXXXXXXNTLDRKDHRPLSDISECTEETESNLATDSDLNKMNMIDQTEPTNVLDDLLESTFGLSPIHQGNQFKPLELSFLDSQEAHLQFIEKMKNPIEIPHSEIANHSIINLSDNLNFTEPVKEIQKPIRRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWIENVEYETQSSKSSKLDSTFHQYAHDGNQLHYTHHHSQPDISYQRDLFDINSIFAPSVHYQHQYSQNISWMHPDPLQAQYSLYDGYNLTLTNPSIPTSSSLSRTNSHYHHVPPAAVTQISSLHHMVTQQESCTNGQPIIYSPKPRRAHTHLSNISLPVNCLSVTXXXXXXXXXXTIFVGTHVPVIENLNTSCSFNTPPANSPVPVQIPPKPKCKTLPRDLFXXXXXXXXXXXXXXXXXXXAAAXXXXXXXXXXXXXXXXXXXXLFAPFISLXXXXXXXXXXXXXXPIISDSENSKSITNRSESLENQPICRFIVSDKIQPPIILASPYRLVTSPKTDILPTESSGNGSDCSSFHNRELAKSRLNDPLTRHKSRRGSTQNMPKNMPKQRPTSSGYGSIIIKGDXXXXXXXXXXXXXXXXGLTSNKNHGGHSRLKHSISLSNYKSITDANITNLSKNFSTDMSNPSSVISREANFNDSVKTAEDLLLQERLKMSLNEERKFVIQLVETNRLRGVMVDSEIMNLMCFKCLDNFDVNNPIKRNECEKLIEKLDQEIEHLKPVLSQAQNHLTLITSFISHPQSR 4421
            CLTINKSQNCVGVIDPTPSRRSQTSTTHVNLFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGS RSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKNNVCDLLA+LNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRSNENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGSGRHGNEDQQILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTLNQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRMRLKKYRSVGFSVSDETSSCSSSSSGLQSRRLRPHMGIGAARRSSGNSSASSEVDLTSASELSCCETVIFKGDTNHSLSDKSPDRMSGKRKLRSVSSDSDNGFSDMEKSKSLAYNSGNSLSPTIRHRMSPRTNARAWPSTNDSSNCSIEHSSETWVDGPKAVYNAANGGNPILDDRNYMNKVTEIGMNIVQDLTVKPTMISKETQCDDVWDSGSSITDGSSHSNTLDRKDHRPLSDISECTEETESNLATDSDLNKMNMIDQTEPTNVLDDLLESTFGLSPIHQGNQFKPLELSFLDSQEAHLQFIEKMKNPIEIPHSEIANHSIINLSDNLNFTEPVKE+QKPIRRDSSKTKKHSHLSSDSKKISKSEGKEKKSKPKCKKCSKSSDDNRSKSMTSSSSTNFSRVSSWIENVEYETQSSKSSKLDSTFHQYAHDGNQLHYTHHHSQPDISYQRDLFDINSIFAPSVHYQHQYSQNISWMHPDPLQAQYSLYDGYNLTLTNPSIPTSSSLSRTNSHYHHVPPAAVTQISSLHHMVTQQESCTNGQPII+SPKPRRAHTHLSNISLPVNCLSVTQLPLPPLPQPTIFVGTHVPVIENLNTSCSFNTPPANSPVPVQIPPKPKCKTLPRDLFSSSISSLKNSNKSDLHSSKAAAISDLKMKDKSKKDTKNIISILFAPFISLKKKINKNKNTNETNP+ISDSENSKSITNRSESLENQPICRFIVSDKIQPPIILASPYRLVTSPKTDILPTESSGNGSDCSSFHNRELAKSRLNDPLTRHKSRRGSTQNMPKNMPKQRPTSSGYGSIIIKGDSEVSSHNDSSSEYSASGLTSNKNHGGHSRLKHSISLSNYKSITDANITNLSKNFSTDMSNPSSVISREANFNDSVKTAEDLLLQERLKMSLNEERK VIQLVETNRLRGVMVDSEIMNLMCFKCLDNFDVNNPIKRNECEKLIEKLDQEIEHLKPVLSQAQNHLTLITSFISHPQSR
Sbjct:   11 CLTINKSQNCVGVIDPTPSRRSQTSTTHVNLFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSGRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKNNVCDLLAHLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRSNENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGSGRHGNEDQQILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTLNQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRMRLKKYRSVGFSVSDETSSCSSSSSGLQSRRLRPHMGIGAARRSSGNSSASSEVDLTSASELSCCETVIFKGDTNHSLSDKSPDRMSGKRKLRSVSSDSDNGFSDMEKSKSLAYNSGNSLSPTIRHRMSPRTNARAWPSTNDSSNCSIEHSSETWVDGPKAVYNAANGGNPILDDRNYMNKVTEIGMNIVQDLTVKPTMISKETQCDDVWDSGSSITDGSSHSNTLDRKDHRPLSDISECTEETESNLATDSDLNKMNMIDQTEPTNVLDDLLESTFGLSPIHQGNQFKPLELSFLDSQEAHLQFIEKMKNPIEIPHSEIANHSIINLSDNLNFTEPVKEVQKPIRRDSSKTKKHSHLSSDSKKISKSEGKEKKSKPKCKKCSKSSDDNRSKSMTSSSSTNFSRVSSWIENVEYETQSSKSSKLDSTFHQYAHDGNQLHYTHHHSQPDISYQRDLFDINSIFAPSVHYQHQYSQNISWMHPDPLQAQYSLYDGYNLTLTNPSIPTSSSLSRTNSHYHHVPPAAVTQISSLHHMVTQQESCTNGQPIIHSPKPRRAHTHLSNISLPVNCLSVTQLPLPPLPQPTIFVGTHVPVIENLNTSCSFNTPPANSPVPVQIPPKPKCKTLPRDLFSSSISSLKNSNKSDLHSSKAAAISDLKMKDKSKKDTKNIISILFAPFISLKKKINKNKNTNETNPLISDSENSKSITNRSESLENQPICRFIVSDKIQPPIILASPYRLVTSPKTDILPTESSGNGSDCSSFHNRELAKSRLNDPLTRHKSRRGSTQNMPKNMPKQRPTSSGYGSIIIKGDSEVSSHNDSSSEYSASGLTSNKNHGGHSRLKHSISLSNYKSITDANITNLSKNFSTDMSNPSSVISREANFNDSVKTAEDLLLQERLKMSLNEERKLVIQLVETNRLRGVMVDSEIMNLMCFKCLDNFDVNNPIKRNECEKLIEKLDQEIEHLKPVLSQAQNHLTLITSFISHPQSR 1313          
