Low affinity cationic amino acid transporter 2

Overview
NameLow affinity cationic amino acid transporter 2
Smed IDSMED30011169
Length (bp)918
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Low affinity cationic amino acid transporter 2 (SMED30011169) t-SNE clustered cells

Violin plots show distribution of expression levels for Low affinity cationic amino acid transporter 2 (SMED30011169) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Low affinity cationic amino acid transporter 2 (SMED30011169) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Low affinity cationic amino acid transporter 2 (SMED30011169) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011169

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30011169SMESG000073991.1 dd_Smed_v4_1732_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30011169SMESG000073991.1 dd_Smed_v4_1732_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30011169SMESG000073991.1 dd_Smed_v4_1732_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011169SMESG000073991.1 Contig29407newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011169SMESG000073991.1 Contig29407uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011169SMESG000073991.1 Contig35487newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011169SMESG000073991.1 Contig35487uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parenchymal cellSMED30011169SMESG000073991.1 dd_Smed_v6_1732_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
glial cellSMED30011169SMESG000073991.1 dd_Smed_v6_1732_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Low affinity cationic amino acid transporter 2 vs. Ensembl Fly
Match: cold (gene:FBgn0031268 transcript:FBtr0078069)

HSP 1 Score: 75.8702 bits (185), Expect = 1.552e-16
Identity = 39/117 (33.33%), Postives = 67/117 (57.26%), Query Frame = 1
Query:   52 IMKSVFFLSTVILFFNYCSALQCYKCANVEGNYYDCIRSSTQCNPNQDACISDVIYTTPTYWTQSTERRAFVTKGCSTKSQCEG-MQRVIQERCTYDMKSDWACIECCFSDNCNYAV 399
            ++ +V+  S V    N+ + L+CY C+N  GN   C+ +   C P ++ C +++ + +  Y+++   ++ +V+K C TK QC+   +R +Q  CT+    DWAC ECC  D CNY V
Sbjct:   10 LVAAVYLCSQV----NFVAGLECYVCSNQTGNTEKCLNTIKTCEPFENVCGTEIRWGSQPYFSEGALKQYYVSKRCMTKEQCQSKRKRYMQLYCTHIWYEDWACNECCKGDRCNYFV 122          
BLAST of Low affinity cationic amino acid transporter 2 vs. Ensembl Fly
Match: cold (gene:FBgn0031268 transcript:FBtr0310022)

