Argininosuccinate synthase

Overview
NameArgininosuccinate synthase
Smed IDSMED30011140
Length (bp)1392
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Argininosuccinate synthase (SMED30011140) t-SNE clustered cells

Violin plots show distribution of expression levels for Argininosuccinate synthase (SMED30011140) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Argininosuccinate synthase (SMED30011140) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Argininosuccinate synthase (SMED30011140) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011140

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30011140SMESG000053053.1 SMESG000053052.1 dd_Smed_v4_3086_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30011140SMESG000053053.1 SMESG000053052.1 dd_Smed_v4_3086_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30011140SMESG000053053.1 SMESG000053052.1 Contig30106newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30011140SMESG000053053.1 SMESG000053052.1 Contig30106uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30011140SMESG000053053.1 SMESG000053052.1 OX_Smed_1.0.20372ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
gutSMED30011140SMESG000053053.1 SMESG000053052.1 SMED30011140smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30011140SMESG000053053.1 SMESG000053052.1 SMED30011140smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
Category 3 cellSMED30011140SMESG000053053.1 SMESG000053052.1 dd_Smed_v6_3086_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30011140SMESG000053053.1 SMESG000053052.1 dd_Smed_v4_3086_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30011140SMESG000053053.1 SMED_04768_V2_1rGPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30011140SMESG000053053.1 SMED_04768_V2_1rGPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Argininosuccinate synthase vs. Ensembl Human
Match: ASS1 (argininosuccinate synthase 1 [Source:HGNC Symbol;Acc:HGNC:758])

HSP 1 Score: 571.237 bits (1471), Expect = 0.000e+0
Identity = 275/407 (67.57%), Postives = 334/407 (82.06%), Query Frame = 3
Query:   87 LTGKKKVILAYSGGLDTSCILVWLQEKGYDVIAYLADVGQEEDFEAAKKKALSLGAVKFFCLDLKLAFVEEYIFKAIQANAIYEDRYLLGTSLARPIIAKGMIEIAKQEGCKYLSHGATGKGNDQIRFELACYALYPDIEIISPWKIPEFYNRFKGRQDLFEYAKVHNIPLPITKSEPWSMDSNLMHISYESGILENPSNEA-PDLYQMTKDPVTASPDQPEKLKIHFHKGVPVEVENLTNSKTVKGSLDLYQYLNEIGGLHGIGRIDIVENRVIGMKSRGIYETPAGTILYHAHLDIENLTMDRELRKIKQRLCIDFGEQIYYGMWFSPECDFLRNSIEYSQKCVTGTVTIKLFKGQVYILARQSPHSLYNEELVSMDVQGKYEPTDAAGFIKINALRLQEYHRIR 1304
            ++ K  V+LAYSGGLDTSCILVWL+E+GYDVIAYLA++GQ+EDFE A+KKAL LGA K F  D+   FVEE+I+ AIQ++A+YEDRYLLGTSLARP IA+  +EIA++EG KY+SHGATGKGNDQ+RFEL+CY+L P I++I+PW++PEFYNRFKGR DL EYAK H IP+P+T   PWSMD NLMHISYE+GILENP N+A P LY  T+DP  A P+ P+ L+I F KGVPV+V N+ +  T + SL+L+ YLNE+ G HG+GRIDIVENR IGMKSRGIYETPAGTILYHAHLDIE  TMDRE+RKIKQ L + F E +Y G W SPEC+F+R+ I  SQ+ V G V + + KGQVYIL R+SP SLYNEELVSM+VQG YEPTDA GFI IN+LRL+EYHR++
Sbjct:    1 MSSKGSVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVFIEDVSREFVEEFIWPAIQSSALYEDRYLLGTSLARPCIARKQVEIAQREGAKYVSHGATGKGNDQVRFELSCYSLAPQIKVIAPWRMPEFYNRFKGRNDLMEYAKQHGIPIPVTPKNPWSMDENLMHISYEAGILENPKNQAPPGLYTKTQDPAKA-PNTPDILEIEFKKGVPVKVTNVKDGTTHQTSLELFMYLNEVAGKHGVGRIDIVENRFIGMKSRGIYETPAGTILYHAHLDIEAFTMDREVRKIKQGLGLKFAELVYTGFWHSPECEFVRHCIAKSQERVEGKVQVSVLKGQVYILGRESPLSLYNEELVSMNVQGDYEPTDATGFININSLRLKEYHRLQ 406          
BLAST of Argininosuccinate synthase vs. Ensembl Human
Match: ASS1 (argininosuccinate synthase 1 [Source:HGNC Symbol;Acc:HGNC:758])

HSP 1 Score: 571.237 bits (1471), Expect = 0.000e+0
Identity = 275/407 (67.57%), Postives = 334/407 (82.06%), Query Frame = 3
Query:   87 LTGKKKVILAYSGGLDTSCILVWLQEKGYDVIAYLADVGQEEDFEAAKKKALSLGAVKFFCLDLKLAFVEEYIFKAIQANAIYEDRYLLGTSLARPIIAKGMIEIAKQEGCKYLSHGATGKGNDQIRFELACYALYPDIEIISPWKIPEFYNRFKGRQDLFEYAKVHNIPLPITKSEPWSMDSNLMHISYESGILENPSNEA-PDLYQMTKDPVTASPDQPEKLKIHFHKGVPVEVENLTNSKTVKGSLDLYQYLNEIGGLHGIGRIDIVENRVIGMKSRGIYETPAGTILYHAHLDIENLTMDRELRKIKQRLCIDFGEQIYYGMWFSPECDFLRNSIEYSQKCVTGTVTIKLFKGQVYILARQSPHSLYNEELVSMDVQGKYEPTDAAGFIKINALRLQEYHRIR 1304
            ++ K  V+LAYSGGLDTSCILVWL+E+GYDVIAYLA++GQ+EDFE A+KKAL LGA K F  D+   FVEE+I+ AIQ++A+YEDRYLLGTSLARP IA+  +EIA++EG KY+SHGATGKGNDQ+RFEL+CY+L P I++I+PW++PEFYNRFKGR DL EYAK H IP+P+T   PWSMD NLMHISYE+GILENP N+A P LY  T+DP  A P+ P+ L+I F KGVPV+V N+ +  T + SL+L+ YLNE+ G HG+GRIDIVENR IGMKSRGIYETPAGTILYHAHLDIE  TMDRE+RKIKQ L + F E +Y G W SPEC+F+R+ I  SQ+ V G V + + KGQVYIL R+SP SLYNEELVSM+VQG YEPTDA GFI IN+LRL+EYHR++
Sbjct:    1 MSSKGSVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVFIEDVSREFVEEFIWPAIQSSALYEDRYLLGTSLARPCIARKQVEIAQREGAKYVSHGATGKGNDQVRFELSCYSLAPQIKVIAPWRMPEFYNRFKGRNDLMEYAKQHGIPIPVTPKNPWSMDENLMHISYEAGILENPKNQAPPGLYTKTQDPAKA-PNTPDILEIEFKKGVPVKVTNVKDGTTHQTSLELFMYLNEVAGKHGVGRIDIVENRFIGMKSRGIYETPAGTILYHAHLDIEAFTMDREVRKIKQGLGLKFAELVYTGFWHSPECEFVRHCIAKSQERVEGKVQVSVLKGQVYILGRESPLSLYNEELVSMNVQGDYEPTDATGFININSLRLKEYHRLQ 406          
BLAST of Argininosuccinate synthase vs. Ensembl Human
Match: ASS1 (argininosuccinate synthase 1 [Source:HGNC Symbol;Acc:HGNC:758])