BLAST of Kinesin-like protein KIF26A vs. Planmine SMEST
Match: SMESG000051203.1 (SMESG000051203.1)

HSP 1 Score: 2206.79 bits (5717), Expect = 0.000e+0
Identity = 1302/1320 (98.64%), Postives = 1309/1320 (99.17%), Query Frame = 3
Query:  465 KVRVVLKINESRDTP-SCLTINKSQNCVGVIDXXXXXXXXXXXXHVNLFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKNNVCDLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRSNENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGSGRHGNEDQQILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTLNQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRMRLKKYRSVGFXXXXXXXXXXXXXXXXXXRRLRPHMGIXXXXXXXXXXXXXXEVDLTSASELSCCETVIFKGDTNHSLSDKSPDRMSGKRKLRSVSSDSDNGFSDMEKSKSLAYNSGNSLSPTIRHRMSPRTNARAWPSTNDSSNCSIEHSSETWVDGPKAVYNAANGGNPILDDRNYMNKVTEIGMNIVQDLTVKPTMISKETQCDDVWXXXXXXXXXXXXXNTLDRKDHRPLSDISECTEETESNLATDSDLNKMNMIDQTEPTNVLDDLLESTFGLSPIHQGNQFKPLELSFLDSQEAHLQFIEKMKNPIEIPHSEIANHSIINLSDNLNFTEPVKEIQKPIRRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWIENVEYETQSSKSSKLDSTFHQYAHDGNQLHYTHHHSQPDISYQRDLFDINSIFAPSVHYQHQYSQNISWMHPDPLQAQYSLYDGYNLTLTNPSIPTSSSLSRTNSHYHHVPPAAVTQISSLHHMVTQQESCTNGQPIIYSPKPRRAHTHLSNISLPVNCLSVTXXXXXXXXXXTIFVGTHVPVIENLNTSCSFNTPPANSPVPVQIPPKPKCKTLPRDLFXXXXXXXXXXXXXXXXXXXAAAXXXXXXXXXXXXXXXXXXXXLFAPFISLXXXXXXXXXXXXXXPIISDSENSKSITNRSESLENQPICRFIVSDKIQPPIILASPYRLVTSPKTDILPTESSGNGSDCSSFHNRELAKSRLNDPLTRHKSRRGSTQNMPKNMPKQRPTSSGYGSIIIKGDXXXXXXXXXXXXXXXXGLTSNKNHGGHSRLKHSISLSNYKSITDANITNLSKNFSTDMSNPSSVISREANFNDSVKTAEDLLLQERLKMSLNEERKFVIQLVETNRLRGVMVDSEIMNLMCFKCLDNFDVNNPIKRNECEKLIEKLDQEIEHLKPVLSQAQNHLTLITSFISHPQSR 4421
            +V V L + +S  T   CLTINKSQNCVGVIDPTPSRRSQTSTTHVNLFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGS RSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKNNVCDLLA+LNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRSNENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGSGRHGNEDQQILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTLNQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRMRLKKYRSVGFSVSDETSSCSSSSSGLQSRRLRPHMGIGAARRSSGNSSASSEVDLTSASELSCCETVIFKGDTNHSLSDKSPDRMSGKRKLRSVSSDSDNGFSDMEKSKSLAYNSGNSLSPTIRHRMSPRTNARAWPSTNDSSNCSIEHSSETWVDGPKAVYNAANGGNPILDDRNYMNKVTEIGMNIVQDLTVKPTMISKETQCDDVWDSGSSITDGSSHSNTLDRKDHRPLSDISECTEETESNLATDSDLNKMNMIDQTEPTNVLDDLLESTFGLSPIHQGNQFKPLELSFLDSQEAHLQFIEKMKNPIEIPHSEIANHSIINLSDNLNFTEPVKE+QKPIRRDSSKTKKHSHLSSDSKKISKSEGKEKKSKPKCKKCSKSSDDNRSKSMTSSSSTNFSRVSSWIENVEYETQSSKSSKLDSTFHQYAHDGNQLHYTHHHSQPDISYQRDLFDINSIFAPSVHYQHQYSQNISWMHPDPLQAQYSLYDGYNLTLTNPSIPTSSSLSRTNSHYHHVPPAAVTQISSLHHMVTQQESCTNGQPII+SPKPRRAHTHLSNISLPVNCLSVTQLPLPPLPQPTIFVGTHVPVIENLNTSCSFNTPPANSPVPVQIPPKPKCKTLPRDLFSSSISSLKNSNKSDLHSSKAAAISDLKMKDKSKKDTKNIISILFAPFISLKKKINKNKNTNETNP+ISDSENSKSITNRSESLENQPICRFIVSDKIQPPIILASPYRLVTSPKTDILPTESSGNGSDCSSFHNRELAKSRLNDPLTRHKSRRGSTQNMPKNMPKQRPTSSGYGSIIIKGDSEVSSHNDSSSEYSASGLTSNKNHGGHSRLKHSISLSNYKSITDANITNLSKNFSTDMSNPSSVISREANFNDSVKTAEDLLLQERLKMSLNEERK VIQLVETNRLRGVMVDSEIMNLMCFKCLDNFDVNNPIKRNECEKLIEKLDQEIEHLKPVLSQAQNHLTLITSFISHPQSR