HSP 1 Score: 75.8702 bits (185), Expect = 1.552e-16
Identity = 39/117 (33.33%), Postives = 67/117 (57.26%), Query Frame = 1
Query:   52 IMKSVFFLSTVILFFNYCSALQCYKCANVEGNYYDCIRSSTQCNPNQDACISDVIYTTPTYWTQSTERRAFVTKGCSTKSQCEG-MQRVIQERCTYDMKSDWACIECCFSDNCNYAV 399
            ++ +V+  S V    N+ + L+CY C+N  GN   C+ +   C P ++ C +++ + +  Y+++   ++ +V+K C TK QC+   +R +Q  CT+    DWAC ECC  D CNY V
Sbjct:   10 LVAAVYLCSQV----NFVAGLECYVCSNQTGNTEKCLNTIKTCEPFENVCGTEIRWGSQPYFSEGALKQYYVSKRCMTKEQCQSKRKRYMQLYCTHIWYEDWACNECCKGDRCNYFV 122          
BLAST of Low affinity cationic amino acid transporter 2 vs. TrEMBL
Match: A0A5K4F8A0 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 1.577e-27
Identity = 60/129 (46.51%), Postives = 72/129 (55.81%), Query Frame = 1
Query:   70 FLSTVILFFNYCSALQCYKCANVEGNYYDCIRSSTQCNPNQDACISDVIYTTPTYWTQSTERRAFVTKGCSTKSQCEGMQRVIQERCTYDMKSDWACIECCFSDNCNYAVKNHSGKIFSNDLFKMTFIL 456
             LS V     +  +L+CY C N EGN+ DCIR+   C P QD C S V Y TP +WT   ERRAFVTKGC+T S C+    VI ERC+     DW C  CC SD CNY V   + +  S   +   FIL
Sbjct:    5 ILSLVASLPFHLDSLECYICTNEEGNWNDCIRTIQTCEPLQDTCQSIVQYRTPPFWTVLAERRAFVTKGCTTTSACQMTSNVISERCSRSKTRDWICSYCCNSDRCNYYVPGGALRTCSPQTYTALFIL 133          
BLAST of Low affinity cationic amino acid transporter 2 vs. TrEMBL
Match: A0A4Z2DIL0 (High affinity cationic amino acid transporter 1 isoform X3 OS=Schistosoma japonicum OX=6182 GN=EWB00_000569 PE=4 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 7.477e-27
Identity = 56/111 (50.45%), Postives = 69/111 (62.16%), Query Frame = 1
Query:   70 FLSTVILFFNYCSALQCYKCANVEGNYYDCIRSSTQCNPNQDACISDVIYTTPTYWTQSTERRAFVTKGCSTKSQCEGMQRVIQERCTYDMKSDWACIECCFSDNCNYAVK 402
             LS ++ F  +  AL+CY C N EGN+ DCIR++  C P QD C S V Y TP++WT   ERRAFVTKGC+T S C+    VI ERC+     DW C  CC +D CNY V 
Sbjct:    5 ILSLILSFPFHIVALECYICTNEEGNWNDCIRTTQTCEPLQDTCQSIVQYRTPSFWTVLAERRAFVTKGCTTMSACQITSNVIAERCSRLKTRDWICSYCCNADRCNYYVP 115          
BLAST of Low affinity cationic amino acid transporter 2 vs. TrEMBL
Match: A0A267ECX5 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018876g3 PE=4 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 1.340e-26
Identity = 57/125 (45.60%), Postives = 76/125 (60.80%), Query Frame = 1
Query:  109 ALQCYKCANVEGNYYDCIRSSTQCNPNQDACISDVIYTTPT-YWTQSTERRAFVTKGCSTKSQCEGMQRVIQERCTYDMKSDWACIECCFSDNCNYAV---KNHSGKIFSN-DLFKMTFILFTLM 468
            A++CY+C N+EGN   C+R ST C P++DACIS V YTTPT YWT   ER+ +++KGC + S C   + + Q  CTYD  +DW+C+ECC  D CNY V       G +FS   L      L  L+
Sbjct:    2 AIKCYECRNIEGNGDACVRLSTPCTPDEDACISHVHYTTPTSYWTPLAERKHYISKGCVSYSACIKQRDITQRSCTYDWFTDWSCVECCRGDLCNYYVTLSGQPVGPVFSRVALLTAVSCLLRLL 126          
BLAST of Low affinity cationic amino acid transporter 2 vs. TrEMBL
Match: A0A504Z8T6 (Uncharacterized protein OS=Fasciola gigantica OX=46835 GN=FGIG_00080 PE=4 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 1.245e-24
Identity = 55/115 (47.83%), Postives = 69/115 (60.00%), Query Frame = 1
Query:   73 LSTVILFFNY--CSALQCYKCANVEGNYYDCIRSSTQCNPNQDACISDVIYTTPTYWTQSTERRAFVTKGCSTKSQCEGMQRVIQERCTYDMKSDWACIECCFSDNCNYAVKNHS 411
            L   ILF +Y   +AL CY C   EGN   CIR+  +C P+QDAC S V+Y T  +WT   +RRAFVTKGC+T++ C   Q  +   CT     +W C  CC +DNCNY V NHS
Sbjct:    8 LWIYILFGHYRRVNALDCYVCTEKEGNIGPCIRTIQRCEPSQDACQSLVVYRTAPWWTVLAKRRAFVTKGCTTRAACFTAQNQLSPLCTPSETRNWMCSYCCITDNCNYQVPNHS 122          
BLAST of Low affinity cationic amino acid transporter 2 vs. TrEMBL
Match: A0A4E0RUS3 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_003496 PE=4 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 7.466e-24
Identity = 54/115 (46.96%), Postives = 68/115 (59.13%), Query Frame = 1
Query:   73 LSTVILFFNY--CSALQCYKCANVEGNYYDCIRSSTQCNPNQDACISDVIYTTPTYWTQSTERRAFVTKGCSTKSQCEGMQRVIQERCTYDMKSDWACIECCFSDNCNYAVKNHS 411
            L   +LF +Y   +AL CY C   EGN   CIR+  +C P+QDAC S V+Y T   WT   +RRAFVTKGC+T++ C   Q  +   CT     +W C  CC +DNCNY V NHS
Sbjct:    8 LWIYVLFGHYRRVNALDCYVCTEKEGNIGPCIRTVQRCEPSQDACQSLVVYRTTPRWTVLAKRRAFVTKGCTTRAACFTAQNQLSPLCTPSETRNWMCSYCCITDNCNYQVPNHS 122          
BLAST of Low affinity cationic amino acid transporter 2 vs. Planmine SMEST
Match: SMESG000073991.1 (SMESG000073991.1)

