mll5-2

Overview
Namemll5-2 (AGA95408.1)
Smed IDSMED30011145
Length (bp)3231
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of mll5-2 (SMED30011145) t-SNE clustered cells

Violin plots show distribution of expression levels for mll5-2 (SMED30011145) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of mll5-2 (SMED30011145) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for mll5-2 (SMED30011145) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011145

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30011145SMESG000017190.1 SmedASXL_010211SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30011145SMESG000017190.1 SmedASXL_010211SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30011145SMESG000017190.1 Contig36521newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011145SMESG000017190.1 Contig36521uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
non-ciliated epidermisSMED30011145SMESG000017190.1 dd_Smed_v4_7881_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30011145SMESG000017190.1 KC262344smed_ncbi_20200123PMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30011145SMESG000017190.1 KC262344smed_ncbi_20200123PMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30011145SMESG000017190.1 KC262344smed_ncbi_20200123PMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of mll5-2 vs. Ensembl Human
Match: KMT2E (lysine methyltransferase 2E [Source:HGNC Symbol;Acc:HGNC:18541])

HSP 1 Score: 87.0409 bits (214), Expect = 1.864e-17
Identity = 43/127 (33.86%), Postives = 67/127 (52.76%), Query Frame = 2
Query: 1673 LEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGKV--RCP 2047
            L+++  L   +++    G+ ML E++           PFV  Y  F    + VD   +GN AR++RRSC PN ++ H I  G++++ I +   I +G E+TI FD  +  C+Y V CAC K    CP
Sbjct:  201 LKSAKDLPPDALIIEYRGKFMLREQFEANGYFFKRPYPFVLFYSKFHGLEMCVDARTFGNEARFIRRSCTPNAEVRHEIQDGTIHLYIYSIHSIPKGTEITIAFDFDYGNCKYKVDCACLKENPECP 327          
BLAST of mll5-2 vs. Ensembl Human
Match: KMT2E (lysine methyltransferase 2E [Source:HGNC Symbol;Acc:HGNC:18541])

HSP 1 Score: 85.5001 bits (210), Expect = 1.228e-16
Identity = 41/121 (33.88%), Postives = 65/121 (53.72%), Query Frame = 2
Query: 1673 LEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGK 2035
            L+++  L   +++    G+ ML E++           PFV  Y  F    + VD   +GN AR++RRSC PN ++ H I  G++++ I +   I +G E+TI FD  +  C+Y V CAC K
Sbjct:  277 LKSAKDLPPDALIIEYRGKFMLREQFEANGYFFKRPYPFVLFYSKFHGLEMCVDARTFGNEARFIRRSCTPNAEVRHEIQDGTIHLYIYSIHSIPKGTEITIAFDFDYGNCKYKVDCACLK 397          
BLAST of mll5-2 vs. Ensembl Human
Match: KMT2E (lysine methyltransferase 2E [Source:HGNC Symbol;Acc:HGNC:18541])

HSP 1 Score: 87.0409 bits (214), Expect = 1.238e-16
Identity = 43/128 (33.59%), Postives = 67/128 (52.34%), Query Frame = 2
Query: 1673 LEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGKV--RCPA 2050
            L+++  L   +++    G+ ML E++           PFV  Y  F    + VD   +GN AR++RRSC PN ++ H I  G++++ I +   I +G E+TI FD  +  C+Y V CAC K    CP 
Sbjct:  343 LKSAKDLPPDALIIEYRGKFMLREQFEANGYFFKRPYPFVLFYSKFHGLEMCVDARTFGNEARFIRRSCTPNAEVRHEIQDGTIHLYIYSIHSIPKGTEITIAFDFDYGNCKYKVDCACLKENPECPV 470          
BLAST of mll5-2 vs. Ensembl Human
Match: KMT2E (lysine methyltransferase 2E [Source:HGNC Symbol;Acc:HGNC:18541])

HSP 1 Score: 85.8853 bits (211), Expect = 2.138e-16
Identity = 41/118 (34.75%), Postives = 62/118 (52.54%), Query Frame = 2
Query: 1703 SIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGKV--RCPA 2050
            +++    G+ ML E++           PFV  Y  F    + VD   +GN AR++RRSC PN ++ H I  G++++ I +   I +G E+TI FD  +  C+Y V CAC K    CP 
Sbjct:  353 ALIIEYRGKFMLREQFEANGYFFKRPYPFVLFYSKFHGLEMCVDARTFGNEARFIRRSCTPNAEVRHEIQDGTIHLYIYSIHSIPKGTEITIAFDFDYGNCKYKVDCACLKENPECPV 470          
BLAST of mll5-2 vs. Ensembl Human
Match: KMT2E (lysine methyltransferase 2E [Source:HGNC Symbol;Acc:HGNC:18541])

HSP 1 Score: 86.2705 bits (212), Expect = 2.728e-16
Identity = 43/127 (33.86%), Postives = 67/127 (52.76%), Query Frame = 2
Query: 1673 LEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGK--VRCP 2047
            L+++  L   +++    G+ ML E++           PFV  Y  F    + VD   +GN AR++RRSC PN ++ H I  G++++ I +   I +G E+TI FD  +  C+Y V CAC K    CP
Sbjct:  343 LKSAKDLPPDALIIEYRGKFMLREQFEANGYFFKRPYPFVLFYSKFHGLEMCVDARTFGNEARFIRRSCTPNAEVRHEIQDGTIHLYIYSIHSIPKGTEITIAFDFDYGNCKYKVDCACLKENPECP 469          
BLAST of mll5-2 vs. Ensembl Celegans
Match: set-24 (SET (Trithorax/polycomb) domain containing [Source:UniProtKB/TrEMBL;Acc:Q9U2G8])

HSP 1 Score: 57.7658 bits (138), Expect = 3.992e-8
Identity = 30/92 (32.61%), Postives = 48/92 (52.17%), Query Frame = 2
Query: 1784 PFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLY-IVIRTTTEICQGVELTIPFDLPFEICQYPVQCAC---GKVRCP 2047
            P  F+Y+G G   + + T+  GN +   RRSC  N  L H +   S + ++I +T  I Q  E+T+PFD  + + + P+ CA      + CP
Sbjct:   91 PRTFMYYGIGGKPICITTSELGNYSEITRRSCQNNSTLRHILGSKSNFRVMIVSTKVILQDHEITLPFDKNWILSETPLHCATHFDKMIECP 182          
BLAST of mll5-2 vs. Ensembl Celegans
Match: set-9 (Histone-lysine N-methyltransferase set-9 [Source:UniProtKB/Swiss-Prot;Acc:O44498])

HSP 1 Score: 53.9138 bits (128), Expect = 7.528e-7
Identity = 28/91 (30.77%), Postives = 46/91 (50.55%), Query Frame = 2
Query: 1790 VFLYHGF-----------GDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTI-VGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCA 2026
            +F+Y G            G   + +DT   GN  ++ RRSC PN  L+H +    +L I+I  T +I +  E+T+PFD  +   +  ++CA
Sbjct:  979 IFMYDGLMKGTAGEDMGDGQELVCIDTKRKGNDTKFTRRSCVPNCVLKHVLGSNATLGIMIVATKDITRNTEVTLPFDADWRESEVELECA 1069          
BLAST of mll5-2 vs. Ensembl Celegans
Match: set-26 (Histone-lysine N-methyltransferase set-26 [Source:UniProtKB/Swiss-Prot;Acc:Q9U263])

HSP 1 Score: 53.9138 bits (128), Expect = 7.868e-7
Identity = 28/91 (30.77%), Postives = 46/91 (50.55%), Query Frame = 2
Query: 1790 VFLYHGF-----------GDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTI-VGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCA 2026
            +F+Y G            G   + +DT   GN  ++ RRSC PN  L+H +    +L I+I  T +I +  E+T+PFD  +   +  ++CA
Sbjct:  987 IFMYDGLMKGTAGEDMGDGQELVCIDTKRKGNDTKFTRRSCVPNCVLKHVLGSNATLGIMIVATKDITRNTEVTLPFDADWRESEVELECA 1077          
BLAST of mll5-2 vs. Ensembl Fly
Match: trx (gene:FBgn0003862 transcript:FBtr0082947)

HSP 1 Score: 61.2326 bits (147), Expect = 5.951e-9
Identity = 31/77 (40.26%), Postives = 42/77 (54.55%), Query Frame = 2
Query: 1814 DHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGKVRC 2044
            D  LVVD T+ GN AR++   C+PN   +   + G  +I+I     I QG ELT  +  PFE  + P  C+CG  RC
Sbjct: 3647 DDNLVVDATMRGNAARFINHCCEPNCYSKVVDILGHKHIIIFALRRIVQGEELTYDYKFPFEDEKIP--CSCGSKRC 3721          
BLAST of mll5-2 vs. Ensembl Fly
Match: trx (gene:FBgn0003862 transcript:FBtr0082950)

HSP 1 Score: 61.2326 bits (147), Expect = 5.951e-9
Identity = 31/77 (40.26%), Postives = 42/77 (54.55%), Query Frame = 2
Query: 1814 DHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGKVRC 2044
            D  LVVD T+ GN AR++   C+PN   +   + G  +I+I     I QG ELT  +  PFE  + P  C+CG  RC
Sbjct: 3647 DDNLVVDATMRGNAARFINHCCEPNCYSKVVDILGHKHIIIFALRRIVQGEELTYDYKFPFEDEKIP--CSCGSKRC 3721          
BLAST of mll5-2 vs. Ensembl Fly
Match: trx (gene:FBgn0003862 transcript:FBtr0082948)

HSP 1 Score: 61.2326 bits (147), Expect = 6.056e-9
Identity = 31/77 (40.26%), Postives = 42/77 (54.55%), Query Frame = 2
Query: 1814 DHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGKVRC 2044
            D  LVVD T+ GN AR++   C+PN   +   + G  +I+I     I QG ELT  +  PFE  + P  C+CG  RC
Sbjct: 3279 DDNLVVDATMRGNAARFINHCCEPNCYSKVVDILGHKHIIIFALRRIVQGEELTYDYKFPFEDEKIP--CSCGSKRC 3353          
BLAST of mll5-2 vs. Ensembl Fly
Match: trx (gene:FBgn0003862 transcript:FBtr0082949)

HSP 1 Score: 61.2326 bits (147), Expect = 6.056e-9
Identity = 31/77 (40.26%), Postives = 42/77 (54.55%), Query Frame = 2
Query: 1814 DHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGKVRC 2044
            D  LVVD T+ GN AR++   C+PN   +   + G  +I+I     I QG ELT  +  PFE  + P  C+CG  RC
Sbjct: 3279 DDNLVVDATMRGNAARFINHCCEPNCYSKVVDILGHKHIIIFALRRIVQGEELTYDYKFPFEDEKIP--CSCGSKRC 3353          
BLAST of mll5-2 vs. Ensembl Fly
Match: trx (gene:FBgn0003862 transcript:FBtr0100277)