HSP 1 Score: 571.237 bits (1471), Expect = 0.000e+0
Identity = 275/407 (67.57%), Postives = 334/407 (82.06%), Query Frame = 3
Query:   87 LTGKKKVILAYSGGLDTSCILVWLQEKGYDVIAYLADVGQEEDFEAAKKKALSLGAVKFFCLDLKLAFVEEYIFKAIQANAIYEDRYLLGTSLARPIIAKGMIEIAKQEGCKYLSHGATGKGNDQIRFELACYALYPDIEIISPWKIPEFYNRFKGRQDLFEYAKVHNIPLPITKSEPWSMDSNLMHISYESGILENPSNEA-PDLYQMTKDPVTASPDQPEKLKIHFHKGVPVEVENLTNSKTVKGSLDLYQYLNEIGGLHGIGRIDIVENRVIGMKSRGIYETPAGTILYHAHLDIENLTMDRELRKIKQRLCIDFGEQIYYGMWFSPECDFLRNSIEYSQKCVTGTVTIKLFKGQVYILARQSPHSLYNEELVSMDVQGKYEPTDAAGFIKINALRLQEYHRIR 1304
            ++ K  V+LAYSGGLDTSCILVWL+E+GYDVIAYLA++GQ+EDFE A+KKAL LGA K F  D+   FVEE+I+ AIQ++A+YEDRYLLGTSLARP IA+  +EIA++EG KY+SHGATGKGNDQ+RFEL+CY+L P I++I+PW++PEFYNRFKGR DL EYAK H IP+P+T   PWSMD NLMHISYE+GILENP N+A P LY  T+DP  A P+ P+ L+I F KGVPV+V N+ +  T + SL+L+ YLNE+ G HG+GRIDIVENR IGMKSRGIYETPAGTILYHAHLDIE  TMDRE+RKIKQ L + F E +Y G W SPEC+F+R+ I  SQ+ V G V + + KGQVYIL R+SP SLYNEELVSM+VQG YEPTDA GFI IN+LRL+EYHR++
Sbjct:    1 MSSKGSVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVFIEDVSREFVEEFIWPAIQSSALYEDRYLLGTSLARPCIARKQVEIAQREGAKYVSHGATGKGNDQVRFELSCYSLAPQIKVIAPWRMPEFYNRFKGRNDLMEYAKQHGIPIPVTPKNPWSMDENLMHISYEAGILENPKNQAPPGLYTKTQDPAKA-PNTPDILEIEFKKGVPVKVTNVKDGTTHQTSLELFMYLNEVAGKHGVGRIDIVENRFIGMKSRGIYETPAGTILYHAHLDIEAFTMDREVRKIKQGLGLKFAELVYTGFWHSPECEFVRHCIAKSQERVEGKVQVSVLKGQVYILGRESPLSLYNEELVSMNVQGDYEPTDATGFININSLRLKEYHRLQ 406          
BLAST of Argininosuccinate synthase vs. Ensembl Human
Match: ASS1 (argininosuccinate synthase 1 [Source:HGNC Symbol;Acc:HGNC:758])

HSP 1 Score: 295.819 bits (756), Expect = 1.123e-98
Identity = 140/198 (70.71%), Postives = 171/198 (86.36%), Query Frame = 3
Query:   87 LTGKKKVILAYSGGLDTSCILVWLQEKGYDVIAYLADVGQEEDFEAAKKKALSLGAVKFFCLDLKLAFVEEYIFKAIQANAIYEDRYLLGTSLARPIIAKGMIEIAKQEGCKYLSHGATGKGNDQIRFELACYALYPDIEIISPWKIPEFYNRFKGRQDLFEYAKVHNIPLPITKSEPWSMDSNLMHISYESGILENP 680
            ++ K  V+LAYSGGLDTSCILVWL+E+GYDVIAYLA++GQ+EDFE A+KKAL LGA K F  D+   FVEE+I+ AIQ++A+YEDRYLLGTSLARP IA+  +EIA++EG KY+SHGATGKGNDQ+RFEL+CY+L P I++I+PW++PEFYNRFKGR DL EYAK H IP+P+T   PWSMD NLMHISYE+GILENP
Sbjct:    1 MSSKGSVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVFIEDVSREFVEEFIWPAIQSSALYEDRYLLGTSLARPCIARKQVEIAQREGAKYVSHGATGKGNDQVRFELSCYSLAPQIKVIAPWRMPEFYNRFKGRNDLMEYAKQHGIPIPVTPKNPWSMDENLMHISYEAGILENP 198          
BLAST of Argininosuccinate synthase vs. Ensembl Human
Match: ASS1 (argininosuccinate synthase 1 [Source:HGNC Symbol;Acc:HGNC:758])