HSP 1 Score: 281.567 bits (719), Expect = 1.295e-96
Identity = 136/138 (98.55%), Postives = 137/138 (99.28%), Query Frame = 1
Query:   55 MKSVFFLSTVILFFNYCSALQCYKCANVEGNYYDCIRSSTQCNPNQDACISDVIYTTPTYWTQSTERRAFVTKGCSTKSQCEGMQRVIQERCTYDMKSDWACIECCFSDNCNYAVKNHSGKIFSNDLFKMTFILFTLM 468
            MKSVFFLSTVILFFNYCSALQCYKCANVEGNYYDCIRSSTQCNPNQDACIS+VIYTTPTYWTQSTERRAFVTKGCSTKSQCEGMQRVIQERCTYDMKSDWACIECCFSDNCNYAVKNHSGKIFSND FKMTFILFTLM
Sbjct:    1 MKSVFFLSTVILFFNYCSALQCYKCANVEGNYYDCIRSSTQCNPNQDACISNVIYTTPTYWTQSTERRAFVTKGCSTKSQCEGMQRVIQERCTYDMKSDWACIECCFSDNCNYAVKNHSGKIFSNDRFKMTFILFTLM 138          
BLAST of Low affinity cationic amino acid transporter 2 vs. Planmine SMEST
Match: SMESG000049007.1 (SMESG000049007.1)