HSP 1 Score: 61.2326 bits (147), Expect = 6.056e-9
Identity = 31/77 (40.26%), Postives = 42/77 (54.55%), Query Frame = 2
Query: 1814 DHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGKVRC 2044
            D  LVVD T+ GN AR++   C+PN   +   + G  +I+I     I QG ELT  +  PFE  + P  C+CG  RC
Sbjct: 3279 DDNLVVDATMRGNAARFINHCCEPNCYSKVVDILGHKHIIIFALRRIVQGEELTYDYKFPFEDEKIP--CSCGSKRC 3353          
BLAST of mll5-2 vs. Ensembl Zebrafish
Match: setd5 (SET domain containing 5 [Source:ZFIN;Acc:ZDB-GENE-080523-1])

HSP 1 Score: 87.8113 bits (216), Expect = 5.389e-17
Identity = 43/127 (33.86%), Postives = 66/127 (51.97%), Query Frame = 2
Query: 1673 LEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCAC--GKVRCP 2047
            L A+  L   +++    G++ML +++        +  PFV  Y  F +  + VD   +GN AR++RRSC PN ++ H I  G +++ I    +I +  E+TI FD  F  C Y V CAC  G   CP
Sbjct:  346 LRAARSLDPETLIIEYRGKVMLRQQFEVNGHFFKKPYPFVLFYSKFNEVEMCVDARTFGNDARFIRRSCTPNAEVRHMIAEGMIHLCIYAVAQISKDSEVTIGFDYEFSCCNYKVDCACHKGNQDCP 472          
BLAST of mll5-2 vs. Ensembl Zebrafish
Match: setd5 (SET domain containing 5 [Source:ZFIN;Acc:ZDB-GENE-080523-1])

HSP 1 Score: 87.4261 bits (215), Expect = 6.476e-17
Identity = 43/127 (33.86%), Postives = 66/127 (51.97%), Query Frame = 2
Query: 1673 LEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCAC--GKVRCP 2047
            L A+  L   +++    G++ML +++        +  PFV  Y  F +  + VD   +GN AR++RRSC PN ++ H I  G +++ I    +I +  E+TI FD  F  C Y V CAC  G   CP
Sbjct:  340 LRAARSLDPETLIIEYRGKVMLRQQFEVNGHFFKKPYPFVLFYSKFNEVEMCVDARTFGNDARFIRRSCTPNAEVRHMIAEGMIHLCIYAVAQISKDSEVTIGFDYEFSCCNYKVDCACHKGNQDCP 466          
BLAST of mll5-2 vs. Ensembl Zebrafish
Match: kmt2e (lysine (K)-specific methyltransferase 2E [Source:ZFIN;Acc:ZDB-GENE-030131-4120])

HSP 1 Score: 87.4261 bits (215), Expect = 6.687e-17
Identity = 45/127 (35.43%), Postives = 67/127 (52.76%), Query Frame = 2
Query: 1673 LEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCAC--GKVRCP 2047
            L+A   L + S++    G++ML +++           PFV  Y  F    + VD   +GN AR++RRSC PN ++ H I  G L++ I +   I +G E+TI FD  +  C+Y V CAC  G   CP
Sbjct:  344 LKAVRDLAADSLIIEYRGKVMLRQQFEANGYFFKRPYPFVLFYSKFDGLEMCVDARSFGNEARFIRRSCTPNAEVRHVIEEGMLHLYIYSLRSISKGSEITIGFDYDYGSCKYKVDCACVKGNPECP 470          
BLAST of mll5-2 vs. Ensembl Zebrafish
Match: setd2 (SET domain containing 2, histone lysine methyltransferase [Source:ZFIN;Acc:ZDB-GENE-030131-2140])

HSP 1 Score: 63.1586 bits (152), Expect = 2.117e-9
Identity = 38/135 (28.15%), Postives = 61/135 (45.19%), Query Frame = 2
Query: 1643 IVLFDGCTMGLEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQ-CACGKVRC 2044
            ++L +    GL A+  LQ  + V    G ++   E+       A  K   + +    ++  ++D T+ GN +R++  SC+PN + +   V G L I   TT  +  G ELT  FD  F+      Q C CG   C
Sbjct: 1385 VILTESKGWGLRAAKDLQPNTFVLEYCGEVLDHREFKARVKEYARNKNIHYYFMALKNNE-IIDATLKGNCSRFMNHSCEPNCETQKWTVNGQLRIGFFTTKAVTAGTELT--FDYQFQRYGKEAQKCFCGAPSC 1516          
BLAST of mll5-2 vs. Ensembl Zebrafish
Match: setd2 (SET domain containing 2, histone lysine methyltransferase [Source:ZFIN;Acc:ZDB-GENE-030131-2140])

HSP 1 Score: 63.1586 bits (152), Expect = 2.219e-9
Identity = 38/135 (28.15%), Postives = 61/135 (45.19%), Query Frame = 2
Query: 1643 IVLFDGCTMGLEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQ-CACGKVRC 2044
            ++L +    GL A+  LQ  + V    G ++   E+       A  K   + +    ++  ++D T+ GN +R++  SC+PN + +   V G L I   TT  +  G ELT  FD  F+      Q C CG   C
Sbjct: 1300 VILTESKGWGLRAAKDLQPNTFVLEYCGEVLDHREFKARVKEYARNKNIHYYFMALKNNE-IIDATLKGNCSRFMNHSCEPNCETQKWTVNGQLRIGFFTTKAVTAGTELT--FDYQFQRYGKEAQKCFCGAPSC 1431          
BLAST of mll5-2 vs. Ensembl Xenopus
Match: KMT2E (lysine (K)-specific methyltransferase 2E [Source:NCBI gene;Acc:779539])

HSP 1 Score: 88.5817 bits (218), Expect = 1.041e-17
Identity = 41/121 (33.88%), Postives = 66/121 (54.55%), Query Frame = 2
Query: 1673 LEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGK 2035
            L+A+  L   +++    G+ ML E++           PF+  Y  F    + VD   +GN AR++RRSC PN ++ H I  G++++ I + + I +G E+TI FD  +  C+Y V CAC K
Sbjct:  259 LKAAKDLLPETLIIEYRGKFMLREQFEANGYFFKRPYPFILFYSKFHGLEMCVDARTFGNEARFIRRSCTPNAEVRHVIEEGTIHLYIYSISSIPKGAEITIAFDFDYANCKYKVDCACFK 379          
BLAST of mll5-2 vs. Ensembl Xenopus
Match: KMT2E (lysine (K)-specific methyltransferase 2E [Source:NCBI gene;Acc:779539])

HSP 1 Score: 88.1965 bits (217), Expect = 1.946e-17
Identity = 41/121 (33.88%), Postives = 66/121 (54.55%), Query Frame = 2
Query: 1673 LEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGK 2035
            L+A+  L   +++    G+ ML E++           PF+  Y  F    + VD   +GN AR++RRSC PN ++ H I  G++++ I + + I +G E+TI FD  +  C+Y V CAC K
Sbjct:  322 LKAAKDLLPETLIIEYRGKFMLREQFEANGYFFKRPYPFILFYSKFHGLEMCVDARTFGNEARFIRRSCTPNAEVRHVIEEGTIHLYIYSISSIPKGAEITIAFDFDYANCKYKVDCACFK 442          
BLAST of mll5-2 vs. Ensembl Xenopus
Match: KMT2E (lysine (K)-specific methyltransferase 2E [Source:NCBI gene;Acc:779539])

HSP 1 Score: 88.5817 bits (218), Expect = 2.269e-17
Identity = 41/121 (33.88%), Postives = 66/121 (54.55%), Query Frame = 2
Query: 1673 LEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGK 2035
            L+A+  L   +++    G+ ML E++           PF+  Y  F    + VD   +GN AR++RRSC PN ++ H I  G++++ I + + I +G E+TI FD  +  C+Y V CAC K
Sbjct:  325 LKAAKDLLPETLIIEYRGKFMLREQFEANGYFFKRPYPFILFYSKFHGLEMCVDARTFGNEARFIRRSCTPNAEVRHVIEEGTIHLYIYSISSIPKGAEITIAFDFDYANCKYKVDCACFK 445          
BLAST of mll5-2 vs. Ensembl Xenopus
Match: KMT2E (lysine (K)-specific methyltransferase 2E [Source:NCBI gene;Acc:779539])

HSP 1 Score: 88.1965 bits (217), Expect = 6.773e-17
Identity = 41/121 (33.88%), Postives = 66/121 (54.55%), Query Frame = 2
Query: 1673 LEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGK 2035
            L+A+  L   +++    G+ ML E++           PF+  Y  F    + VD   +GN AR++RRSC PN ++ H I  G++++ I + + I +G E+TI FD  +  C+Y V CAC K
Sbjct:  358 LKAAKDLLPETLIIEYRGKFMLREQFEANGYFFKRPYPFILFYSKFHGLEMCVDARTFGNEARFIRRSCTPNAEVRHVIEEGTIHLYIYSISSIPKGAEITIAFDFDYANCKYKVDCACFK 478          
BLAST of mll5-2 vs. Ensembl Xenopus
Match: KMT2E (lysine (K)-specific methyltransferase 2E [Source:NCBI gene;Acc:779539])

HSP 1 Score: 88.1965 bits (217), Expect = 6.809e-17
Identity = 41/121 (33.88%), Postives = 66/121 (54.55%), Query Frame = 2
Query: 1673 LEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGK 2035
            L+A+  L   +++    G+ ML E++           PF+  Y  F    + VD   +GN AR++RRSC PN ++ H I  G++++ I + + I +G E+TI FD  +  C+Y V CAC K
Sbjct:  325 LKAAKDLLPETLIIEYRGKFMLREQFEANGYFFKRPYPFILFYSKFHGLEMCVDARTFGNEARFIRRSCTPNAEVRHVIEEGTIHLYIYSISSIPKGAEITIAFDFDYANCKYKVDCACFK 445          
BLAST of mll5-2 vs. Ensembl Mouse
Match: Kmt2e (lysine (K)-specific methyltransferase 2E [Source:MGI Symbol;Acc:MGI:1924825])

HSP 1 Score: 85.8853 bits (211), Expect = 2.609e-16
Identity = 43/127 (33.86%), Postives = 67/127 (52.76%), Query Frame = 2
Query: 1673 LEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGK--VRCP 2047
            L+++  L   +++    G+ ML E++           PFV  Y  F    + VD   +GN AR++RRSC PN ++ H I  G++++ I +   I +G E+TI FD  +  C+Y V CAC K    CP
Sbjct:  343 LKSAKDLPPDALIIEYRGKFMLREQFEANGYFFKRPYPFVLFYSKFHGLEMCVDARTFGNEARFIRRSCTPNAEVRHEIEEGTIHLYIYSIQSIPKGTEITIAFDFDYGNCKYKVDCACLKENPECP 469          
BLAST of mll5-2 vs. Ensembl Mouse
Match: Kmt2e (lysine (K)-specific methyltransferase 2E [Source:MGI Symbol;Acc:MGI:1924825])