HSP 1 Score: 253.062 bits (645), Expect = 3.211e-82
Identity = 127/198 (64.14%), Postives = 154/198 (77.78%), Query Frame = 3
Query:   87 LTGKKKVILAYSGGLDTSCILVWLQEKGYDVIAYLADVGQEEDFEAAKKKALSLGAVKFFCLDLKLAFVEEYIFKAIQANAIYEDRYLLGTSLARPIIAKGMIEIAKQEGCKYLSHGATGKGNDQIRFELACYALYPDIEIISPWKIPEFYNRFKGRQDLFEYAKVHNIPLPITKSEPWSMDSNLMHISYESGILENP 680
            ++ K  V+LAYSGGLDTSCILVWL+E+GYDVIAYLA++GQ+EDFE A+KKAL LGA K F  D+   FVEE+I+ AIQ++A+YEDRYLLGTSLARP IA+  +EIA++EG KY+SHGATGK                   +I+PW++PEFYNRFKGR DL EYAK H IP+P+T   PWSMD NLMHISYE+GILENP
Sbjct:    1 MSSKGSVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVFIEDVSREFVEEFIWPAIQSSALYEDRYLLGTSLARPCIARKQVEIAQREGAKYVSHGATGK-------------------VIAPWRMPEFYNRFKGRNDLMEYAKQHGIPIPVTPKNPWSMDENLMHISYEAGILENP 179          
BLAST of Argininosuccinate synthase vs. Ensembl Fly
Match: Ass (gene:FBgn0026565 transcript:FBtr0081699)

HSP 1 Score: 456.447 bits (1173), Expect = 8.749e-159
Identity = 219/405 (54.07%), Postives = 295/405 (72.84%), Query Frame = 3
Query:   96 KKKVILAYSGGLDTSCILVWLQEKGYDVIAYLADVGQEEDFEAAKKKALSLGAVKFFCLDLKLAFVEEYIFKAIQANAIYEDRYLLGTSLARPIIAKGMIEIAKQEGCKYLSHGATGKGNDQIRFELACYALYPDIEIISPWKIPEFYNRFKGRQDLFEYAKVHNIPLPITKSEPWSMDSNLMHISYESGILENPSNEAP-DLYQMTKDPVTASPDQPEKLKIHFHKGVPVEVENLTNSKTVKGSLDLYQYLNEIGGLHGIGRIDIVENRVIGMKSRGIYETPAGTILYHAHLDIENLTMDRELRKIKQRLCIDFGEQIYYGMWFSPECDFLRNSIEYSQKCVTGTVTIKLFKGQVYILARQSPH---SLYNEELVSMDVQGKYEPTDAAGFIKINALRLQEYHR 1298
            K+ VILAYSGGLDTSC+L WL +K Y+VI  LADVGQ+EDF AA+KKAL +GA K    D+K +FVE+YI+ A+Q   +YE+RYLLGTSLARP I+  ++E+A++ G KYL+HGATGKGNDQ+RFEL  YAL PD++II+PW+  EF  +F+GRQDL  YA+ H I +    + PWS D+N++HISYESGILE+P+  AP +LY+MT DP+T +P  P  L I F +G+P  VE+L   +     L++  +LN++GG +GIGRIDIVENR +G+KSRG+YETP GTIL+ AH D+E   +DRE+ + KQ L     + +Y G WFSPE  + R  IE +++ V+G VT++L  G    +AR++     +LYNE+LVSMDV G Y P DA GFI INA+R++E+ R
Sbjct:    3 KETVILAYSGGLDTSCVLKWLLDKQYEVICVLADVGQKEDFTAAEKKALKIGAKKVIVADVKQSFVEDYIWPAVQMGLVYEERYLLGTSLARPCISVALMEVAREYGAKYLAHGATGKGNDQVRFELCAYALKPDLKIIAPWRDVEFCCQFQGRQDLIAYAQQHGIEVSAKPATPWSTDANILHISYESGILEDPNTVAPENLYEMTVDPLTRAPRDPVHLVIQFDRGLPSSVEDLPGGRVYTKPLEMLDFLNKLGGSYGIGRIDIVENRFVGLKSRGVYETPGGTILFAAHQDLEVFALDREVLRTKQVLRDRMADYVYNGFWFSPEAIYARKCIELAEQRVSGKVTVELAPGYCRAIARKAAKDVGALYNEQLVSMDVHGGYVPQDAGGFIAINAVRIREHVR 407          
BLAST of Argininosuccinate synthase vs. Ensembl Fly
Match: Ass (gene:FBgn0026565 transcript:FBtr0337022)

HSP 1 Score: 456.447 bits (1173), Expect = 8.749e-159
Identity = 219/405 (54.07%), Postives = 295/405 (72.84%), Query Frame = 3
Query:   96 KKKVILAYSGGLDTSCILVWLQEKGYDVIAYLADVGQEEDFEAAKKKALSLGAVKFFCLDLKLAFVEEYIFKAIQANAIYEDRYLLGTSLARPIIAKGMIEIAKQEGCKYLSHGATGKGNDQIRFELACYALYPDIEIISPWKIPEFYNRFKGRQDLFEYAKVHNIPLPITKSEPWSMDSNLMHISYESGILENPSNEAP-DLYQMTKDPVTASPDQPEKLKIHFHKGVPVEVENLTNSKTVKGSLDLYQYLNEIGGLHGIGRIDIVENRVIGMKSRGIYETPAGTILYHAHLDIENLTMDRELRKIKQRLCIDFGEQIYYGMWFSPECDFLRNSIEYSQKCVTGTVTIKLFKGQVYILARQSPH---SLYNEELVSMDVQGKYEPTDAAGFIKINALRLQEYHR 1298
            K+ VILAYSGGLDTSC+L WL +K Y+VI  LADVGQ+EDF AA+KKAL +GA K    D+K +FVE+YI+ A+Q   +YE+RYLLGTSLARP I+  ++E+A++ G KYL+HGATGKGNDQ+RFEL  YAL PD++II+PW+  EF  +F+GRQDL  YA+ H I +    + PWS D+N++HISYESGILE+P+  AP +LY+MT DP+T +P  P  L I F +G+P  VE+L   +     L++  +LN++GG +GIGRIDIVENR +G+KSRG+YETP GTIL+ AH D+E   +DRE+ + KQ L     + +Y G WFSPE  + R  IE +++ V+G VT++L  G    +AR++     +LYNE+LVSMDV G Y P DA GFI INA+R++E+ R
Sbjct:    3 KETVILAYSGGLDTSCVLKWLLDKQYEVICVLADVGQKEDFTAAEKKALKIGAKKVIVADVKQSFVEDYIWPAVQMGLVYEERYLLGTSLARPCISVALMEVAREYGAKYLAHGATGKGNDQVRFELCAYALKPDLKIIAPWRDVEFCCQFQGRQDLIAYAQQHGIEVSAKPATPWSTDANILHISYESGILEDPNTVAPENLYEMTVDPLTRAPRDPVHLVIQFDRGLPSSVEDLPGGRVYTKPLEMLDFLNKLGGSYGIGRIDIVENRFVGLKSRGVYETPGGTILFAAHQDLEVFALDREVLRTKQVLRDRMADYVYNGFWFSPEAIYARKCIELAEQRVSGKVTVELAPGYCRAIARKAAKDVGALYNEQLVSMDVHGGYVPQDAGGFIAINAVRIREHVR 407          
BLAST of Argininosuccinate synthase vs. Ensembl Zebrafish
Match: ASS1 (argininosuccinate synthase 1 [Source:HGNC Symbol;Acc:HGNC:758])