Sbjct:   32 RVYVFLTMKKSTRTKFDCLTINKSQNCVGVIDPTPSRRSQTSTTHVNLFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSGRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKNNVCDLLAHLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRSNENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGSGRHGNEDQQILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTLNQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRMRLKKYRSVGFSVSDETSSCSSSSSGLQSRRLRPHMGIGAARRSSGNSSASSEVDLTSASELSCCETVIFKGDTNHSLSDKSPDRMSGKRKLRSVSSDSDNGFSDMEKSKSLAYNSGNSLSPTIRHRMSPRTNARAWPSTNDSSNCSIEHSSETWVDGPKAVYNAANGGNPILDDRNYMNKVTEIGMNIVQDLTVKPTMISKETQCDDVWDSGSSITDGSSHSNTLDRKDHRPLSDISECTEETESNLATDSDLNKMNMIDQTEPTNVLDDLLESTFGLSPIHQGNQFKPLELSFLDSQEAHLQFIEKMKNPIEIPHSEIANHSIINLSDNLNFTEPVKEVQKPIRRDSSKTKKHSHLSSDSKKISKSEGKEKKSKPKCKKCSKSSDDNRSKSMTSSSSTNFSRVSSWIENVEYETQSSKSSKLDSTFHQYAHDGNQLHYTHHHSQPDISYQRDLFDINSIFAPSVHYQHQYSQNISWMHPDPLQAQYSLYDGYNLTLTNPSIPTSSSLSRTNSHYHHVPPAAVTQISSLHHMVTQQESCTNGQPIIHSPKPRRAHTHLSNISLPVNCLSVTQLPLPPLPQPTIFVGTHVPVIENLNTSCSFNTPPANSPVPVQIPPKPKCKTLPRDLFSSSISSLKNSNKSDLHSSKAAAISDLKMKDKSKKDTKNIISILFAPFISLKKKINKNKNTNETNPLISDSENSKSITNRSESLENQPICRFIVSDKIQPPIILASPYRLVTSPKTDILPTESSGNGSDCSSFHNRELAKSRLNDPLTRHKSRRGSTQNMPKNMPKQRPTSSGYGSIIIKGDSEVSSHNDSSSEYSASGLTSNKNHGGHSRLKHSISLSNYKSITDANITNLSKNFSTDMSNPSSVISREANFNDSVKTAEDLLLQERLKMSLNEERKLVIQLVETNRLRGVMVDSEIMNLMCFKCLDNFDVNNPIKRNECEKLIEKLDQEIEHLKPVLSQAQNHLTLITSFISHPQSR 1351          

HSP 2 Score: 103.219 bits (256), Expect = 1.110e-21
Identity = 47/48 (97.92%), Postives = 48/48 (100.00%), Query Frame = 1
Query:  331 MPPDKSLLRNFINYFSTTMLFYQRNCSNFCRRVYVFLTMKKSTRTKFE 474
            MPPDKSLLRNFINYFSTTMLFYQRNCSNFCRRVYVFLTMKKSTRTKF+
Sbjct:    1 MPPDKSLLRNFINYFSTTMLFYQRNCSNFCRRVYVFLTMKKSTRTKFD 48          
BLAST of Kinesin-like protein KIF26A vs. Planmine SMEST
Match: SMESG000028296.1 (SMESG000028296.1)

HSP 1 Score: 193.356 bits (490), Expect = 2.330e-49
Identity = 175/544 (32.17%), Postives = 284/544 (52.21%), Query Frame = 3
Query:  360 FHKLFLNNDVVLPTKLQQFLSEGLRFPDNEKINSNKVRVVLKINESRDTPSCLTINKSQNCVGVIDXXXXXXXXXXXXHVNLFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIFSFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYFVSISAIEVSNKNNVC-DLLANLNPLSKLSGDSKSQELSDQDQSNTILINQRELPASCLQEAACILDSALATRS-NENESLTHLQLIIHLYHCRVDAVAERNCDSNNVTSKKSRLILLDLGSGRHGNE-DQQILSLQGISKVILALYTSQRHVPYKENVLTQLLKDTLNQNFT---TTMLLHISSKEQHYSETLQVVQLAYKLYRMRLKKYRSVGFXXXXXXXXXXXXXXXXXXRRLRPHMG--IXXXXXXXXXXXXXXEVDLTSASELSCCETVIFKGDTNHSLSDKSPDRMSGKRKLRSVSSDSDNGFSDMEKSKSLAYNSGNSLSPTIRHRMSPRTNARAWPSTNDSSNCSIEHSS-ETWVDGPKAVYNAANG 1964
            FHK+  N+   LP  LQ+ +S      +  K  S++++V +++    +T SCL+++   NC+ + +PTPSR+   S     LFP DSI+ +      I ++SL   +  +  G D+C+ SFG+        ++GSD+S + IG++PCA++W F  I  +++  ++ R+ V ISA E+S +   C DLL  L+  +  S  S+    S    ++ +     EL A  +++AA  LD AL  RS +E   L+H+ L +HLY   +        + + ++  +S+L ++DLG GR   + +   LS+QGISKVI AL++ QRH+P  +++L Q LK     ++T   T+M++ +S KE  Y+E LQVVQLA KL R + +  +    + SD+ SS S S S  +  + R   G  +    R +   S SS+VD TS+SE+S C+TVI++G   +S     P  + G        S    GFS  E  +             ++ R   + N+ AWP         +  S  E WVDGP+A  +  +G