HSP 1 Score: 85.8853 bits (211), Expect = 2.609e-16
Identity = 43/127 (33.86%), Postives = 67/127 (52.76%), Query Frame = 2
Query: 1673 LEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGK--VRCP 2047
            L+++  L   +++    G+ ML E++           PFV  Y  F    + VD   +GN AR++RRSC PN ++ H I  G++++ I +   I +G E+TI FD  +  C+Y V CAC K    CP
Sbjct:  343 LKSAKDLPPDALIIEYRGKFMLREQFEANGYFFKRPYPFVLFYSKFHGLEMCVDARTFGNEARFIRRSCTPNAEVRHEIEEGTIHLYIYSIQSIPKGTEITIAFDFDYGNCKYKVDCACLKENPECP 469          
BLAST of mll5-2 vs. Ensembl Mouse
Match: Setd5 (SET domain containing 5 [Source:MGI Symbol;Acc:MGI:1920145])

HSP 1 Score: 85.1149 bits (209), Expect = 4.313e-16
Identity = 42/127 (33.07%), Postives = 65/127 (51.18%), Query Frame = 2
Query: 1673 LEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCAC--GKVRCP 2047
            L A+  L   +++    G++ML +++        +  PFV  Y  F    + VD   +GN AR++RRSC PN ++ H I  G +++ I   + I +  E+TI FD  +  C Y V CAC  G   CP
Sbjct:  286 LRAARDLALDTLIIEYRGKVMLRQQFEVNGHFFKKPYPFVLFYSKFNGVEMCVDARTFGNDARFIRRSCTPNAEVRHMIADGMIHLCIYAVSAITKDAEVTIAFDYEYSNCNYKVDCACHKGNRNCP 412          
BLAST of mll5-2 vs. Ensembl Mouse
Match: Setd5 (SET domain containing 5 [Source:MGI Symbol;Acc:MGI:1920145])

HSP 1 Score: 85.1149 bits (209), Expect = 4.443e-16
Identity = 42/127 (33.07%), Postives = 65/127 (51.18%), Query Frame = 2
Query: 1673 LEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCAC--GKVRCP 2047
            L A+  L   +++    G++ML +++        +  PFV  Y  F    + VD   +GN AR++RRSC PN ++ H I  G +++ I   + I +  E+TI FD  +  C Y V CAC  G   CP
Sbjct:  305 LRAARDLALDTLIIEYRGKVMLRQQFEVNGHFFKKPYPFVLFYSKFNGVEMCVDARTFGNDARFIRRSCTPNAEVRHMIADGMIHLCIYAVSAITKDAEVTIAFDYEYSNCNYKVDCACHKGNRNCP 431          
BLAST of mll5-2 vs. Ensembl Mouse
Match: Setd5 (SET domain containing 5 [Source:MGI Symbol;Acc:MGI:1920145])

HSP 1 Score: 85.1149 bits (209), Expect = 4.443e-16
Identity = 42/127 (33.07%), Postives = 65/127 (51.18%), Query Frame = 2
Query: 1673 LEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCAC--GKVRCP 2047
            L A+  L   +++    G++ML +++        +  PFV  Y  F    + VD   +GN AR++RRSC PN ++ H I  G +++ I   + I +  E+TI FD  +  C Y V CAC  G   CP
Sbjct:  305 LRAARDLALDTLIIEYRGKVMLRQQFEVNGHFFKKPYPFVLFYSKFNGVEMCVDARTFGNDARFIRRSCTPNAEVRHMIADGMIHLCIYAVSAITKDAEVTIAFDYEYSNCNYKVDCACHKGNRNCP 431          
BLAST of mll5-2 vs. UniProt/SwissProt
Match: sp|Q8IZD2|KMT2E_HUMAN (Inactive histone-lysine N-methyltransferase 2E OS=Homo sapiens OX=9606 GN=KMT2E PE=1 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.310e-15
Identity = 43/127 (33.86%), Postives = 67/127 (52.76%), Query Frame = 2
Query: 1673 LEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGK--VRCP 2047
            L+++  L   +++    G+ ML E++           PFV  Y  F    + VD   +GN AR++RRSC PN ++ H I  G++++ I +   I +G E+TI FD  +  C+Y V CAC K    CP
Sbjct:  343 LKSAKDLPPDALIIEYRGKFMLREQFEANGYFFKRPYPFVLFYSKFHGLEMCVDARTFGNEARFIRRSCTPNAEVRHEIQDGTIHLYIYSIHSIPKGTEITIAFDFDYGNCKYKVDCACLKENPECP 469          
BLAST of mll5-2 vs. UniProt/SwissProt
Match: sp|Q3UG20|KMT2E_MOUSE (Inactive histone-lysine N-methyltransferase 2E OS=Mus musculus OX=10090 GN=Kmt2e PE=1 SV=2)

HSP 1 Score: 85.8853 bits (211), Expect = 1.764e-15
Identity = 43/127 (33.86%), Postives = 67/127 (52.76%), Query Frame = 2
Query: 1673 LEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGK--VRCP 2047
            L+++  L   +++    G+ ML E++           PFV  Y  F    + VD   +GN AR++RRSC PN ++ H I  G++++ I +   I +G E+TI FD  +  C+Y V CAC K    CP
Sbjct:  343 LKSAKDLPPDALIIEYRGKFMLREQFEANGYFFKRPYPFVLFYSKFHGLEMCVDARTFGNEARFIRRSCTPNAEVRHEIEEGTIHLYIYSIQSIPKGTEITIAFDFDYGNCKYKVDCACLKENPECP 469          
BLAST of mll5-2 vs. UniProt/SwissProt
Match: sp|Q9C0A6|SETD5_HUMAN (Histone-lysine N-methyltransferase SETD5 OS=Homo sapiens OX=9606 GN=SETD5 PE=1 SV=2)

HSP 1 Score: 85.1149 bits (209), Expect = 2.657e-15
Identity = 42/127 (33.07%), Postives = 65/127 (51.18%), Query Frame = 2
Query: 1673 LEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCAC--GKVRCP 2047
            L A+  L   +++    G++ML +++        +  PFV  Y  F    + VD   +GN AR++RRSC PN ++ H I  G +++ I   + I +  E+TI FD  +  C Y V CAC  G   CP
Sbjct:  286 LRAARDLALDTLIIEYRGKVMLRQQFEVNGHFFKKPYPFVLFYSKFNGVEMCVDARTFGNDARFIRRSCTPNAEVRHMIADGMIHLCIYAVSAITKDAEVTIAFDYEYSNCNYKVDCACHKGNRNCP 412          
BLAST of mll5-2 vs. UniProt/SwissProt
Match: sp|Q5XJV7|SETD5_MOUSE (Histone-lysine N-methyltransferase SETD5 OS=Mus musculus OX=10090 GN=Setd5 PE=1 SV=2)

HSP 1 Score: 85.1149 bits (209), Expect = 3.017e-15
Identity = 42/127 (33.07%), Postives = 65/127 (51.18%), Query Frame = 2
Query: 1673 LEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCAC--GKVRCP 2047
            L A+  L   +++    G++ML +++        +  PFV  Y  F    + VD   +GN AR++RRSC PN ++ H I  G +++ I   + I +  E+TI FD  +  C Y V CAC  G   CP
Sbjct:  286 LRAARDLALDTLIIEYRGKVMLRQQFEVNGHFFKKPYPFVLFYSKFNGVEMCVDARTFGNDARFIRRSCTPNAEVRHMIADGMIHLCIYAVSAITKDAEVTIAFDYEYSNCNYKVDCACHKGNRNCP 412          
BLAST of mll5-2 vs. UniProt/SwissProt
Match: sp|Q24742|TRX_DROVI (Histone-lysine N-methyltransferase trithorax OS=Drosophila virilis OX=7244 GN=trx PE=3 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 1.390e-8
Identity = 32/77 (41.56%), Postives = 43/77 (55.84%), Query Frame = 2
Query: 1814 DHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGKVRC 2044
            D  LVVD T+ GN AR++  SC+PN   +   + G  +I+I     I QG ELT  +  PFE  + P  C+CG  RC
Sbjct: 3749 DDNLVVDATMRGNAARFINHSCEPNCYSKVVDILGHKHIIIFALRRIVQGEELTYDYKFPFEDEKIP--CSCGSKRC 3823          
BLAST of mll5-2 vs. TrEMBL
Match: L0HB50 (Mll5-2 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 693.73 bits (1789), Expect = 0.000e+0
Identity = 385/385 (100.00%), Postives = 385/385 (100.00%), Query Frame = 2
Query: 1511 TGALLAXXXXXXXXXXXXQTLLANANVEGLEQGTEFLDRNPRCRIVLFDGCTMGLEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGKVRCPAXXXXXXXXXXXXXTSNINCEQVIEDKLRELSQPLLSSTSAYAGNVSGLKKPIIANRFGIQSRQIMESFTDVAECKPNLSSFHNDSKSLTDHNSILTEDRIKIEEREPSIELDEXXXXXXXXXXXXXXXXXDLCGDAILTTKRRPKPVQHPDFEVDINSRISDRSRVRSTHNTPIKTKTEPILKRTSSNTDNVNIKSPSKSLNTKE 2665
            TGALLAKIEEMKESEEEKQTLLANANVEGLEQGTEFLDRNPRCRIVLFDGCTMGLEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGKVRCPAIKHRRKHHRNRIITSNINCEQVIEDKLRELSQPLLSSTSAYAGNVSGLKKPIIANRFGIQSRQIMESFTDVAECKPNLSSFHNDSKSLTDHNSILTEDRIKIEEREPSIELDEQQQQQKSPPPSNKQISSDLCGDAILTTKRRPKPVQHPDFEVDINSRISDRSRVRSTHNTPIKTKTEPILKRTSSNTDNVNIKSPSKSLNTKE
Sbjct:    1 TGALLAKIEEMKESEEEKQTLLANANVEGLEQGTEFLDRNPRCRIVLFDGCTMGLEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGKVRCPAIKHRRKHHRNRIITSNINCEQVIEDKLRELSQPLLSSTSAYAGNVSGLKKPIIANRFGIQSRQIMESFTDVAECKPNLSSFHNDSKSLTDHNSILTEDRIKIEEREPSIELDEQQQQQKSPPPSNKQISSDLCGDAILTTKRRPKPVQHPDFEVDINSRISDRSRVRSTHNTPIKTKTEPILKRTSSNTDNVNIKSPSKSLNTKE 385          
BLAST of mll5-2 vs. TrEMBL
Match: A0A0X3NN92 (SET domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR153392 PE=4 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 5.406e-48
Identity = 111/244 (45.49%), Postives = 152/244 (62.30%), Query Frame = 2
Query: 1439 RLAIINRRNPPFKKDYKEATKSLYTGALLAXXXXXXXXXXXXQTLLANANVEGLEQGTEF----LDRNPRCRIVLFDGCTMGLEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGKVRCPAXXXXXXXXXXXXXTSNINCEQVIEDKLRELSQPLLS 2158
            R AI +     + K+Y+EA++S YT AL  +              +A     G E+        LDR P CR+VLFD    GLE+SVRL    +V  + GR+MLMEEY  Y  P AEY  +V LY+ FGD+G+ VD T++GN AR++RRSC PN KL+H IV G +++VIRT  +I  GVELTIPFD+ +  C+YP+ CAC + RCP +K RRK  RN+++  N++  + I  KL+ELS+ LLS
Sbjct:  295 REAIPSSLGAAWAKNYQEASRSTYTNALFLR--------------IAERISTGRERDQRLPPTCLDRTPLCRLVLFDHNDKGLESSVRLSRGDVVTELRGRIMLMEEYEHYVDPTAEYNRYVILYNDFGDNGVAVDATLFGNDARFIRRSCTPNCKLDHFIVCGKMHVVIRTIQDISPGVELTIPFDVDYTSCRYPLDCACARSRCPVLKWRRKLLRNKVM-PNLDYSKCINSKLKELSK-LLS 522          
BLAST of mll5-2 vs. TrEMBL
Match: A0A183T6J3 (SET domain-containing protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS12091 PE=4 SV=1)