HSP 1 Score: 337.035 bits (863), Expect = 1.549e-113
Identity = 160/238 (67.23%), Postives = 190/238 (79.83%), Query Frame = 3
Query:  507 IISPWKIPEFYNRFKGRQDLFEYAKVHNIPLPITKSEPWSMDSNLMHISYESGILENPSNEAP-DLYQMTKDPVTASPDQPEKLKIHFHKGVPVEVENLTNSKTVKGSLDLYQYLNEIGGLHGIGRIDIVENRVIGMKSRGIYETPAGTILYHAHLDIENLTMDRELRKIKQRLCIDFGEQIYYGMWFSPECDFLRNSIEYSQKCVTGTVTIKLFKGQVYILARQSPHSLYNEELVSM 1217
            +I+PW+IPEFYNRF+GR+DL EYA+ HNIP+P+T   PWSMD+NLMHISYESGILENP N AP DLYQMTK+P   SPDQ + L+I F KGVPV V +L +  + +  L+++ YLNEIGG HG+GRIDIVENR IGMKSRGIYETP GT+L  AHLDIE  TMDRE+RKIKQ L I F E IY G WFSPEC+F+R  +E SQK V G V + ++KGQVYIL R+SP SLYNEELVS+
Sbjct:   43 VIAPWRIPEFYNRFRGRKDLMEYAEKHNIPVPVTPKAPWSMDANLMHISYESGILENPKNHAPSDLYQMTKNP-EHSPDQADMLEIEFKKGVPVRVSHLKDGISKETPLEIFCYLNEIGGKHGVGRIDIVENRFIGMKSRGIYETPGGTVLLQAHLDIETFTMDREVRKIKQSLGIKFSELIYNGFWFSPECEFVRECVERSQKHVEGRVQLSVYKGQVYILGRESPKSLYNEELVSI 279          
BLAST of Argininosuccinate synthase vs. Ensembl Xenopus
Match: ass1 (argininosuccinate synthase 1 [Source:NCBI gene;Acc:496645])

HSP 1 Score: 592.423 bits (1526), Expect = 0.000e+0
Identity = 276/404 (68.32%), Postives = 332/404 (82.18%), Query Frame = 3
Query:   96 KKKVILAYSGGLDTSCILVWLQEKGYDVIAYLADVGQEEDFEAAKKKALSLGAVKFFCLDLKLAFVEEYIFKAIQANAIYEDRYLLGTSLARPIIAKGMIEIAKQEGCKYLSHGATGKGNDQIRFELACYALYPDIEIISPWKIPEFYNRFKGRQDLFEYAKVHNIPLPITKSEPWSMDSNLMHISYESGILENPSNEA-PDLYQMTKDPVTASPDQPEKLKIHFHKGVPVEVENLTNSKTVKGSLDLYQYLNEIGGLHGIGRIDIVENRVIGMKSRGIYETPAGTILYHAHLDIENLTMDRELRKIKQRLCIDFGEQIYYGMWFSPECDFLRNSIEYSQKCVTGTVTIKLFKGQVYILARQSPHSLYNEELVSMDVQGKYEPTDAAGFIKINALRLQEYHRIR 1304
            K  V+LAYSGGLDTSCILVWL+E+GYDVIAYLA++GQ EDFEAA+KKA++LGA K +  D++  FVEEYI+ A+QANAIYEDRYLLGTSLARP IAK  +EIAK+E  +Y+SHGATGKGNDQIRFEL CYALYP+++II+PW++PEFYNRF+GR DL EYAK HNIP+P+T  +PWSMD N+MHISYE GILENP N A P LY  TK+P T SP++P+ L+I F KGVPV+V N         +L L+ YLNE+ G HG+GRIDIVENR IGMKSRGIYETPAGTILY AHLD+E  TMDRE+RKIKQ L   F EQIY G W+SPEC+F+R+ I  SQ+ V G V + + KGQVY+L R++PHSLYNEELVSMDVQG Y+P DA GFI+INALRL+E+HR++
Sbjct:    5 KGMVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQNEDFEAARKKAVNLGAKKVYIEDMRQQFVEEYIWPAVQANAIYEDRYLLGTSLARPCIAKKQVEIAKKEAAEYVSHGATGKGNDQIRFELTCYALYPEVKIIAPWRMPEFYNRFRGRSDLMEYAKKHNIPVPVTPKDPWSMDENIMHISYEGGILENPKNHAPPGLYLKTKNPAT-SPNEPDILEIEFKKGVPVKVTNTKEKTQHSSALGLFCYLNEVAGKHGVGRIDIVENRFIGMKSRGIYETPAGTILYQAHLDVEAFTMDREVRKIKQHLSQRFAEQIYNGFWYSPECEFVRSCITKSQEMVEGKVLVSVLKGQVYVLGREAPHSLYNEELVSMDVQGDYDPADACGFIRINALRLKEFHRLQ 407          
BLAST of Argininosuccinate synthase vs. Ensembl Xenopus
Match: ass1 (argininosuccinate synthase 1 [Source:NCBI gene;Acc:496645])