Sbjct:   54 FHKILSNSVPGLPPNLQKLISTE----NKSKKESDRIQVFVQLLSCPETSSCLSLDIPNNCISLTNPTPSRKFTASNA-PKLFPVDSIIHEDCPIMEICSNSLGPVIRSVANGEDACVISFGNVLPSDLNPIIGSDKSPNMIGVMPCAIVWLFNYIQTIRKQEYA-RFSVRISAAEISGRQENCRDLL--LSISNPSSDSSQPLNSSSSLFNSLV-----ELRAVNVEKAAYYLDYALTERSKSEENGLSHMFLTLHLYQYHLQ-------NDSGISGGRSKLHIIDLGCGRLSEDVESTALSIQGISKVIYALWSHQRHIPNPDSILAQTLKRLNVNSYTMMQTSMIIKVSGKETQYNEALQVVQLASKLCRQKTRLSKLSSSTCSDDNSSSSDSFSIRRMTKFRSQFGNDLKRLDRLNRTLSISSDVDATSSSEVS-CDTVIYRGQPLNS----PPSCVRGN---ADGCSQGQIGFSHSESEEKKPEPKLTLFQ--LKRRTGNKINSNAWPKVAVKKAKEVMKSGQELWVDGPEAFRSNTDG 567          

HSP 2 Score: 52.373 bits (124), Expect = 3.704e-6
Identity = 76/308 (24.68%), Postives = 137/308 (44.48%), Query Frame = 3
Query: 3558 ENSKSITNRSESLENQPICRFIVSDKIQ------PPIILASPYRLVTSPKTDILPTESSGNGSDCSSFHNRELAKSRLNDPLTRHKSRRGSTQNMPKNMPKQRPTSSGYGSIIIKGDXXXXXXXXXXXXXXXXGLTSNKNHGGHSRLKHSISLSNYKSITDANITNLSKNFSTDMSNPSSVISREANFNDSVKTAEDLLLQERLKMSLNEERKFVIQLVETNRLRGVMVD-----SEIMNLMCFKCLDNFDVNNPIKRNECE----------KLIEKLDQEIEHLKPVLSQAQNHLTLITSFISHPQS 4418
            E++ S+   S+S      C+F  SD I       PP++L SPY  +T PK       SSG+GSDCSSF   +  ++ +N     H+        + + +P  R  SSGY S++   +                 L+S+ +         + +L +   I    + N +KN  + +S  + V + + + N+  K  E +         +NE +K V +L++  ++  + ++     +E++N++ F    N D++   K  E            K  E L+   + L+ VL++ Q++L +ITSFI  P S
Sbjct:  996 ESTNSVEISSQSAVKSHECQF--SDNIDYVKRAGPPLLLTSPYSTITHPKIPPTQAGSSGHGSDCSSFKESKSTQASVN----FHQE-----NTVYRFLPYARAGSSGYESVVRDSE-----------------LSSHNDSASECSAPTNSALQSKNIINSTTVNNTNKN--SQISPTTPVNNAKVSTNEHEKKVETINF-------VNESQK-VFELIKAEKICMLEMEQDEMKNELINVLKFF---NDDIDGSRKYLETHLSDIEGVDDIKSPEGLNATNQTLRSVLNRYQSNLYMITSFIGKPSS 1262          
The following BLAST results are available for this feature:
BLAST of Kinesin-like protein KIF26A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIF26A6.058e-4633.25kinesin family member 26A [Source:HGNC Symbol;Acc:... [more]
KIF26A6.093e-4633.25kinesin family member 26A [Source:HGNC Symbol;Acc:... [more]
KIF26B6.635e-4535.20kinesin family member 26B [Source:HGNC Symbol;Acc:... [more]
KIF26B7.908e-4535.31kinesin family member 26B [Source:HGNC Symbol;Acc:... [more]
KIF26B8.902e-4535.31kinesin family member 26B [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Kinesin-like protein KIF26A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
klp-196.452e-1828.25Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc... [more]
klp-203.789e-1626.17Kinesin-like protein klp-20 [Source:UniProtKB/Swi... [more]
klp-203.789e-1626.17Kinesin-like protein klp-20 [Source:UniProtKB/Swi... [more]
klp-203.789e-1626.17Kinesin-like protein klp-20 [Source:UniProtKB/Swi... [more]
bmk-14.584e-1325.32Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc... [more]
back to top
BLAST of Kinesin-like protein KIF26A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG145351.606e-2626.09gene:FBgn0031955 transcript:FBtr0343421[more]
CG145351.606e-2626.09gene:FBgn0031955 transcript:FBtr0079564[more]
Klp68D1.922e-1527.91gene:FBgn0004381 transcript:FBtr0332129[more]
Klp68D1.922e-1527.91gene:FBgn0004381 transcript:FBtr0076030[more]
Klp64D1.039e-1328.57gene:FBgn0004380 transcript:FBtr0077157[more]
back to top
BLAST of Kinesin-like protein KIF26A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif26ba2.775e-4535.06kinesin family member 26Ba [Source:ZFIN;Acc:ZDB-GE... [more]
kif26ba2.970e-4534.03kinesin family member 26Ba [Source:ZFIN;Acc:ZDB-GE... [more]
kif26ab8.858e-4535.64kinesin family member 26Ab [Source:ZFIN;Acc:ZDB-GE... [more]
kif26aa3.275e-4035.86kinesin family member 26Aa [Source:ZFIN;Acc:ZDB-GE... [more]