HSP 1 Score: 194.512 bits (493), Expect = 4.011e-47
Identity = 111/244 (45.49%), Postives = 152/244 (62.30%), Query Frame = 2
Query: 1439 RLAIINRRNPPFKKDYKEATKSLYTGALLAXXXXXXXXXXXXQTLLANANVEGLEQGTEF----LDRNPRCRIVLFDGCTMGLEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGKVRCPAXXXXXXXXXXXXXTSNINCEQVIEDKLRELSQPLLS 2158
            R AI +     + K+Y+EA++S YT AL  +              +A     G E+        LDR P CR+VLFD    GLE+SVRL    +V  + GR+MLMEEY  Y  P AEY  +V LY+ FGD+G+ VD T++GN AR++RRSC PN KL+H IV G +++VIRT  +I  GVELTIPFD+ +  C+YP+ CAC + RCP +K RRK  RN+++  N++  + I  KL+ELS+ LLS
Sbjct:  499 REAIPSSLGAAWAKNYQEASRSTYTNALFLR--------------IAERISTGRERDQRLPPTCLDRTPLCRLVLFDHNDKGLESSVRLSRGDVVTELRGRIMLMEEYEHYVDPTAEYNRYVILYNDFGDNGVAVDATLFGNDARFIRRSCTPNCKLDHFIVCGKMHVVIRTIQDISPGVELTIPFDVDYTSCRYPLDCACARSRCPVLKWRRKLLRNKVM-PNLDYSKCINSKLKELSK-LLS 726          
BLAST of mll5-2 vs. TrEMBL
Match: A0A504YQ62 (Histone-lysine N-methyltransferase 2E OS=Fasciola gigantica OX=46835 GN=FGIG_01331 PE=4 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 7.124e-47
Identity = 99/228 (43.42%), Postives = 139/228 (60.96%), Query Frame = 2
Query: 1472 FKKDYKEATKSLYTGALLAXXXXXXXXXXXXQTLLANANVE-GLEQGTEFLDRNPRCRIVLFDGCTMGLEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGKVRCPAXXXXXXXXXXXXXTSNINCEQVIEDKLRELSQPL 2152
            + KDY+EA  + YT ALL  +EE             +AN+E         L R+  CR+VLFD    GLEAS+RL    +V  + G+ +L+EEY  Y  P +EY  +V  Y+GFG+ G+V+D T YGN AR++RRSC PN +LEH +V G L +V+RT+TE+  G ELTIPFDL ++ C+YP+ CAC + RCP     R+      +  N++  + IE +LR LS+PL
Sbjct:  364 WAKDYQEAENNAYTKALLDHVEERI-----------SANLERNYRIPPSCLTRSSLCRVVLFDHDDKGLEASIRLSPSEVVTEVRGQFLLLEEYEHYVDPVSEYNRYVLFYNGFGERGVVIDATQYGNSARFIRRSCIPNCRLEHYVVQGKLLVVVRTSTEVTSGTELTIPFDLDYQACRYPLDCACARSRCPV-LKWRRKLLRNKVVPNLDYSKYIESQLRVLSKPL 579          
BLAST of mll5-2 vs. TrEMBL
Match: A0A0X3P3N5 (Histone-lysine N-methyltransferase 2E OS=Schistocephalus solidus OX=70667 GN=KMT2E PE=4 SV=1)

HSP 1 Score: 193.356 bits (490), Expect = 1.984e-46
Identity = 111/244 (45.49%), Postives = 152/244 (62.30%), Query Frame = 2
Query: 1439 RLAIINRRNPPFKKDYKEATKSLYTGALLAXXXXXXXXXXXXQTLLANANVEGLEQGTEF----LDRNPRCRIVLFDGCTMGLEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGKVRCPAXXXXXXXXXXXXXTSNINCEQVIEDKLRELSQPLLS 2158
            R AI +     + K+Y+EA++S YT AL  +              +A     G E+        LDR P CR+VLFD    GLE+SVRL    +V  + GR+MLMEEY  Y  P AEY  +V LY+ FGD+G+ VD T++GN AR++RRSC PN KL+H IV G +++VIRT  +I  GVELTIPFD+ +  C+YP+ CAC + RCP +K RRK  RN+++  N++  + I  KL+ELS+ LLS
Sbjct:  637 REAIPSSLGAAWAKNYQEASRSTYTNALFLR--------------IAERISTGRERDQRLPPTCLDRTPLCRLVLFDHNDKGLESSVRLSRGDVVTELRGRIMLMEEYEHYVDPTAEYNRYVILYNDFGDNGVAVDATLFGNDARFIRRSCTPNCKLDHFIVCGKMHVVIRTIQDISPGVELTIPFDVDYTSCRYPLDCACARSRCPVLKWRRKLLRNKVM-PNLDYSKCINSKLKELSK-LLS 864          

HSP 2 Score: 97.8265 bits (242), Expect = 1.014e-16
Identity = 49/91 (53.85%), Postives = 60/91 (65.93%), Query Frame = 2
Query:   32 MELVGQMYKLSACFDTPNEYKGLPYD-YFPDDAVSYGSTICSFGLPYNDHNYGMPTGLTPPVMAPHLMD-PVSKPKKLINDLFSKAKSEPT 298
            + LVG M++L+AC D     +   +D Y+PD  +SYG TICSFGLPYNDHNY  P GLTPP MAPHLMD P++K   L     S  +S PT
Sbjct:   50 VHLVGPMFELTACIDHKQNVED--FDAYYPDSGLSYGPTICSFGLPYNDHNYAFPVGLTPPTMAPHLMDLPLAKVSNLTTS--SVTQSSPT 136          
BLAST of mll5-2 vs. Ensembl Cavefish
Match: setd5 (SET domain containing 5 [Source:NCBI gene;Acc:103025313])

HSP 1 Score: 88.9669 bits (219), Expect = 2.135e-17
Identity = 44/127 (34.65%), Postives = 67/127 (52.76%), Query Frame = 2
Query: 1673 LEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCAC--GKVRCP 2047
            L A+  L+  +++    G++ML +++        +  PFV  Y  F +  + VD   +GN AR++RRSC PN ++ H I  G +++ I   T I +  E+TI FD  F  C Y V CAC  G   CP
Sbjct:  343 LRAARDLEFDTLIIEYRGKVMLKQQFEVNGHFFKKPYPFVLFYSKFNETEMCVDARTFGNDARFIRRSCTPNAEVRHMIAEGMIHLCIYAVTRISKDSEVTIGFDYEFNSCNYKVDCACHKGNQNCP 469          
BLAST of mll5-2 vs. Ensembl Cavefish
Match: setd5 (SET domain containing 5 [Source:NCBI gene;Acc:103025313])

HSP 1 Score: 88.9669 bits (219), Expect = 2.379e-17
Identity = 44/127 (34.65%), Postives = 67/127 (52.76%), Query Frame = 2
Query: 1673 LEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCAC--GKVRCP 2047
            L A+  L+  +++    G++ML +++        +  PFV  Y  F +  + VD   +GN AR++RRSC PN ++ H I  G +++ I   T I +  E+TI FD  F  C Y V CAC  G   CP
Sbjct:  343 LRAARDLEFDTLIIEYRGKVMLKQQFEVNGHFFKKPYPFVLFYSKFNETEMCVDARTFGNDARFIRRSCTPNAEVRHMIAEGMIHLCIYAVTRISKDSEVTIGFDYEFNSCNYKVDCACHKGNQNCP 469          
BLAST of mll5-2 vs. Ensembl Cavefish
Match: kmt2e (lysine (K)-specific methyltransferase 2E [Source:ZFIN;Acc:ZDB-GENE-030131-4120])

HSP 1 Score: 86.6557 bits (213), Expect = 3.903e-17
Identity = 45/128 (35.16%), Postives = 67/128 (52.34%), Query Frame = 2
Query: 1673 LEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCAC--GKVRCPA 2050
            L+A   L + S++    G++ML +++           PFV  Y  F    + VD   +GN AR++RRSC PN ++ H I  G L++ I +   I +G E+TI FD  +  C+Y V CAC  G   CP 
Sbjct:  259 LKAVRDLAADSLIIEYRGKVMLRQQFEANGYFFKRPYPFVLFYSKFDGLEMCVDARSFGNEARFIRRSCTPNAEVRHVIEDGMLHLYIYSLRSISKGSEITIGFDYDYGSCKYKVDCACVRGNQECPV 386          
BLAST of mll5-2 vs. Ensembl Cavefish
Match: setd2 (SET domain containing 2, histone lysine methyltransferase [Source:NCBI gene;Acc:103039344])

HSP 1 Score: 61.6178 bits (148), Expect = 5.671e-9
Identity = 36/135 (26.67%), Postives = 62/135 (45.93%), Query Frame = 2
Query: 1643 IVLFDGCTMGLEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQ-CACGKVRC 2044
            ++L +    GL A+  L + + V    G ++  +E+       A  K   + +    ++  ++D T+ GN +R++  SC+PN + +   V G L +   TT  +  G ELT  FD  F+      Q C CG   C
Sbjct: 1607 VILTESKGWGLRAAKDLPANTFVLEYCGEVLDHKEFKSRVKEYARNKNIHYYFMALKNNE-IIDATLKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKAVSAGTELT--FDYQFQRYGKEAQKCFCGAPSC 1738          
BLAST of mll5-2 vs. Ensembl Cavefish
Match: setd2 (SET domain containing 2, histone lysine methyltransferase [Source:NCBI gene;Acc:103039344])

HSP 1 Score: 61.2326 bits (147), Expect = 6.182e-9
Identity = 36/135 (26.67%), Postives = 62/135 (45.93%), Query Frame = 2
Query: 1643 IVLFDGCTMGLEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQ-CACGKVRC 2044
            ++L +    GL A+  L + + V    G ++  +E+       A  K   + +    ++  ++D T+ GN +R++  SC+PN + +   V G L +   TT  +  G ELT  FD  F+      Q C CG   C
Sbjct: 1621 VILTESKGWGLRAAKDLPANTFVLEYCGEVLDHKEFKSRVKEYARNKNIHYYFMALKNNE-IIDATLKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKAVSAGTELT--FDYQFQRYGKEAQKCFCGAPSC 1752          
BLAST of mll5-2 vs. Ensembl Sea Lamprey
Match: kmt2e (lysine (K)-specific methyltransferase 2E [Source:ZFIN;Acc:ZDB-GENE-030131-4120])