HSP 1 Score: 580.867 bits (1496), Expect = 0.000e+0
Identity = 272/396 (68.69%), Postives = 324/396 (81.82%), Query Frame = 3
Query:   96 KKKVILAYSGGLDTSCILVWLQEKGYDVIAYLADVGQEEDFEAAKKKALSLGAVKFFCLDLKLAFVEEYIFKAIQANAIYEDRYLLGTSLARPIIAKGMIEIAKQEGCKYLSHGATGKGNDQIRFELACYALYPDIEIISPWKIPEFYNRFKGRQDLFEYAKVHNIPLPITKSEPWSMDSNLMHISYESGILENPSNEA-PDLYQMTKDPVTASPDQPEKLKIHFHKGVPVEVENLTNSKTVKGSLDLYQYLNEIGGLHGIGRIDIVENRVIGMKSRGIYETPAGTILYHAHLDIENLTMDRELRKIKQRLCIDFGEQIYYGMWFSPECDFLRNSIEYSQKCVTGTVTIKLFKGQVYILARQSPHSLYNEELVSMDVQGKYEPTDAAGFIKINALR 1280
            K  V+LAYSGGLDTSCILVWL+E+GYDVIAYLA++GQ EDFEAA+KKA++LGA K +  D++  FVEEYI+ A+QANAIYEDRYLLGTSLARP IAK  +EIAK+E  +Y+SHGATGKGNDQIRFEL CYALYP+++II+PW++PEFYNRF+GR DL EYAK HNIP+P+T  +PWSMD N+MHISYE GILENP N A P LY  TK+P T SP++P+ L+I F KGVPV+V N         +L L+ YLNE+ G HG+GRIDIVENR IGMKSRGIYETPAGTILY AHLD+E  TMDRE+RKIKQ L   F EQIY G W+SPEC+F+R+ I  SQ+ V G V + + KGQVY+L R++PHSLYNEELVSMDVQG Y+P DA GFI+INALR
Sbjct:    5 KGMVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQNEDFEAARKKAVNLGAKKVYIEDMRQQFVEEYIWPAVQANAIYEDRYLLGTSLARPCIAKKQVEIAKKEAAEYVSHGATGKGNDQIRFELTCYALYPEVKIIAPWRMPEFYNRFRGRSDLMEYAKKHNIPVPVTPKDPWSMDENIMHISYEGGILENPKNHAPPGLYLKTKNPAT-SPNEPDILEIEFKKGVPVKVTNTKEKTQHSSALGLFCYLNEVAGKHGVGRIDIVENRFIGMKSRGIYETPAGTILYQAHLDVEAFTMDREVRKIKQHLSQRFAEQIYNGFWYSPECEFVRSCITKSQEMVEGKVLVSVLKGQVYVLGREAPHSLYNEELVSMDVQGDYDPADACGFIRINALR 399          
BLAST of Argininosuccinate synthase vs. Ensembl Xenopus
Match: ass1 (argininosuccinate synthase 1 [Source:NCBI gene;Acc:496645])

HSP 1 Score: 549.666 bits (1415), Expect = 0.000e+0
Identity = 262/404 (64.85%), Postives = 319/404 (78.96%), Query Frame = 3
Query:   93 GKKKVILAYSGGLDTSCILVWLQEKGYDVIAYLADVGQEEDFEAAKKKALSLGAVKFFCLDLKLAFVEEYIFKAIQANAIYEDRYLLGTSLARPIIAKGMIEIAKQEGCKYLSHGATGKGNDQIRFELACYALYPDIEIISPWKIPEFYNRFKGRQDLFEYAKVHNIPLPITKSEPWSMDSNLMHISYESGILENPSN-------EAPD-LYQMTKDPVTASPDQPEKLKIHFHKGVPVEVENLTNSKTVKGSLDLYQYLNEIGGLHGIGRIDIVENRVIGMKSRGIYETPAGTILYHAHLDIENLTMDRELRKIKQRLCIDFGEQIYYGMWFSPECDFLRNSIEYSQKCVTGTVTIKLFKGQVYILARQSPHSLYNEELVSMDVQGKYEPTDAAGFIKINALR 1280
             K  V+LAYSGGLDTSCILVWL+E+GYDVIAYLA++GQ EDFEAA+KKA++LGA K +  D++  FVEEYI+ A+QANAIYEDRYLLGTSLARP IAK  +EIAK+E  +Y+SHGATGKGNDQIRFEL CYALYP+++II+PW++PEFYNRF+GR DL EYAK HNIP+P+T  +PWSMD N+MHI Y   I+    +       + P+ L + TK+P T SP++P+ L+I F KGVPV+V N         +L L+ YLNE+ G HG+GRIDIVENR IGMKSRGIYETPAGTILY AHLD+E  TMDRE+RKIKQ L   F EQIY G W+SPEC+F+R+ I  SQ+ V G V + + KGQVY+L R++PHSLYNEELVSMDVQG Y+P DA GFI+INALR
Sbjct:    4 SKGMVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQNEDFEAARKKAVNLGAKKVYIEDMRQQFVEEYIWPAVQANAIYEDRYLLGTSLARPCIAKKQVEIAKKEAAEYVSHGATGKGNDQIRFELTCYALYPEVKIIAPWRMPEFYNRFRGRSDLMEYAKKHNIPVPVTPKDPWSMDENIMHIRYIFLIIHTRLDWQICRFWQMPEGLLEDTKNPAT-SPNEPDILEIEFKKGVPVKVTNTKEKTQHSSALGLFCYLNEVAGKHGVGRIDIVENRFIGMKSRGIYETPAGTILYQAHLDVEAFTMDREVRKIKQHLSQRFAEQIYNGFWYSPECEFVRSCITKSQEMVEGKVLVSVLKGQVYVLGREAPHSLYNEELVSMDVQGDYDPADACGFIRINALR 406          
BLAST of Argininosuccinate synthase vs. Ensembl Xenopus
Match: ass1 (argininosuccinate synthase 1 [Source:NCBI gene;Acc:496645])