kif26aa3.829e-4035.86kinesin family member 26Aa [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Kinesin-like protein KIF26A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gyg26.771e-4635.97glycogenin 2 [Source:Xenbase;Acc:XB-GENE-5854708][more]
gyg27.135e-4635.97glycogenin 2 [Source:Xenbase;Acc:XB-GENE-5854708][more]
gyg27.152e-4635.97glycogenin 2 [Source:Xenbase;Acc:XB-GENE-5854708][more]
gyg27.298e-4635.97glycogenin 2 [Source:Xenbase;Acc:XB-GENE-5854708][more]
gyg28.230e-4635.97glycogenin 2 [Source:Xenbase;Acc:XB-GENE-5854708][more]
back to top
BLAST of Kinesin-like protein KIF26A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kif26a4.614e-5233.41kinesin family member 26A [Source:MGI Symbol;Acc:M... [more]
Kif26b8.194e-4635.97kinesin family member 26B [Source:MGI Symbol;Acc:M... [more]
Kif26b8.506e-4635.97kinesin family member 26B [Source:MGI Symbol;Acc:M... [more]
Kifc16.184e-1828.76kinesin family member C1 [Source:MGI Symbol;Acc:MG... [more]
Kifc5b7.052e-1828.76kinesin family member C5B [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Kinesin-like protein KIF26A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q52KG5|KI26A_MOUSE3.227e-5133.41Kinesin-like protein KIF26A OS=Mus musculus OX=100... [more]
sp|Q9ULI4|KI26A_HUMAN2.926e-4533.25Kinesin-like protein KIF26A OS=Homo sapiens OX=960... [more]
sp|Q7TNC6|KI26B_MOUSE5.950e-4535.97Kinesin-like protein KIF26B OS=Mus musculus OX=100... [more]
sp|Q2KJY2|KI26B_HUMAN3.798e-4435.31Kinesin-like protein KIF26B OS=Homo sapiens OX=960... [more]
sp|Q9VLW2|KI26L_DROME1.610e-2526.09Kinesin-like protein CG14535 OS=Drosophila melanog... [more]
back to top
BLAST of Kinesin-like protein KIF26A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3HWK51.118e-5136.16kinesin-like protein KIF26B OS=Lingula unguis OX=7... [more]
A0A267GJP57.005e-5133.53Kinesin motor domain-containing protein (Fragment)... [more]
A0A210PKW85.644e-5033.88Kinesin-like protein KIF26A OS=Mizuhopecten yessoe... [more]
A0A0R3SED93.480e-4931.92Kinesin motor domain-containing protein OS=Hymenol... [more]
A0A1I8I4F24.439e-4933.33Kinesin motor domain-containing protein OS=Macrost... [more]
back to top
BLAST of Kinesin-like protein KIF26A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif26aa2.474e-4635.34kinesin family member 26Aa [Source:ZFIN;Acc:ZDB-GE... [more]
kif26aa2.893e-4635.34kinesin family member 26Aa [Source:ZFIN;Acc:ZDB-GE... [more]
kif26ab1.072e-4532.97kinesin family member 26A [Source:NCBI gene;Acc:10... [more]
kif26ab1.115e-4535.86kinesin family member 26A [Source:NCBI gene;Acc:10... [more]
kif26ab1.167e-4535.86kinesin family member 26A [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Kinesin-like protein KIF26A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001911.11.087e-1933.10pep scaffold:Pmarinus_7.0:GL476451:251877:270556:1... [more]
kif65.157e-1727.72kinesin family member 6 [Source:ZFIN;Acc:ZDB-GENE-... [more]
ENSPMAT00000010492.12.053e-1525.50pep scaffold:Pmarinus_7.0:GL478879:14589:34633:-1 ... [more]
kif3a1.231e-1428.20kinesin family member 3A [Source:ZFIN;Acc:ZDB-GENE... [more]
kifc32.584e-1426.33kinesin family member C3 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Kinesin-like protein KIF26A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