HSP 1 Score: 86.6557 bits (213), Expect = 1.198e-17
Identity = 43/130 (33.08%), Postives = 68/130 (52.31%), Query Frame = 2
Query: 1664 TMGLEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGK--VRCP 2047
            T  L+A+  L + +++    G +ML +++           PFV  Y  F    + VD   +GN AR++RRSC PN ++ H I  G  ++ I +  +I +G E+TI FD  +  C Y V CAC +  + CP
Sbjct:  337 TKALKAARDLPAHTLLIEYRGMVMLQQQFEANGLFFKRPYPFVLFYSKFLGVEMCVDARTFGNEARFVRRSCSPNAEVRHAIEAGLFHLYIYSLADISKGAEITIGFDFDYSGCHYTVNCACPREGLACP 466          

HSP 2 Score: 48.9062 bits (115), Expect = 5.806e-6
Identity = 21/67 (31.34%), Postives = 38/67 (56.72%), Query Frame = 2
Query:  680 VIDCICENNYDDKRMVQCEACGIKQHLDCMYVNPRQVQNFLKHRCQKCSDIKVDIPRAKAIQNSRKN 880
            V  C+C   +DD  M+ C+ C + QH+DCM ++ +++ +   + C+ C    VD  RA  +Q+ R+ 
Sbjct:  116 VTRCVCGFTHDDGYMICCDKCSVWQHIDCMGIDRQRIPD--TYLCEFCEPRSVDQERAFQLQSRRRG 180          
BLAST of mll5-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010827.1 (pep scaffold:Pmarinus_7.0:GL487806:1944:5585:-1 gene:ENSPMAG00000009809.1 transcript:ENSPMAT00000010827.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.8322 bits (120), Expect = 1.071e-7
Identity = 36/127 (28.35%), Postives = 60/127 (47.24%), Query Frame = 2
Query: 1667 MGLEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSL-YIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGKVRC 2044
            +GL A+  ++  ++V   IG ++  E   +  +        V+++   GDH  V+D T+ G  ARY+  SC PN   E          I+I ++  + +G ELT  +   FE  Q+ + C CG   C
Sbjct:    7 LGLYAARDIEKHTMVIEYIGTIIRNEVANRREALYKAQNRGVYMFRIDGDH--VIDATLTGGPARYINHSCSPNCVAEVVNFDKERSKIIIISSRRLQKGEELTYDYKFDFEDDQHKIPCHCGAPNC 131          
BLAST of mll5-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002322.1 (pep scaffold:Pmarinus_7.0:GL477101:2485:64197:1 gene:ENSPMAG00000002099.1 transcript:ENSPMAT00000002322.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 1.954e-7
Identity = 36/126 (28.57%), Postives = 58/126 (46.03%), Query Frame = 2
Query: 1667 MGLEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGKVRC 2044
            +GL AS  ++  ++V   IG ++  E   ++          V+++    +H  V+D T+ G  ARY+  SC PN   E         I+I +   I +G ELT  +   FE  Q  + C CG + C
Sbjct: 3794 LGLYASRDIEKHTMVIEYIGEIIRNEVANRHEKLYESTNRGVYMFRLDSEH--VIDATITGGPARYINHSCAPNCVAELVTFDRENKIIISSCRRIQKGEELTYDYLFDFEDDQNKIPCHCGAINC 3917          
BLAST of mll5-2 vs. Ensembl Sea Lamprey
Match: setd1a (SET domain containing 1A, histone lysine methyltransferase [Source:ZFIN;Acc:ZDB-GENE-080521-4])

HSP 1 Score: 49.6766 bits (117), Expect = 4.129e-6
Identity = 26/77 (33.77%), Postives = 37/77 (48.05%), Query Frame = 2
Query: 1814 DHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGKVRC 2044
            DH  ++D T  GN+AR++  SC+PN   +   V     IVI +   I    E+T  +  P E  + P  C CG   C
Sbjct: 1775 DHDTIIDATKVGNLARFINHSCNPNCYAKVITVESQKRIVIYSKQAINVNEEITYDYKFPIEENKIP--CLCGAEHC 1849          
BLAST of mll5-2 vs. Ensembl Yeast
Match: SET1 (Histone methyltransferase, subunit of the COMPASS (Set1C) complex; COMPASS methylates histone H3K4; Set1p-dependent H3K4 trimethylation recruits Nrd1p, allowing efficient termination of snoRNAs and cryptic unstable transcripts (CUTs) by Nrd1p-Nab3p-Sen1p pathway; modulates histone acetylation levels in promoter proximal regions to ensure efficient Nrd1p-dependent termination; required in transcriptional silencing near telomeres and at silent mating type loci; has a SET domain [Source:SGD;Acc:S000001161])

HSP 1 Score: 50.8322 bits (120), Expect = 1.071e-6
Identity = 43/152 (28.29%), Postives = 63/152 (41.45%), Query Frame = 2
Query: 1628 NPRCRIVLFDGCTM---GLEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFG-------DHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEI---CQYPVQCACGKVRC 2044
            N R + V+F    +   GL A   + +  ++   +G  +          P AE +   +L +G G       D   V+D T  G IAR++   CDPN   +   VGG   IVI    +I    ELT  +D  FE     +  + C CG   C
Sbjct:  934 NKRKKPVMFARSAIHNWGLYALDSIAAKEMIIEYVGERI--------RQPVAEMREKRYLKNGIGSSYLFRVDENTVIDATKKGGIARFINHCCDPNCTAKIIKVGGRRRIVIYALRDIAASEELT--YDYKFEREKDDEERLPCLCGAPNC 1075          
BLAST of mll5-2 vs. Ensembl Nematostella
Match: EDO45423 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT90])

HSP 1 Score: 71.2478 bits (173), Expect = 1.154e-14
Identity = 36/107 (33.64%), Postives = 52/107 (48.60%), Query Frame = 2
Query: 1724 GRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGKVRC 2044
            GRMML   + K       Y P V  Y       L VD   +GN AR++RRSC PN ++ H    G L + + +   + +G E+TIPF+      +  + CAC +  C
Sbjct:   18 GRMMLGSNFEKENQFFKRYSPHVLFYDKLDHLCLCVDARTFGNDARFVRRSCSPNAEVRHFFSNGKLCLALFSLCPLPKGAEITIPFEHSLHEYKSHLTCACSQDTC 124          
BLAST of mll5-2 vs. Ensembl Nematostella
Match: EDO30858 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZK6])

HSP 1 Score: 50.447 bits (119), Expect = 1.910e-6
Identity = 28/77 (36.36%), Postives = 38/77 (49.35%), Query Frame = 2
Query: 1814 DHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGKVRC 2044
            D   VVD T  GN AR++  SC+PN       + G+  I+I  +  I +G ELT  +  P E  + P  C C   RC
Sbjct:  235 DGTYVVDATTSGNAARFINHSCEPNCYSRVVTIDGNKKILIFASKSISRGEELTYDYKFPLEDEKLP--CHCKSKRC 309          
BLAST of mll5-2 vs. Ensembl Nematostella
Match: EDO30857 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZK5])

HSP 1 Score: 50.447 bits (119), Expect = 1.995e-6
Identity = 28/77 (36.36%), Postives = 38/77 (49.35%), Query Frame = 2
Query: 1814 DHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGKVRC 2044
            D   VVD T  GN AR++  SC+PN       + G+  I+I  +  I +G ELT  +  P E  + P  C C   RC
Sbjct:  209 DGTYVVDATTSGNAARFINHSCEPNCYSRVVTIDGNKKILIFASKSISRGEELTYDYKFPLEDEKLP--CHCKSKRC 283          
BLAST of mll5-2 vs. Ensembl Nematostella
Match: EDO31259 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYF5])

HSP 1 Score: 50.447 bits (119), Expect = 2.287e-6
Identity = 28/77 (36.36%), Postives = 38/77 (49.35%), Query Frame = 2
Query: 1814 DHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGKVRC 2044
            D   VVD T  GN AR++  SC+PN       + G+  I+I  +  I +G ELT  +  P E  + P  C C   RC
Sbjct:  232 DGTYVVDATTSGNAARFINHSCEPNCYSRVVTIDGNKKILIFASKSISRGEELTYDYKFPLEDEKLP--CHCKSKRC 306          
BLAST of mll5-2 vs. Ensembl Medaka
Match: kmt2e (lysine methyltransferase 2E [Source:NCBI gene;Acc:101162568])

HSP 1 Score: 87.8113 bits (216), Expect = 1.554e-17
Identity = 45/127 (35.43%), Postives = 65/127 (51.18%), Query Frame = 2
Query: 1673 LEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCAC--GKVRCP 2047
            L+A   L   S++    G+ ML +++           PFV  Y  F    + VD   +GN AR++RRSC PN ++ H I  G L++ I +   I +G E+TI FD  +  C+Y V CAC  G   CP
Sbjct:  270 LKAVRDLAPDSLIIEYRGKFMLRQQFEANGYFFKRPYPFVLFYSKFDGLEMCVDARSFGNEARFIRRSCSPNAEVRHVIEDGMLHLYIYSLRHITKGTEITIGFDFDYGNCKYKVDCACVKGNQECP 396          
BLAST of mll5-2 vs. Ensembl Medaka
Match: setd5 (SET domain containing 5 [Source:NCBI gene;Acc:101159908])

HSP 1 Score: 87.0409 bits (214), Expect = 7.721e-17
Identity = 43/127 (33.86%), Postives = 66/127 (51.97%), Query Frame = 2
Query: 1673 LEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCAC--GKVRCP 2047
            L A+  L   +++    G++ML +++        +  PFV  Y  F +  + VD   +GN AR++RRSC PN ++ H I  G +++ I   + I +  E+TI FD  F  C Y V CAC  G   CP
Sbjct:  346 LRAAKNLDPDTLIIEYRGKVMLKQQFEVNGHFFKKPYPFVLFYSKFNEVEMCVDARTFGNDARFIRRSCTPNAEVRHMISDGMIHLCIYAISHISKDSEVTIGFDYEFNSCDYKVDCACHKGNQNCP 472          
BLAST of mll5-2 vs. Ensembl Medaka
Match: setd5 (SET domain containing 5 [Source:NCBI gene;Acc:101159908])

HSP 1 Score: 87.0409 bits (214), Expect = 7.743e-17
Identity = 43/127 (33.86%), Postives = 66/127 (51.97%), Query Frame = 2
Query: 1673 LEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCAC--GKVRCP 2047
            L A+  L   +++    G++ML +++        +  PFV  Y  F +  + VD   +GN AR++RRSC PN ++ H I  G +++ I   + I +  E+TI FD  F  C Y V CAC  G   CP
Sbjct:  346 LRAAKNLDPDTLIIEYRGKVMLKQQFEVNGHFFKKPYPFVLFYSKFNEVEMCVDARTFGNDARFIRRSCTPNAEVRHMISDGMIHLCIYAISHISKDSEVTIGFDYEFNSCDYKVDCACHKGNQNCP 472          
BLAST of mll5-2 vs. Ensembl Medaka
Match: KMT2A (lysine methyltransferase 2A [Source:NCBI gene;Acc:101171020])