HSP 1 Score: 84.7297 bits (208), Expect = 6.090e-20
Identity = 42/123 (34.15%), Postives = 64/123 (52.03%), Query Frame = 1
Query:   61 SVFFLSTVILFFNYCS---ALQCYKCANVEGNYYDCIRSSTQCNPNQDACISDVIYTTPTYWTQSTERRAFVTKGCSTKSQCEGMQRVIQERCTYDMKSDWACIECCFSDNCNYAVKNHSGKI 420
             ++FL+  +L     S    ++CY C   EGN   CI++S QC   +D C++++ Y TP YW    ERR F+ K C  K++C  ++      C  +   DW C ECC  + CNY V   S ++
Sbjct:    2 KLYFLAIFLLILTNISIVELMECYVCNTQEGNNDKCIKTSMQCLEPEDFCLTEITYETPPYWLYIMERRHFIKKRCIAKAECNQIKDQYASSCYREYYMDWKCAECCEGELCNYYVTLSSRQV 124          
The following BLAST results are available for this feature:
BLAST of Low affinity cationic amino acid transporter 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low affinity cationic amino acid transporter 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low affinity cationic amino acid transporter 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cold1.552e-1633.33gene:FBgn0031268 transcript:FBtr0078069[more]
cold1.552e-1633.33gene:FBgn0031268 transcript:FBtr0310022[more]
back to top
BLAST of Low affinity cationic amino acid transporter 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low affinity cationic amino acid transporter 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low affinity cationic amino acid transporter 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low affinity cationic amino acid transporter 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low affinity cationic amino acid transporter 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K4F8A01.577e-2746.51Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A4Z2DIL07.477e-2750.45High affinity cationic amino acid transporter 1 is... [more]
A0A267ECX51.340e-2645.60Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A504Z8T61.245e-2447.83Uncharacterized protein OS=Fasciola gigantica OX=4... [more]
A0A4E0RUS37.466e-2446.96Uncharacterized protein OS=Fasciola hepatica OX=61... [more]
back to top
BLAST of Low affinity cationic amino acid transporter 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low affinity cationic amino acid transporter 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low affinity cationic amino acid transporter 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low affinity cationic amino acid transporter 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low affinity cationic amino acid transporter 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low affinity cationic amino acid transporter 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000073991.11.295e-9698.55SMESG000073991.1[more]
SMESG000049007.16.090e-2034.15SMESG000049007.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011169 ID=SMED30011169|Name=Low affinity cationic amino acid transporter 2|organism=Schmidtea mediterranea sexual|type=transcript|length=918bp
CTCTTCCGATCTGTTTAAATTTGTTATTAATTTATATTTCTTAATATATA
AATTATGAAAAGTGTTTTTTTTCTTTCTACAGTTATTCTATTTTTTAACT
ATTGTTCTGCCTTACAGTGTTATAAATGTGCCAATGTTGAAGGAAATTAT
TATGACTGTATACGCTCTTCAACTCAATGCAATCCAAATCAAGATGCTTG
CATATCCGATGTGATATATACAACCCCAACATATTGGACTCAATCAACCG
AACGTAGGGCTTTTGTTACAAAAGGTTGCTCAACAAAGTCGCAGTGTGAA
GGAATGCAAAGAGTTATTCAAGAGCGATGTACCTATGATATGAAGAGTGA
CTGGGCATGCATTGAGTGTTGTTTTTCTGATAATTGCAACTATGCAGTAA
AGAATCATTCCGGGAAGATTTTTTCGAATGATCTTTTCAAAATGACTTTT
ATTCTATTTACATTAATGTGTTTTGATTTCTTTATATTGTGACTACCTGA
TTTTTTTTGTTGCATGTAATATAAATTAGACTTTAAACTAAAATCACAAT
AAATATTTATTTGATGTCATCATATTTTATATGTTATGTTTACTTGAAAA
TTTCACGATAATTATGAACTGGAAGTCAGTTGTGTTATACATTCCAAAAT
GTTACTTCGTTCATTATGTGTATAAATGCTAATATTATAATGGTGGTAAA
CAATAAAAATAATCGAAAATGACTTTCAAAAATAATCTCATCTATTTTCT
TAATATTATTAAAAAAATTACAATAAAGCTCTAAATTCTAGTTTTCCATT
ATAATCAGTAATGTTTTGACCGTTTGAGATATAATTTCTATGTTTAGTTG
TATATCTTTTGTACTTTTATATATTTTGTAATTTTTGTTGGCAATTTTTG
AAATTTATATATATAGCG
back to top

protein sequence of SMED30011169-orf-1

>SMED30011169-orf-1 ID=SMED30011169-orf-1|Name=SMED30011169-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=146bp
MKSVFFLSTVILFFNYCSALQCYKCANVEGNYYDCIRSSTQCNPNQDACI
SDVIYTTPTYWTQSTERRAFVTKGCSTKSQCEGMQRVIQERCTYDMKSDW
ACIECCFSDNCNYAVKNHSGKIFSNDLFKMTFILFTLMCFDFFIL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
GO:0015171amino acid transmembrane transporter activity
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
GO:0003333amino acid transmembrane transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
PLANA:0007528glial cell
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:2.10.60.10coord: 18..117
e-value: 1.2E-6
score: 30.6
NoneNo IPR availablePANTHERPTHR20914:SF21COILED, ISOFORM Acoord: 3..120
NoneNo IPR availablePANTHERPTHR20914EP1/ROBO-1coord: 3..120
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.897
NoneNo IPR availableSUPERFAMILYSSF57302Snake toxin-likecoord: 18..113