KAR31.108e-1629.68Minus-end-directed microtubule motor; functions in... [more]
KIP37.906e-1326.20Kinesin-related antiparallel sliding motor protein... [more]
KIP11.043e-1225.40Kinesin-related motor protein; required for mitoti... [more]
back to top
BLAST of Kinesin-like protein KIF26A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO490273.289e-3433.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349612.630e-1928.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO396104.701e-1827.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO385911.059e-1730.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO392702.083e-1725.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Kinesin-like protein KIF26A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif26ab7.034e-4435.86kinesin family member 26A [Source:NCBI gene;Acc:10... [more]
kif26ab8.004e-4435.86kinesin family member 26A [Source:NCBI gene;Acc:10... [more]
kif26ab8.895e-4435.86kinesin family member 26A [Source:NCBI gene;Acc:10... [more]
kif26ab9.070e-4435.86kinesin family member 26A [Source:NCBI gene;Acc:10... [more]
kif26ba4.034e-4233.17kinesin family member 26B [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Kinesin-like protein KIF26A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051203.10.000e+099.57SMESG000051203.1[more]
SMESG000051203.11.467e-1098.64SMESG000051203.1[more]
SMESG000051203.10.000e+099.54SMESG000051203.1[more]
SMESG000051203.11.110e-2198.64SMESG000051203.1[more]
SMESG000028296.12.330e-4932.17SMESG000028296.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011180 ID=SMED30011180|Name=Kinesin-like protein KIF26A|organism=Schmidtea mediterranea sexual|type=transcript|length=4701bp
CCTGAACCAACTGGTTATGTGATCCAACATGAGTTGACAATCAGTAGACA
TTCTCATGAACTTGGATCATTAATTTCGATTCACAAGGAGAATTTCAATT
ATTGTCGCGCAGATGCCCCGGATTTTTCCTTTGTTTTCGATGAAAATTTC
CTTAACAATTTCAAAGGGAATCCACATAGAATCTGAAGAATATTTATCTT
ATTCAATGGAATTCTTACAAATCCCATAAACTAAGTCAAAGATATTCCAC
TGTGAATTGAACTTCCATGCCTCAATTGTGTAGATTTCGGCTTGAAAGAA
AAATAAGTTCGGACAAGTTGCGCAAGCACAATGCCGCCAGACAAAAGTCT
CCTCCGAAATTTCATAAACTATTTCTCAACAACGATGTTGTTTTACCAAC
GAAACTGCAGCAATTTTTGTCGGAGGGTTTACGTTTTCCTGACAATGAAA
AAATCAACTCGAACAAAGTTCGAGTTGTACTAAAGATCAACGAATCTCGA
GATACTCCAAGCTGTTTGACGATAAACAAAAGTCAAAATTGCGTTGGTGT
GATTGACCCAACGCCGTCCAGGAGAAGTCAAACGTCAACAACCCATGTAA
ATCTCTTTCCTTTCGATTCTATTTTGACAGACTCAGATTCACAGGAATTT
ATATTTACCGATTCTCTTGTTGATCCAGTGCTCGAATTGTTCAAAGGAAG
GGACAGTTGTATATTCTCTTTTGGACATTCTGGACTGGGCAAAACCAAAT
CAATGGTTGGATCGGACCGGTCCATATCGCACATTGGAATCATTCCTTGC
GCCTTGATTTGGACATTCAAATTAATCGACCAACTCAAGCGAAATAATCA
TTCAATGCGTTATTTCGTGAGCATCTCCGCGATTGAGGTGTCGAACAAAA
ACAATGTCTGCGATCTATTAGCCAATTTAAATCCATTATCAAAACTTTCC
GGCGATTCCAAATCACAAGAGCTGAGTGACCAAGACCAATCAAATACGAT
TCTAATCAACCAGCGGGAATTACCCGCGAGTTGTTTGCAAGAAGCCGCCT
GCATCCTTGATAGCGCTCTCGCCACCAGATCTAATGAAAATGAATCATTG
ACTCATTTGCAGTTGATTATTCATCTTTATCACTGTCGCGTCGATGCGGT
CGCTGAACGCAACTGCGATTCTAATAACGTGACAAGCAAAAAGAGTCGCC
TGATTTTGTTGGATTTGGGATCAGGGCGTCACGGTAACGAAGACCAGCAA
ATTCTATCTCTACAAGGGATTTCAAAAGTGATTTTGGCTTTGTATACTAG
CCAAAGACATGTGCCGTATAAAGAAAATGTCCTGACTCAGTTACTAAAAG
ATACCCTCAACCAGAACTTTACCACCACAATGCTACTTCATATCTCAAGC
AAAGAGCAACATTATAGTGAAACATTACAAGTTGTACAATTGGCTTATAA
ACTTTATAGGATGCGTTTGAAAAAGTACCGATCAGTCGGATTTTCTGTAT
CTGACGAAACGTCATCGTGTAGTAGCTCAAGTAGCGGTTTGCAAAGTCGT