HSP 1 Score: 62.7734 bits (151), Expect = 2.196e-9
Identity = 30/73 (41.10%), Postives = 39/73 (53.42%), Query Frame = 2
Query: 1826 VVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGKVRC 2044
            VVD TV+GN AR++  SC+PN       V G  +IVI  +  IC G ELT  +  P E     + C CG  +C
Sbjct: 4462 VVDATVHGNAARFINHSCEPNCYSRVLTVDGQKHIVIFASRRICCGEELTYDYKFPIEDASNKLPCNCGTKKC 4534          
BLAST of mll5-2 vs. Ensembl Medaka
Match: KMT2A (lysine methyltransferase 2A [Source:NCBI gene;Acc:101171020])

HSP 1 Score: 62.7734 bits (151), Expect = 2.675e-9
Identity = 30/73 (41.10%), Postives = 39/73 (53.42%), Query Frame = 2
Query: 1826 VVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGKVRC 2044
            VVD TV+GN AR++  SC+PN       V G  +IVI  +  IC G ELT  +  P E     + C CG  +C
Sbjct: 4089 VVDATVHGNAARFINHSCEPNCYSRVLTVDGQKHIVIFASRRICCGEELTYDYKFPIEDASNKLPCNCGTKKC 4161          
BLAST of mll5-2 vs. Planmine SMEST
Match: SMESG000017190.1 (SMESG000017190.1)

HSP 1 Score: 1563.9 bits (4048), Expect = 0.000e+0
Identity = 879/888 (98.99%), Postives = 883/888 (99.44%), Query Frame = 2
Query:   32 MELVGQMYKLSACFDTPNEYKGLPYDYFPDDAVSYGSTICSFGLPYNDHNYGMPTGLTPPVMAPHLMDPVSKPKKLINDLFSKAKSEPTSELDTSGQPVSNTQFSTDSPDPSLNCTPRKQYLDENDXXXXXXXXXXXXXXXXXLCVXXXXXXXXXXXXXXXTKVNPEFLMYLRSLASRHESVERYLSRARRQYEHYAHSQKSSGSEKRDCSMTSDTVIDCICENNYDDKRMVQCEACGIKQHLDCMYVNPRQVQNFLKHRCQKCSDIKVDIPRAKAIQNSRKNWHLNNQLNDKIPQRCKIKSEDRKNKDFLMKIKESKNECSSNENAMFNLKNNNSNITRVNKRKQDLKVYGEPDVAAVSVPCSMKALVXXXXXXXXXXXXXXXXXXXXSERVPGVFPGDGRGPSVINNPLCDGTSESDADMKLAAEDAVNGGGGCXXXXXXXXXXXXMAGRPAAEGADCSPAVEEYTERLAIINRRNPPFKKDYKEATKSLYTGALLAXXXXXXXXXXXXQTLLANANVEGLEQGTEFLDRNPRCRIVLFDGCTMGLEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGKVRCPAXXXXXXXXXXXXXTSNINCEQVIEDKLRELSQPLLSSTSAYAGNVSGLKKPIIANRFGIQSRQIMESFTDVAECKPNLSSFHNDSKSLTDHNSILTEDRIKIEEREPSIELDEXXXXXXXXXXXXXXXXXDLCGDAILTTKRRPKPVQHPDFEVDINSRISDRSRVRSTHNTPIKTKTEPILKRTSSNTDNVNIKSPSKSLNTKETIINRLYEAI 2695
            MELVGQMYKLSACFDTPNEYKGLPYDYFPDDAVSYGSTICSFGLPYNDHNYGMPTGLTPPVMAPHLMDPVSKPKKLINDLFSKAKSEPTSELDTSGQPVSNTQFSTDSPDPSLNCTPRKQYLDENDYPVYVEPEIKVVEVPEKLCVSASEYSDCSSESSDDTKVNPEFLMYLRSLASRHESVERYLSRARRQYEHYAHSQKSSGSEKRDCSMTSDTVIDCICENNYDDKRMVQCEACGIKQHLDCMYVNPRQVQNFLKHRCQKCSDIKVDIPRAKAIQNSRKNWHLNNQLNDKIPQRCKIKSEDRKNKDFLMKIKESKNECSSNENAMFNLKNNNSNITRVNKRKQDLKVYGEPDVAAVSVPCSMKALVEEDGDEDEDVGMTEGEGDGESERVPGVFPGDGRGPSVINNPLCDGTSESDADMKLAAEDAVNGGGGCQELPPPQLPDEPMAGRPAAEGADCSPAVEEYTERLAIINRRNPPFKKDYKEATKSLYTGALLAKIEEMKESEEEKQTLLANANVEGLEQGTEFLDRNPRCRIVLFDGCTMGLEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGKVRCPAIKHRRKHHRNRIITSNINCEQVIEDKLRELSQPLLSSTSAYAGNVSGLKKPIIANRFGIQSRQIMESFTDVAECKPNLSSFHNDSKSLTDHNSILTEDRIKIEEREPSIELDEQQQQQKSPPPSNKQISSDLCGDAILTTKRRPKPVQHPDFEVDINSRISDRSRVRSTHNTPIKTKTEPILKRTSSNTDNVNIKSPSKSLNTKE   +  +++I
Sbjct:    1 MELVGQMYKLSACFDTPNEYKGLPYDYFPDDAVSYGSTICSFGLPYNDHNYGMPTGLTPPVMAPHLMDPVSKPKKLINDLFSKAKSEPTSELDTSGQPVSNTQFSTDSPDPSLNCTPRKQYLDENDYPVYVEPEIKVVEVPEKLCVSASEYSDCSSESSDDTKVNPEFLMYLRSLASRHESVERYLSRARRQYEHYAHSQKSSGSEKRDCSMTSDTVIDCICENNYDDKRMVQCEACGIKQHLDCMYVNPRQVQNFLKHRCQKCSDIKVDIPRAKAIQNSRKNWHLNNQLNDKIPQRCKIKSEDRKNKDFLMKIKESKNECSSNENAMFNLKNNNSNITRVNKRKQDLKVYGEPDVAAVSVPCSMKALVEEDGDEDEDVGMTEGEGDGESERVPGVFPGDGRGPSVINNPLCDGTSESDADMKLAAEDAVNGGGGCQELPPPQLPDEPMAGRPAAEGADCSPAVEEYTERLAIINRRNPPFKKDYKEATKSLYTGALLAKIEEMKESEEEKQTLLANANVEGLEQGTEFLDRNPRCRIVLFDGCTMGLEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGKVRCPAIKHRRKHHRNRIITSNINCEQVIEDKLRELSQPLLSSTSAYAGNVSGLKKPIIANRFGIQSRQIMESFTDVAECKPNLSSFHNDSKSLTDHNSILTEDRIKIEEREPSIELDEQQQQQKSPPPSNKQISSDLCGDAILTTKRRPKPVQHPDFEVDINSRISDRSRVRSTHNTPIKTKTEPILKRTSSNTDNVNIKSPSKSLNTKEGSSSATFKSI 888          

HSP 2 Score: 99.3673 bits (246), Expect = 8.865e-21
Identity = 50/51 (98.04%), Postives = 51/51 (100.00%), Query Frame = 2
Query: 2960 QGSSSATFKSIITTRQQKRNKSPPTNKRSRNAKTEPLEEEIATKRSNRAKK 3112
            +GSSSATFKSIITTRQQKRNKSPPTNKRSRNAKTEPLEEEIATKRSNRAKK
Sbjct:  878 EGSSSATFKSIITTRQQKRNKSPPTNKRSRNAKTEPLEEEIATKRSNRAKK 928          
BLAST of mll5-2 vs. Planmine SMEST
Match: SMESG000017190.1 (SMESG000017190.1)

HSP 1 Score: 1551.95 bits (4017), Expect = 0.000e+0
Identity = 873/882 (98.98%), Postives = 877/882 (99.43%), Query Frame = 2
Query:   50 MYKLSACFDTPNEYKGLPYDYFPDDAVSYGSTICSFGLPYNDHNYGMPTGLTPPVMAPHLMDPVSKPKKLINDLFSKAKSEPTSELDTSGQPVSNTQFSTDSPDPSLNCTPRKQYLDENDXXXXXXXXXXXXXXXXXLCVXXXXXXXXXXXXXXXTKVNPEFLMYLRSLASRHESVERYLSRARRQYEHYAHSQKSSGSEKRDCSMTSDTVIDCICENNYDDKRMVQCEACGIKQHLDCMYVNPRQVQNFLKHRCQKCSDIKVDIPRAKAIQNSRKNWHLNNQLNDKIPQRCKIKSEDRKNKDFLMKIKESKNECSSNENAMFNLKNNNSNITRVNKRKQDLKVYGEPDVAAVSVPCSMKALVXXXXXXXXXXXXXXXXXXXXSERVPGVFPGDGRGPSVINNPLCDGTSESDADMKLAAEDAVNGGGGCXXXXXXXXXXXXMAGRPAAEGADCSPAVEEYTERLAIINRRNPPFKKDYKEATKSLYTGALLAXXXXXXXXXXXXQTLLANANVEGLEQGTEFLDRNPRCRIVLFDGCTMGLEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGKVRCPAXXXXXXXXXXXXXTSNINCEQVIEDKLRELSQPLLSSTSAYAGNVSGLKKPIIANRFGIQSRQIMESFTDVAECKPNLSSFHNDSKSLTDHNSILTEDRIKIEEREPSIELDEXXXXXXXXXXXXXXXXXDLCGDAILTTKRRPKPVQHPDFEVDINSRISDRSRVRSTHNTPIKTKTEPILKRTSSNTDNVNIKSPSKSLNTKETIINRLYEAI 2695
            MYKLSACFDTPNEYKGLPYDYFPDDAVSYGSTICSFGLPYNDHNYGMPTGLTPPVMAPHLMDPVSKPKKLINDLFSKAKSEPTSELDTSGQPVSNTQFSTDSPDPSLNCTPRKQYLDENDYPVYVEPEIKVVEVPEKLCVSASEYSDCSSESSDDTKVNPEFLMYLRSLASRHESVERYLSRARRQYEHYAHSQKSSGSEKRDCSMTSDTVIDCICENNYDDKRMVQCEACGIKQHLDCMYVNPRQVQNFLKHRCQKCSDIKVDIPRAKAIQNSRKNWHLNNQLNDKIPQRCKIKSEDRKNKDFLMKIKESKNECSSNENAMFNLKNNNSNITRVNKRKQDLKVYGEPDVAAVSVPCSMKALVEEDGDEDEDVGMTEGEGDGESERVPGVFPGDGRGPSVINNPLCDGTSESDADMKLAAEDAVNGGGGCQELPPPQLPDEPMAGRPAAEGADCSPAVEEYTERLAIINRRNPPFKKDYKEATKSLYTGALLAKIEEMKESEEEKQTLLANANVEGLEQGTEFLDRNPRCRIVLFDGCTMGLEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGKVRCPAIKHRRKHHRNRIITSNINCEQVIEDKLRELSQPLLSSTSAYAGNVSGLKKPIIANRFGIQSRQIMESFTDVAECKPNLSSFHNDSKSLTDHNSILTEDRIKIEEREPSIELDEQQQQQKSPPPSNKQISSDLCGDAILTTKRRPKPVQHPDFEVDINSRISDRSRVRSTHNTPIKTKTEPILKRTSSNTDNVNIKSPSKSLNTKE   +  +++I
Sbjct:    1 MYKLSACFDTPNEYKGLPYDYFPDDAVSYGSTICSFGLPYNDHNYGMPTGLTPPVMAPHLMDPVSKPKKLINDLFSKAKSEPTSELDTSGQPVSNTQFSTDSPDPSLNCTPRKQYLDENDYPVYVEPEIKVVEVPEKLCVSASEYSDCSSESSDDTKVNPEFLMYLRSLASRHESVERYLSRARRQYEHYAHSQKSSGSEKRDCSMTSDTVIDCICENNYDDKRMVQCEACGIKQHLDCMYVNPRQVQNFLKHRCQKCSDIKVDIPRAKAIQNSRKNWHLNNQLNDKIPQRCKIKSEDRKNKDFLMKIKESKNECSSNENAMFNLKNNNSNITRVNKRKQDLKVYGEPDVAAVSVPCSMKALVEEDGDEDEDVGMTEGEGDGESERVPGVFPGDGRGPSVINNPLCDGTSESDADMKLAAEDAVNGGGGCQELPPPQLPDEPMAGRPAAEGADCSPAVEEYTERLAIINRRNPPFKKDYKEATKSLYTGALLAKIEEMKESEEEKQTLLANANVEGLEQGTEFLDRNPRCRIVLFDGCTMGLEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGKVRCPAIKHRRKHHRNRIITSNINCEQVIEDKLRELSQPLLSSTSAYAGNVSGLKKPIIANRFGIQSRQIMESFTDVAECKPNLSSFHNDSKSLTDHNSILTEDRIKIEEREPSIELDEQQQQQKSPPPSNKQISSDLCGDAILTTKRRPKPVQHPDFEVDINSRISDRSRVRSTHNTPIKTKTEPILKRTSSNTDNVNIKSPSKSLNTKEGSSSATFKSI 882          