HSP 1 Score: 546.969 bits (1408), Expect = 0.000e+0
Identity = 259/401 (64.59%), Postives = 315/401 (78.55%), Query Frame = 3
Query:   93 GKKKVILAYSGGLDTSCILVWLQEKGYDVIAYLADVGQEEDFEAAKKKALSLGAVKFFCLDLKLAFVEEYIFKAIQANAIYEDRYLLGTSLARPIIAKGMIEIAKQEGCKYLSHGATGKGNDQIRFELACYALYPDIEIISPWKIPEFYNRFKGRQDLFEYAKVHNIPLPITKSEPWSMDSNLMHISYESGILENPSN-EAPDLYQMT----KDPVTASPDQPEKLKIHFHKGVPVEVENLTNSKTVKGSLDLYQYLNEIGGLHGIGRIDIVENRVIGMKSRGIYETPAGTILYHAHLDIENLTMDRELRKIKQRLCIDFGEQIYYGMWFSPECDFLRNSIEYSQKCVTGTVTIKLFKGQVYILARQSPHSLYNEELVSMDVQGKYEPTDAAGFIKINALR 1280
             K  V+LAYSGGLDTSCILVWL+E+GYDVIAYLA++GQ EDFEAA+KKA++LGA K +  D++  FVEEYI+ A+QANAIYEDRYLLGTSLARP IAK  +EIAK+E  +Y+SHGATGKGNDQIRFEL CYALYP+++II+PW++PEFYNRF+GR DL EYAK HNIP+P+T  +PWSMD N+MHI Y   I+    + +    +QM     +D    SP++P+ L+I F KGVPV+V N         +L L+ YLNE+ G HG+GRIDIVENR IGMKSRGIYETPAGTILY AHLD+E  TMDRE+RKIKQ L   F EQIY G W+SPEC+F+R+ I  SQ+ V G V + + KGQVY+L R++PHSLYNEELVSMDVQG Y+P DA GFI+INALR
Sbjct:    4 SKGMVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQNEDFEAARKKAVNLGAKKVYIEDMRQQFVEEYIWPAVQANAIYEDRYLLGTSLARPCIAKKQVEIAKKEAAEYVSHGATGKGNDQIRFELTCYALYPEVKIIAPWRMPEFYNRFRGRSDLMEYAKKHNIPVPVTPKDPWSMDENIMHIRYIFLIIHTRLDWQICRFWQMPEGLLEDNPATSPNEPDILEIEFKKGVPVKVTNTKEKTQHSSALGLFCYLNEVAGKHGVGRIDIVENRFIGMKSRGIYETPAGTILYQAHLDVEAFTMDREVRKIKQHLSQRFAEQIYNGFWYSPECEFVRSCITKSQEMVEGKVLVSVLKGQVYVLGREAPHSLYNEELVSMDVQGDYDPADACGFIRINALR 404          
BLAST of Argininosuccinate synthase vs. Ensembl Xenopus
Match: ass1 (argininosuccinate synthase 1 [Source:NCBI gene;Acc:496645])

HSP 1 Score: 459.529 bits (1181), Expect = 5.277e-160
Identity = 229/395 (57.97%), Postives = 278/395 (70.38%), Query Frame = 3
Query:   96 KKKVILAYSGGLDTSCILVWLQEKGYDVIAYLADVGQEEDFEAAKKKALSLGAVKFFCLDLKLAFVEEYIFKAIQANAIYEDRYLLGTSLARPIIAKGMIEIAKQEGCKYLSHGATGKGNDQIRFELACYALYPDIEIISPWKIPEFYNRFKGRQDLFEYAKVHNIPLPITKSEPWSMDSNLMHISYESGILENPSNEAPDLYQMTKDPVTASPDQPEKLKIHFHKGVPVEVENLTNSKTVKGSLDLYQYLNEIGGLHGIGRIDIVENRVIGMKSRGIYETPAGTILYHAHLDIENLTMDRELRKIKQRLCIDFGEQIYYGMWFSPECDFLRNSIEYSQKCVTGTVTIKLFKGQVYILARQSPHSLYNEELVSMDVQGKYEPTDAAGFIKINALR 1280
            K  V+LAYSGGLDTSCILVWL+E+GYDVIAYLA++GQ EDFEAA+KKA++LGA K +  D++  FVEEYI+ A+QANAIYEDRYLLGTSLARP IAK  +EIAK+E  +Y+SHGATGKGNDQIRFEL CYALYP++++ + +                         +P+    P                        P LY  TK+P T SP++P+ L+I F KGVPV+V N         +L L+ YLNE+ G HG+GRIDIVENR IGMKSRGIYETPAGTILY AHLD+E  TMDRE+RKIKQ L   F EQIY G W+SPEC+F+R+ I  SQ+ V G V + + KGQVY+L R++PHSLYNEELVSMDVQG Y+P DA GFI+INALR
Sbjct:    5 KGMVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQNEDFEAARKKAVNLGAKKVYIEDMRQQFVEEYIWPAVQANAIYEDRYLLGTSLARPCIAKKQVEIAKKEAAEYVSHGATGKGNDQIRFELTCYALYPEVKVTTIY-----------------------CSVPLLNHAP------------------------PGLYLKTKNPAT-SPNEPDILEIEFKKGVPVKVTNTKEKTQHSSALGLFCYLNEVAGKHGVGRIDIVENRFIGMKSRGIYETPAGTILYQAHLDVEAFTMDREVRKIKQHLSQRFAEQIYNGFWYSPECEFVRSCITKSQEMVEGKVLVSVLKGQVYVLGREAPHSLYNEELVSMDVQGDYDPADACGFIRINALR 351          
BLAST of Argininosuccinate synthase vs. Ensembl Mouse
Match: Ass1 (argininosuccinate synthetase 1 [Source:MGI Symbol;Acc:MGI:88090])