CGACTTCGGCCACATATGGGCATCGGCGCCGCTAGGCGAAGCAGTGGGAA
TAGTAGCGCTTCTTCAGAAGTAGATTTGACGTCAGCCAGTGAATTGTCAT
GTTGTGAAACTGTTATTTTCAAAGGAGACACTAATCATAGCTTATCTGAT
AAATCGCCCGATCGGATGTCAGGAAAACGGAAGTTGAGATCAGTTTCATC
AGATTCCGATAATGGCTTTTCTGATATGGAAAAATCAAAATCGCTAGCAT
ATAATTCGGGAAATAGTTTATCTCCAACTATTCGCCATCGAATGTCACCA
AGAACAAATGCTCGAGCTTGGCCTTCCACAAACGATTCATCCAACTGTTC
CATAGAGCATAGTTCAGAAACTTGGGTTGACGGTCCGAAAGCTGTATATA
ATGCTGCGAATGGTGGAAATCCCATATTAGATGATCGGAATTATATGAAT
AAGGTTACTGAAATTGGAATGAATATAGTTCAAGATCTAACAGTTAAACC
AACCATGATATCTAAAGAAACCCAATGTGATGATGTTTGGGATAGTGGGT
CGTCTATTACGGATGGTAGCAGTCATTCTAACACGTTGGATAGGAAAGAT
CATAGACCATTATCAGATATTAGTGAATGCACCGAAGAAACAGAAAGCAA
CTTAGCTACCGATTCAGACCTTAACAAGATGAATATGATTGATCAAACCG
AACCGACAAATGTGCTAGACGATCTGCTTGAATCAACTTTCGGGTTAAGT
CCAATTCATCAAGGAAATCAATTCAAACCCCTGGAATTGTCATTCCTTGA
TTCACAGGAAGCTCATTTACAGTTTATTGAAAAGATGAAAAATCCCATTG
AAATCCCTCATTCAGAAATCGCAAACCATTCAATCATAAATTTATCAGAT
AACCTTAACTTCACGGAACCGGTGAAGGAAATCCAAAAGCCTATTCGAAG
AGATTCGAGTAAAACAAAAAAGCATAGTCATTTGTCCAGTGACTCCAAAA
AAATAAGTAAAAGTGAAGGAAAAGAGAAAAAAAGCAAACCGAAATGCAAG
AAATGCTCAAAAAGTTCCGATGATAACCGTTCAAAGTCTATGACTTCTTC
AAGCAGCACCAACTTTTCAAGAGTGAGCAGCTGGATAGAGAACGTTGAAT
ATGAGACCCAATCTTCAAAATCTAGCAAGCTGGACTCAACTTTTCATCAA
TATGCTCACGATGGAAATCAGTTGCATTATACCCATCATCATTCGCAGCC
GGATATATCCTATCAGCGAGATCTGTTTGACATAAACAGCATATTTGCCC
CTTCTGTCCATTATCAACATCAATATTCTCAAAATATTTCTTGGATGCAT
CCTGACCCCCTTCAAGCTCAATATTCACTTTATGATGGGTATAATTTGAC
CCTAACCAATCCATCAATACCAACATCCTCATCTTTATCGCGAACAAATT
CTCATTATCATCATGTACCACCTGCAGCAGTCACACAAATATCTTCACTC
CATCACATGGTAACACAGCAAGAATCGTGCACTAATGGACAGCCTATAAT
CTACTCACCAAAACCGAGAAGGGCGCACACGCATTTGTCAAACATATCTT
TGCCAGTGAATTGTCTATCTGTCACTCAGTTACCTCTGCCTCCACTTCCT
CAGCCAACCATCTTTGTTGGTACACATGTGCCAGTCATTGAAAATCTCAA
CACCTCTTGTTCATTCAACACGCCACCAGCCAATAGTCCTGTACCGGTTC
AAATTCCTCCGAAACCAAAATGTAAAACTTTACCTCGTGATTTATTTTCA
AGTTCAATTTCTTCTTTGAAAAACAGTAATAAAAGTGATCTTCATTCTTC
AAAGGCAGCAGCTATAAGTGACCTCAAAATGAAAGACAAATCGAAAAAGG
ATACTAAAAATATCATATCGATTCTATTTGCTCCTTTTATTAGTCTAAAG
AAAAAAATAAATAAAAATAAAAACACAAATGAAACGAATCCGATAATTTC
TGACAGTGAAAATTCTAAGTCCATAACAAACCGATCGGAAAGCTTGGAAA
ACCAACCGATTTGCCGATTCATAGTTTCAGATAAAATTCAGCCTCCCATC
ATTTTGGCTAGTCCATATCGCCTTGTTACGTCACCTAAAACTGATATCCT
TCCTACTGAAAGCAGCGGAAACGGAAGTGATTGCAGTAGTTTTCATAATA
GAGAATTAGCCAAATCAAGACTGAATGATCCTTTGACACGACACAAATCT
AGAAGGGGTTCAACACAAAATATGCCTAAAAATATGCCTAAACAAAGACC
GACCAGTAGTGGCTACGGTAGCATTATCATTAAAGGTGACAGCGAAGTTT
CTTCTCACAATGATTCGTCTAGTGAATATTCAGCGTCTGGACTGACCAGT
AATAAAAATCATGGAGGTCATTCAAGATTAAAGCACTCCATATCATTATC
AAATTATAAATCAATTACCGATGCCAACATAACGAATCTTTCAAAAAACT
TCTCAACGGACATGTCGAACCCGTCAAGCGTAATATCACGCGAAGCCAAT
TTCAATGACAGTGTAAAAACAGCGGAAGATTTATTATTACAAGAAAGATT
GAAAATGTCTTTGAATGAAGAAAGAAAATTTGTAATCCAGTTGGTAGAAA
CGAATCGGTTGCGTGGAGTCATGGTTGATTCTGAAATTATGAACCTAATG
TGTTTCAAATGCTTGGATAATTTCGATGTCAACAACCCGATCAAACGGAA
TGAATGCGAAAAATTAATTGAAAAACTTGATCAGGAAATAGAGCATCTCA
AACCAGTACTCTCCCAGGCTCAAAATCATCTCACTCTCATAACCTCATTC
ATTTCTCATCCGCAGTCTCGATGATGGAGATTTTCTTTTTTCTCTTTTTT
TTTAGCTATTTTCTATCTTTCACAATTGTCGTTTTTATTCGTTTGGAATT
TTGATCTAAATTTTATGAATTTTGTTTATAAAATATCTACAAATATAAAT
AAATATAATTATCAGCGACAACAAAATGGCTCAAACCGGACAGTGAAAAG
TCAACAGAATCGCATGAATGTTTTTTATATATAATATATTTATTAAATTG
AATATTTTAAAGAATTTTGTAAATAAATTAGACAACACTTTTATGATAGT
C
back to top

protein sequence of SMED30011180-orf-1