HSP 2 Score: 99.3673 bits (246), Expect = 8.520e-21
Identity = 50/51 (98.04%), Postives = 51/51 (100.00%), Query Frame = 2
Query: 2960 QGSSSATFKSIITTRQQKRNKSPPTNKRSRNAKTEPLEEEIATKRSNRAKK 3112
            +GSSSATFKSIITTRQQKRNKSPPTNKRSRNAKTEPLEEEIATKRSNRAKK
Sbjct:  872 EGSSSATFKSIITTRQQKRNKSPPTNKRSRNAKTEPLEEEIATKRSNRAKK 922          
BLAST of mll5-2 vs. Planmine SMEST
Match: SMESG000051295.1 (SMESG000051295.1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.153e-17
Identity = 41/143 (28.67%), Postives = 69/143 (48.25%), Query Frame = 2
Query: 1619 LDRNPRCRIVLFDGCTMGLEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIV-GGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGKVRC 2044
            ++ N  C+++ ++     +++   L    ++    G + L E+Y K       Y PFV  Y  F    L +D       ++Y+RRSC PN +++H ++  GS+   I     I    E+TI FD  ++ C Y V+CACG   C
Sbjct:  540 VNSNCSCKVIKYNNNQTVIKSIKELHCSEVIMEFNGFISLSEDYNKEFDYRKHYNPFVLFYEKFDHLSLAIDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFITPINWISNDTEITIGFDFNYKKCSYSVECACGHPNC 682          
BLAST of mll5-2 vs. Planmine SMEST
Match: SMESG000051295.1 (SMESG000051295.1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.173e-17
Identity = 41/143 (28.67%), Postives = 69/143 (48.25%), Query Frame = 2
Query: 1619 LDRNPRCRIVLFDGCTMGLEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIV-GGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGKVRC 2044
            ++ N  C+++ ++     +++   L    ++    G + L E+Y K       Y PFV  Y  F    L +D       ++Y+RRSC PN +++H ++  GS+   I     I    E+TI FD  ++ C Y V+CACG   C
Sbjct:  543 VNSNCSCKVIKYNNNQTVIKSIKELHCSEVIMEFNGFISLSEDYNKEFDYRKHYNPFVLFYEKFDHLSLAIDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFITPINWISNDTEITIGFDFNYKKCSYSVECACGHPNC 685          
BLAST of mll5-2 vs. Planmine SMEST
Match: SMESG000062296.1 (SMESG000062296.1)