HSP 1 Score: 571.237 bits (1471), Expect = 0.000e+0
Identity = 274/407 (67.32%), Postives = 333/407 (81.82%), Query Frame = 3
Query:   87 LTGKKKVILAYSGGLDTSCILVWLQEKGYDVIAYLADVGQEEDFEAAKKKALSLGAVKFFCLDLKLAFVEEYIFKAIQANAIYEDRYLLGTSLARPIIAKGMIEIAKQEGCKYLSHGATGKGNDQIRFELACYALYPDIEIISPWKIPEFYNRFKGRQDLFEYAKVHNIPLPITKSEPWSMDSNLMHISYESGILENPSNEA-PDLYQMTKDPVTASPDQPEKLKIHFHKGVPVEVENLTNSKTVKGSLDLYQYLNEIGGLHGIGRIDIVENRVIGMKSRGIYETPAGTILYHAHLDIENLTMDRELRKIKQRLCIDFGEQIYYGMWFSPECDFLRNSIEYSQKCVTGTVTIKLFKGQVYILARQSPHSLYNEELVSMDVQGKYEPTDAAGFIKINALRLQEYHRIR 1304
            ++ K  V+LAYSGGLDTSCILVWL+E+GYDVIAYLA++GQ+EDFE A+KKAL LGA K F  D+   FVEE+I+ A+Q++A+YEDRYLLGTSLARP IA+  +EIA++EG KY+SHGATGKGNDQ+RFEL CY+L P I++I+PW++PEFYNRFKGR DL EYAK H IP+P+T   PWSMD NLMHISYE+GILENP N+A P LY  T+DP  A P+ P+ L+I F KGVPV+V N+ +  T   SL+L+ YLNE+ G HG+GRIDIVENR IGMKSRGIYETPAGTILYHAHLDIE  TMDRE+RKIKQ L + F E +Y G W SPEC+F+R+ I+ SQ+ V G V + +FKGQVYIL R+SP SLYNEELVSM+VQG YEP DA GFI IN+LRL+EYHR++
Sbjct:    1 MSSKGSVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVFIEDVSKEFVEEFIWPAVQSSALYEDRYLLGTSLARPCIARRQVEIAQREGAKYVSHGATGKGNDQVRFELTCYSLAPQIKVIAPWRMPEFYNRFKGRNDLMEYAKQHGIPIPVTPKSPWSMDENLMHISYEAGILENPKNQAPPGLYTKTQDPAKA-PNSPDVLEIEFKKGVPVKVTNIKDGTTRTTSLELFMYLNEVAGKHGVGRIDIVENRFIGMKSRGIYETPAGTILYHAHLDIEAFTMDREVRKIKQGLGLKFAELVYTGFWHSPECEFVRHCIQKSQERVEGKVQVSVFKGQVYILGRESPLSLYNEELVSMNVQGDYEPIDATGFININSLRLKEYHRLQ 406          
BLAST of Argininosuccinate synthase vs. UniProt/SwissProt
Match: sp|Q7ZWM4|ASSY_XENLA (Argininosuccinate synthase OS=Xenopus laevis OX=8355 GN=ass1 PE=2 SV=1)

HSP 1 Score: 595.504 bits (1534), Expect = 0.000e+0
Identity = 279/404 (69.06%), Postives = 331/404 (81.93%), Query Frame = 3
Query:   96 KKKVILAYSGGLDTSCILVWLQEKGYDVIAYLADVGQEEDFEAAKKKALSLGAVKFFCLDLKLAFVEEYIFKAIQANAIYEDRYLLGTSLARPIIAKGMIEIAKQEGCKYLSHGATGKGNDQIRFELACYALYPDIEIISPWKIPEFYNRFKGRQDLFEYAKVHNIPLPITKSEPWSMDSNLMHISYESGILENPSNEA-PDLYQMTKDPVTASPDQPEKLKIHFHKGVPVEVENLTNSKTVKGSLDLYQYLNEIGGLHGIGRIDIVENRVIGMKSRGIYETPAGTILYHAHLDIENLTMDRELRKIKQRLCIDFGEQIYYGMWFSPECDFLRNSIEYSQKCVTGTVTIKLFKGQVYILARQSPHSLYNEELVSMDVQGKYEPTDAAGFIKINALRLQEYHRIR 1304
            K  V+LAYSGGLDTSCILVWL+E+G+DVIAYLA++GQ EDFE A+KKA++LGA K +  D++  FVEEYI+ A+QANAIYEDRYLLGTSLARP IAK  +EIAK+E  +Y+SHGATGKGNDQIRFEL CY+LYP+++II+PW++PEFYNRF+GR DL EYAK HNI +P+T   PWSMD NLMHISYE GILENP N A P LY  TKDP T SPD+P+ L+I F KGVPV+V N  N      SL L+ YLNE+ G HG+GRIDIVENR IGMKSRGIYETPAGTILY AHLDIE  TMDRE+RKIKQ+L   F EQIY G W+SPEC+F+R+ I  SQ+ V G V + + KGQVY+L R++PHSLYNEELVSMDVQG Y+P DA GFIKINA+RL+EYHR++
Sbjct:    5 KGTVVLAYSGGLDTSCILVWLKEQGFDVIAYLANIGQNEDFEEARKKAVNLGAKKVYIEDIRQQFVEEYIWPAVQANAIYEDRYLLGTSLARPCIAKKQVEIAKKEAAEYVSHGATGKGNDQIRFELTCYSLYPEVKIIAPWRMPEFYNRFRGRSDLMEYAKKHNISVPVTPKSPWSMDENLMHISYEGGILENPKNHAPPGLYLKTKDPAT-SPDEPDILEIEFKKGVPVKVTNTKNKTQHSSSLALFCYLNEVAGKHGVGRIDIVENRFIGMKSRGIYETPAGTILYQAHLDIEAFTMDREMRKIKQQLSQRFAEQIYNGFWYSPECEFVRSCISKSQEMVEGKVLVSVLKGQVYVLGREAPHSLYNEELVSMDVQGDYDPADACGFIKINAVRLKEYHRLQ 407          
BLAST of Argininosuccinate synthase vs. UniProt/SwissProt
Match: sp|Q5M8Z6|ASSY_XENTR (Argininosuccinate synthase OS=Xenopus tropicalis OX=8364 GN=ass1 PE=2 SV=1)