>SMED30011180-orf-1 ID=SMED30011180-orf-1|Name=SMED30011180-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1386bp
MPQLCRFRLERKISSDKLRKHNAARQKSPPKFHKLFLNNDVVLPTKLQQF
LSEGLRFPDNEKINSNKVRVVLKINESRDTPSCLTINKSQNCVGVIDPTP
SRRSQTSTTHVNLFPFDSILTDSDSQEFIFTDSLVDPVLELFKGRDSCIF
SFGHSGLGKTKSMVGSDRSISHIGIIPCALIWTFKLIDQLKRNNHSMRYF
VSISAIEVSNKNNVCDLLANLNPLSKLSGDSKSQELSDQDQSNTILINQR
ELPASCLQEAACILDSALATRSNENESLTHLQLIIHLYHCRVDAVAERNC
DSNNVTSKKSRLILLDLGSGRHGNEDQQILSLQGISKVILALYTSQRHVP
YKENVLTQLLKDTLNQNFTTTMLLHISSKEQHYSETLQVVQLAYKLYRMR
LKKYRSVGFSVSDETSSCSSSSSGLQSRRLRPHMGIGAARRSSGNSSASS
EVDLTSASELSCCETVIFKGDTNHSLSDKSPDRMSGKRKLRSVSSDSDNG
FSDMEKSKSLAYNSGNSLSPTIRHRMSPRTNARAWPSTNDSSNCSIEHSS
ETWVDGPKAVYNAANGGNPILDDRNYMNKVTEIGMNIVQDLTVKPTMISK
ETQCDDVWDSGSSITDGSSHSNTLDRKDHRPLSDISECTEETESNLATDS
DLNKMNMIDQTEPTNVLDDLLESTFGLSPIHQGNQFKPLELSFLDSQEAH
LQFIEKMKNPIEIPHSEIANHSIINLSDNLNFTEPVKEIQKPIRRDSSKT
KKHSHLSSDSKKISKSEGKEKKSKPKCKKCSKSSDDNRSKSMTSSSSTNF
SRVSSWIENVEYETQSSKSSKLDSTFHQYAHDGNQLHYTHHHSQPDISYQ
RDLFDINSIFAPSVHYQHQYSQNISWMHPDPLQAQYSLYDGYNLTLTNPS
IPTSSSLSRTNSHYHHVPPAAVTQISSLHHMVTQQESCTNGQPIIYSPKP
RRAHTHLSNISLPVNCLSVTQLPLPPLPQPTIFVGTHVPVIENLNTSCSF
NTPPANSPVPVQIPPKPKCKTLPRDLFSSSISSLKNSNKSDLHSSKAAAI
SDLKMKDKSKKDTKNIISILFAPFISLKKKINKNKNTNETNPIISDSENS
KSITNRSESLENQPICRFIVSDKIQPPIILASPYRLVTSPKTDILPTESS
GNGSDCSSFHNRELAKSRLNDPLTRHKSRRGSTQNMPKNMPKQRPTSSGY
GSIIIKGDSEVSSHNDSSSEYSASGLTSNKNHGGHSRLKHSISLSNYKSI
TDANITNLSKNFSTDMSNPSSVISREANFNDSVKTAEDLLLQERLKMSLN
EERKFVIQLVETNRLRGVMVDSEIMNLMCFKCLDNFDVNNPIKRNECEKL
IEKLDQEIEHLKPVLSQAQNHLTLITSFISHPQSR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000110pharynx progenitor cell
PLANA:0000478pharynx musculature
Vocabulary: INTERPRO
TermDefinition
IPR036961Kinesin_motor_dom_sf
IPR001752Kinesin_motor_dom
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0003777microtubule motor activity
GO:0005524ATP binding
GO:0008017microtubule binding
GO:0000166nucleotide binding
GO:0003774motor activity
Vocabulary: biological process
TermDefinition
GO:0007018microtubule-based movement
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001752Kinesin motor domainPRINTSPR00380KINESINHEAVYcoord: 270..287
score: 31.62
coord: 349..370
score: 41.21
coord: 144..165
score: 43.37
IPR001752Kinesin motor domainSMARTSM00129kinesin_4coord: 65..407
e-value: 2.5E-14
score: -1.6
IPR001752Kinesin motor domainPFAMPF00225Kinesincoord: 101..395
e-value: 4.6E-36
score: 124.4
IPR001752Kinesin motor domainPROSITEPS50067KINESIN_MOTOR_2coord: 67..399
score: 43.189
IPR036961Kinesin motor domain superfamilyGENE3DG3DSA:3.40.850.10coord: 65..407
e-value: 1.9E-44
score: 153.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1179..1237
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1164..1237
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1164..1178
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 609..633
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1088..1108
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 474..549
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 475..494
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 495..549
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 752..786
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 738..796
NoneNo IPR availablePANTHERPTHR21608UNCHARACTERIZEDcoord: 76..480
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 59..397