HSP 1 Score: 56.9954 bits (136), Expect = 8.697e-8
Identity = 34/98 (34.69%), Postives = 47/98 (47.96%), Query Frame = 2
Query: 1772 AEYKPFVFLYHGFG-------DHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGKVRC 2044
            AEY+   +   G G       D  LV+D T+YG+ AR++  SC PN       V G   IVI +  +I    E+T  +  P+E  + P  C CG V C
Sbjct: 1313 AEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIP--CLCGSVGC 1408          
The following BLAST results are available for this feature:
BLAST of mll5-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KMT2E1.864e-1733.86lysine methyltransferase 2E [Source:HGNC Symbol;Ac... [more]
KMT2E1.228e-1633.88lysine methyltransferase 2E [Source:HGNC Symbol;Ac... [more]
KMT2E1.238e-1633.59lysine methyltransferase 2E [Source:HGNC Symbol;Ac... [more]
KMT2E2.138e-1634.75lysine methyltransferase 2E [Source:HGNC Symbol;Ac... [more]
KMT2E2.728e-1633.86lysine methyltransferase 2E [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of mll5-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
set-243.992e-832.61SET (Trithorax/polycomb) domain containing [Sourc... [more]
set-97.528e-730.77Histone-lysine N-methyltransferase set-9 [Source:... [more]
set-267.868e-730.77Histone-lysine N-methyltransferase set-26 [Source... [more]
back to top
BLAST of mll5-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trx5.951e-940.26gene:FBgn0003862 transcript:FBtr0082947[more]
trx5.951e-940.26gene:FBgn0003862 transcript:FBtr0082950[more]
trx6.056e-940.26gene:FBgn0003862 transcript:FBtr0082948[more]
trx6.056e-940.26gene:FBgn0003862 transcript:FBtr0082949[more]
trx6.056e-940.26gene:FBgn0003862 transcript:FBtr0100277[more]
back to top
BLAST of mll5-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
setd55.389e-1733.86SET domain containing 5 [Source:ZFIN;Acc:ZDB-GENE-... [more]
setd56.476e-1733.86SET domain containing 5 [Source:ZFIN;Acc:ZDB-GENE-... [more]
kmt2e6.687e-1735.43lysine (K)-specific methyltransferase 2E [Source:Z... [more]
setd22.117e-928.15SET domain containing 2, histone lysine methyltran... [more]
setd22.219e-928.15SET domain containing 2, histone lysine methyltran... [more]
back to top
BLAST of mll5-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KMT2E1.041e-1733.88lysine (K)-specific methyltransferase 2E [Source:N... [more]
KMT2E1.946e-1733.88lysine (K)-specific methyltransferase 2E [Source:N... [more]
KMT2E2.269e-1733.88lysine (K)-specific methyltransferase 2E [Source:N... [more]
KMT2E6.773e-1733.88lysine (K)-specific methyltransferase 2E [Source:N... [more]
KMT2E6.809e-1733.88lysine (K)-specific methyltransferase 2E [Source:N... [more]
back to top
BLAST of mll5-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kmt2e2.609e-1633.86lysine (K)-specific methyltransferase 2E [Source:M... [more]
Kmt2e2.609e-1633.86lysine (K)-specific methyltransferase 2E [Source:M... [more]
Setd54.313e-1633.07SET domain containing 5 [Source:MGI Symbol;Acc:MGI... [more]
Setd54.443e-1633.07SET domain containing 5 [Source:MGI Symbol;Acc:MGI... [more]
Setd54.443e-1633.07SET domain containing 5 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of mll5-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8IZD2|KMT2E_HUMAN1.310e-1533.86Inactive histone-lysine N-methyltransferase 2E OS=... [more]
sp|Q3UG20|KMT2E_MOUSE1.764e-1533.86Inactive histone-lysine N-methyltransferase 2E OS=... [more]
sp|Q9C0A6|SETD5_HUMAN2.657e-1533.07Histone-lysine N-methyltransferase SETD5 OS=Homo s... [more]
sp|Q5XJV7|SETD5_MOUSE3.017e-1533.07Histone-lysine N-methyltransferase SETD5 OS=Mus mu... [more]
sp|Q24742|TRX_DROVI1.390e-841.56Histone-lysine N-methyltransferase trithorax OS=Dr... [more]
back to top
BLAST of mll5-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
L0HB500.000e+0100.00Mll5-2 (Fragment) OS=Schmidtea mediterranea OX=793... [more]
A0A0X3NN925.406e-4845.49SET domain-containing protein OS=Schistocephalus s... [more]
A0A183T6J34.011e-4745.49SET domain-containing protein OS=Schistocephalus s... [more]
A0A504YQ627.124e-4743.42Histone-lysine N-methyltransferase 2E OS=Fasciola ... [more]
A0A0X3P3N51.984e-4645.49Histone-lysine N-methyltransferase 2E OS=Schistoce... [more]
back to top
BLAST of mll5-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
setd52.135e-1734.65SET domain containing 5 [Source:NCBI gene;Acc:1030... [more]
setd52.379e-1734.65SET domain containing 5 [Source:NCBI gene;Acc:1030... [more]
kmt2e3.903e-1735.16lysine (K)-specific methyltransferase 2E [Source:Z... [more]
setd25.671e-926.67SET domain containing 2, histone lysine methyltran... [more]
setd26.182e-926.67SET domain containing 2, histone lysine methyltran... [more]
back to top
BLAST of mll5-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
kmt2e1.198e-1733.08lysine (K)-specific methyltransferase 2E [Source:Z... [more]
ENSPMAT00000010827.11.071e-728.35pep scaffold:Pmarinus_7.0:GL487806:1944:5585:-1 ge... [more]
ENSPMAT00000002322.11.954e-728.57pep scaffold:Pmarinus_7.0:GL477101:2485:64197:1 ge... [more]
setd1a4.129e-633.77SET domain containing 1A, histone lysine methyltra... [more]
back to top
BLAST of mll5-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SET11.071e-628.29Histone methyltransferase, subunit of the COMPASS ... [more]
back to top
BLAST of mll5-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO454231.154e-1433.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO308581.910e-636.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO308571.995e-636.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO312592.287e-636.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of mll5-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kmt2e1.554e-1735.43lysine methyltransferase 2E [Source:NCBI gene;Acc:... [more]
setd57.721e-1733.86SET domain containing 5 [Source:NCBI gene;Acc:1011... [more]
setd57.743e-1733.86SET domain containing 5 [Source:NCBI gene;Acc:1011... [more]
KMT2A2.196e-941.10lysine methyltransferase 2A [Source:NCBI gene;Acc:... [more]
KMT2A2.675e-941.10lysine methyltransferase 2A [Source:NCBI gene;Acc:... [more]
back to top
BLAST of mll5-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017190.18.865e-2198.99SMESG000017190.1[more]
SMESG000017190.18.520e-2198.98SMESG000017190.1[more]
SMESG000051295.11.153e-1728.67SMESG000051295.1[more]
SMESG000051295.11.173e-1728.67SMESG000051295.1[more]
SMESG000062296.18.697e-834.69SMESG000062296.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30011145
GenBankAGA95408.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011145 ID=SMED30011145|Name=mll5-2|organism=Schmidtea mediterranea sexual|type=transcript|length=3231bp
ATCTATATAAATCTTATATGATTACGACATAATGGAGTTGGTTGGACAAA
TGTATAAGTTATCAGCGTGCTTTGATACTCCCAATGAGTATAAAGGCTTG
CCTTATGATTATTTTCCAGATGACGCTGTTTCTTATGGATCGACAATATG
CTCATTTGGTTTACCATATAATGATCACAATTACGGAATGCCAACTGGGT
TAACTCCACCAGTAATGGCTCCTCATCTCATGGATCCGGTTTCCAAACCG
AAGAAACTAATCAATGATTTATTTTCCAAAGCGAAATCAGAACCGACTTC
TGAATTAGACACTTCGGGTCAGCCGGTTTCGAATACTCAATTTTCTACAG
ATTCTCCTGATCCCTCGCTGAATTGCACCCCTAGAAAGCAGTATTTGGAT
GAGAATGATTACCCGGTTTATGTCGAGCCGGAAATCAAAGTGGTGGAGGT
GCCTGAAAAATTATGCGTTTCAGCATCGGAATATAGCGATTGCAGCAGCG
AATCATCGGACGATACCAAGGTCAATCCGGAGTTCCTGATGTACCTGCGA
TCATTGGCTAGTCGACACGAGTCAGTCGAGCGCTACCTGAGCCGGGCGCG
GCGCCAATACGAGCATTATGCCCACTCACAGAAATCATCTGGTTCAGAGA
AACGCGACTGCAGCATGACAAGCGACACAGTGATTGATTGTATTTGTGAA
AATAACTATGATGACAAGCGGATGGTGCAGTGCGAGGCTTGCGGCATCAA
GCAACACCTCGACTGCATGTACGTCAATCCAAGGCAAGTGCAAAACTTCC
TCAAGCACCGCTGCCAGAAATGCAGCGACATCAAAGTCGACATTCCTCGA
GCTAAAGCCATTCAAAATTCCAGAAAAAATTGGCATCTAAACAATCAACT
GAATGATAAAATTCCTCAAAGGTGCAAAATTAAAAGTGAAGATAGGAAAA
ATAAAGATTTCCTAATGAAAATCAAAGAATCGAAGAACGAGTGCTCATCC
AATGAAAATGCCATGTTTAATTTAAAAAACAATAACTCTAACATAACCCG
TGTCAATAAAAGGAAACAAGATCTGAAAGTTTATGGAGAGCCGGATGTAG
CAGCAGTGAGTGTCCCATGTTCCATGAAGGCATTAGTAGAGGAGGATGGG
GATGAGGATGAGGATGTAGGAATGACGGAGGGTGAGGGGGATGGCGAGAG
CGAGAGAGTGCCAGGGGTTTTCCCGGGCGACGGGAGAGGACCATCAGTAA
TCAATAATCCGTTGTGTGACGGCACGAGTGAGTCTGATGCTGATATGAAG
CTGGCGGCAGAAGATGCAGTGAATGGCGGCGGCGGCTGCCAGGAATTGCC
GCCACCGCAGCTGCCAGATGAGCCAATGGCAGGCAGGCCGGCTGCAGAAG
GGGCCGACTGCTCCCCTGCGGTAGAGGAATACACCGAGCGGCTGGCCATC
ATTAACAGAAGGAATCCGCCATTCAAAAAGGATTACAAAGAGGCCACCAA
AAGCCTTTATACTGGCGCGTTGCTAGCTAAGATTGAGGAAATGAAGGAAA
GCGAGGAAGAGAAGCAGACGTTATTGGCAAATGCTAATGTGGAAGGCCTG
GAGCAAGGGACTGAATTCCTTGATAGGAATCCTCGCTGCCGGATTGTGCT
GTTTGACGGGTGCACAATGGGCCTGGAGGCGTCAGTGAGGCTGCAGAGCT
GCAGCATTGTCGCTGCAATGATTGGTCGCATGATGCTGATGGAGGAATAC
CTTAAATATGCCAGTCCAGCTGCCGAATACAAGCCGTTTGTGTTCCTTTA
TCACGGATTTGGTGATCACGGGTTGGTTGTGGACACAACTGTCTATGGTA
ATATTGCCCGATATCTCCGGCGGTCCTGTGATCCCAATGTCAAGCTGGAG
CATACAATTGTCGGCGGATCACTGTATATCGTCATCCGGACCACCACTGA
GATTTGCCAAGGAGTCGAATTGACTATTCCGTTCGATCTGCCCTTTGAAA
TCTGCCAATACCCAGTACAATGTGCTTGCGGCAAGGTGAGATGTCCTGCG
ATTAAACACCGAAGGAAGCACCACCGAAACCGTATAATCACATCCAATAT
CAACTGTGAACAGGTCATTGAAGACAAATTGCGCGAGTTATCCCAGCCTC
TCCTGAGTTCAACCAGCGCTTATGCGGGAAATGTTTCCGGTCTGAAGAAA
CCGATTATCGCTAACAGATTCGGAATTCAGTCTCGACAAATCATGGAATC
ATTCACCGATGTGGCGGAATGCAAACCAAATTTATCGTCTTTCCATAACG
ATTCAAAATCTCTGACTGATCATAACTCTATCCTGACTGAAGATCGGATC
AAAATAGAAGAAAGAGAGCCGTCGATAGAACTCGATGAGCAGCAGCAGCA
GCAGAAATCACCTCCTCCTTCCAATAAACAGATATCATCAGATTTGTGTG
GTGATGCTATATTGACCACTAAACGGCGCCCGAAACCCGTCCAACATCCC
GATTTTGAGGTCGATATCAATTCCCGGATCTCAGATAGATCACGAGTGAG
ATCGACTCATAATACACCAATCAAAACTAAAACTGAGCCCATCTTAAAGC
GAACTTCATCAAACACAGATAATGTAAATATCAAATCTCCCTCGAAATCG
CTGAACACTAAAGAGACAATCATTAATCGGCTCTATGAGGCAATACAGCA
GGTGAAAGAGTTGATTCACATCCTGAACGACTCGCCACAGGATGGTGACA
TGAGATATTGCCAATGCTGCTGCTCTATATGGAGCAATGAGGAGCAGGAG
CGCTTGTGCTGGTTAATATCGATGTGTTTTATTATTATTATCGTTCGTTT
ATTGATTTCTGTTCGGTTTCGATGTCATATGATTGGAGGAAATGTTTCTC
ACTCACACACACGCACACACACATCGAGAGCAGCTGATTGATTGATTGCA
TATAATTTCCAGGGCTCCAGCAGTGCAACGTTCAAATCGATTATCACCAC
GCGTCAGCAGAAGCGCAACAAATCACCGCCTACAAACAAAAGGAGCCGCA
ACGCAAAAACGGAACCGCTGGAAGAGGAAATTGCAACAAAAAGATCGAAT
CGGGCTAAAAAGTAGCGCGTGGAAATAATATAAATCACTTTTACTCTGAA
TATTTTGCCTTAATCGGTTTTTGTAATATTTTGTAATTTTTTTCCATTTT
ATCGATTGTACAATTTCACAATGCTATAATC
back to top

protein sequence of SMED30011145-orf-1

>SMED30011145-orf-1 ID=SMED30011145-orf-1|Name=SMED30011145-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=970bp
MELVGQMYKLSACFDTPNEYKGLPYDYFPDDAVSYGSTICSFGLPYNDHN
YGMPTGLTPPVMAPHLMDPVSKPKKLINDLFSKAKSEPTSELDTSGQPVS
NTQFSTDSPDPSLNCTPRKQYLDENDYPVYVEPEIKVVEVPEKLCVSASE
YSDCSSESSDDTKVNPEFLMYLRSLASRHESVERYLSRARRQYEHYAHSQ
KSSGSEKRDCSMTSDTVIDCICENNYDDKRMVQCEACGIKQHLDCMYVNP
RQVQNFLKHRCQKCSDIKVDIPRAKAIQNSRKNWHLNNQLNDKIPQRCKI
KSEDRKNKDFLMKIKESKNECSSNENAMFNLKNNNSNITRVNKRKQDLKV
YGEPDVAAVSVPCSMKALVEEDGDEDEDVGMTEGEGDGESERVPGVFPGD
GRGPSVINNPLCDGTSESDADMKLAAEDAVNGGGGCQELPPPQLPDEPMA
GRPAAEGADCSPAVEEYTERLAIINRRNPPFKKDYKEATKSLYTGALLAK
IEEMKESEEEKQTLLANANVEGLEQGTEFLDRNPRCRIVLFDGCTMGLEA
SVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVV
DTTVYGNIARYLRRSCDPNVKLEHTIVGGSLYIVIRTTTEICQGVELTIP
FDLPFEICQYPVQCACGKVRCPAIKHRRKHHRNRIITSNINCEQVIEDKL
RELSQPLLSSTSAYAGNVSGLKKPIIANRFGIQSRQIMESFTDVAECKPN
LSSFHNDSKSLTDHNSILTEDRIKIEEREPSIELDEQQQQQKSPPPSNKQ
ISSDLCGDAILTTKRRPKPVQHPDFEVDINSRISDRSRVRSTHNTPIKTK
TEPILKRTSSNTDNVNIKSPSKSLNTKETIINRLYEAIQQVKELIHILND
SPQDGDMRYCQCCCSIWSNEEQERLCWLISMCFIIIIVRLLISVRFRCHM
IGGNVSHSHTRTHTSRAAD*
back to top
Aliases
The feature 'mll5-2' has the following synonyms
Synonym
mll5-2
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000429neoblast
PLANA:0002063non-ciliated epidermis
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR001214SET_dom
IPR013083Znf_RING/FYVE/PHD
IPR011011Znf_FYVE_PHD
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008168methyltransferase activity
GO:0016740transferase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0032259methylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 501..525
NoneNo IPR availableGENE3DG3DSA:2.170.270.10coord: 534..686
e-value: 3.4E-19
score: 71.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 375..394
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 790..807
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 90..115
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 786..807
NoneNo IPR availablePANTHERPTHR46462FAMILY NOT NAMEDcoord: 46..857
NoneNo IPR availableSUPERFAMILYSSF82199SET domaincoord: 536..675
NoneNo IPR availableTMHMMTMhelixcoord: 929..946
IPR001214SET domainSMARTSM00317set_7coord: 538..662
e-value: 1.4E-9
score: 47.9
IPR001214SET domainPFAMPF00856SETcoord: 487..653
e-value: 4.6E-7
score: 30.4
IPR001214SET domainPROSITEPS50280SETcoord: 538..656
score: 9.029
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 217..286
e-value: 5.2E-12
score: 47.0
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILYSSF57903FYVE/PHD zinc fingercoord: 214..275