HSP 1 Score: 592.423 bits (1526), Expect = 0.000e+0
Identity = 276/404 (68.32%), Postives = 332/404 (82.18%), Query Frame = 3
Query:   96 KKKVILAYSGGLDTSCILVWLQEKGYDVIAYLADVGQEEDFEAAKKKALSLGAVKFFCLDLKLAFVEEYIFKAIQANAIYEDRYLLGTSLARPIIAKGMIEIAKQEGCKYLSHGATGKGNDQIRFELACYALYPDIEIISPWKIPEFYNRFKGRQDLFEYAKVHNIPLPITKSEPWSMDSNLMHISYESGILENPSNEA-PDLYQMTKDPVTASPDQPEKLKIHFHKGVPVEVENLTNSKTVKGSLDLYQYLNEIGGLHGIGRIDIVENRVIGMKSRGIYETPAGTILYHAHLDIENLTMDRELRKIKQRLCIDFGEQIYYGMWFSPECDFLRNSIEYSQKCVTGTVTIKLFKGQVYILARQSPHSLYNEELVSMDVQGKYEPTDAAGFIKINALRLQEYHRIR 1304
            K  V+LAYSGGLDTSCILVWL+E+GYDVIAYLA++GQ EDFEAA+KKA++LGA K +  D++  FVEEYI+ A+QANAIYEDRYLLGTSLARP IAK  +EIAK+E  +Y+SHGATGKGNDQIRFEL CYALYP+++II+PW++PEFYNRF+GR DL EYAK HNIP+P+T  +PWSMD N+MHISYE GILENP N A P LY  TK+P T SP++P+ L+I F KGVPV+V N         +L L+ YLNE+ G HG+GRIDIVENR IGMKSRGIYETPAGTILY AHLD+E  TMDRE+RKIKQ L   F EQIY G W+SPEC+F+R+ I  SQ+ V G V + + KGQVY+L R++PHSLYNEELVSMDVQG Y+P DA GFI+INALRL+E+HR++
Sbjct:    5 KGMVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQNEDFEAARKKAVNLGAKKVYIEDMRQQFVEEYIWPAVQANAIYEDRYLLGTSLARPCIAKKQVEIAKKEAAEYVSHGATGKGNDQIRFELTCYALYPEVKIIAPWRMPEFYNRFRGRSDLMEYAKKHNIPVPVTPKDPWSMDENIMHISYEGGILENPKNHAPPGLYLKTKNPAT-SPNEPDILEIEFKKGVPVKVTNTKEKTQHSSALGLFCYLNEVAGKHGVGRIDIVENRFIGMKSRGIYETPAGTILYQAHLDVEAFTMDREVRKIKQHLSQRFAEQIYNGFWYSPECEFVRSCITKSQEMVEGKVLVSVLKGQVYVLGREAPHSLYNEELVSMDVQGDYDPADACGFIRINALRLKEFHRLQ 407          
BLAST of Argininosuccinate synthase vs. UniProt/SwissProt
Match: sp|Q66I24|ASSY_DANRE (Argininosuccinate synthase OS=Danio rerio OX=7955 GN=ass1 PE=2 SV=1)

HSP 1 Score: 586.26 bits (1510), Expect = 0.000e+0
Identity = 274/404 (67.82%), Postives = 336/404 (83.17%), Query Frame = 3
Query:   96 KKKVILAYSGGLDTSCILVWLQEKGYDVIAYLADVGQEEDFEAAKKKALSLGAVKFFCLDLKLAFVEEYIFKAIQANAIYEDRYLLGTSLARPIIAKGMIEIAKQEGCKYLSHGATGKGNDQIRFELACYALYPDIEIISPWKIPEFYNRFKGRQDLFEYAKVHNIPLPITKSEPWSMDSNLMHISYESGILENPSNEAP-DLYQMTKDPVTASPDQPEKLKIHFHKGVPVEVENLTNSKTVKGSLDLYQYLNEIGGLHGIGRIDIVENRVIGMKSRGIYETPAGTILYHAHLDIENLTMDRELRKIKQRLCIDFGEQIYYGMWFSPECDFLRNSIEYSQKCVTGTVTIKLFKGQVYILARQSPHSLYNEELVSMDVQGKYEPTDAAGFIKINALRLQEYHRIR 1304
            K  V+LAYSGGLDTSCILVWL+E+GYDVIAYLA++GQ+EDF+ A+KKA  LGA K F  DL+  FV+E+I+ A+QANA+YEDRYLLGTS+ARP IA+  ++IA++EG +Y+SHGATGKGNDQ+RFEL CYALYP +++I+PW+IPEFYNRF+GR+DL EYA+ HNIP+P+T   PWSMD+NLMHISYESGILENP N AP DLYQMTK+P   SPDQ + L+I F KGVPV V +L +  + +  L+++ YLNEIGG HG+GRIDIVENR IGMKSRGIYETP GT+L  AHLDIE  TMDRE+RKIKQ L I F E IY G WFSPEC+F+R  +E SQK V G V + ++KGQVYIL R+SP SLYNEELVSMDVQG Y+P DA+GFIKINA+RL+E++R++
Sbjct:    3 KGLVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQDEDFDVARKKAEKLGAKKVFIEDLRSEFVQEFIWPALQANALYEDRYLLGTSIARPCIARRQVQIAQREGAQYVSHGATGKGNDQVRFELTCYALYPQVQVIAPWRIPEFYNRFRGRKDLMEYAEKHNIPVPVTPKAPWSMDANLMHISYESGILENPKNHAPSDLYQMTKNP-EHSPDQADMLEIEFKKGVPVRVSHLKDGISKETPLEIFCYLNEIGGKHGVGRIDIVENRFIGMKSRGIYETPGGTVLLQAHLDIETFTMDREVRKIKQSLGIKFSELIYNGFWFSPECEFVRECVERSQKHVEGRVQLSVYKGQVYILGRESPKSLYNEELVSMDVQGDYDPCDASGFIKINAVRLREHNRLQ 405          
BLAST of Argininosuccinate synthase vs. UniProt/SwissProt
Match: sp|Q5ZJ23|ASSY_CHICK (Argininosuccinate synthase OS=Gallus gallus OX=9031 GN=ASS1 PE=2 SV=1)

HSP 1 Score: 576.63 bits (1485), Expect = 0.000e+0
Identity = 263/404 (65.10%), Postives = 332/404 (82.18%), Query Frame = 3
Query:   96 KKKVILAYSGGLDTSCILVWLQEKGYDVIAYLADVGQEEDFEAAKKKALSLGAVKFFCLDLKLAFVEEYIFKAIQANAIYEDRYLLGTSLARPIIAKGMIEIAKQEGCKYLSHGATGKGNDQIRFELACYALYPDIEIISPWKIPEFYNRFKGRQDLFEYAKVHNIPLPITKSEPWSMDSNLMHISYESGILENPSNEAP-DLYQMTKDPVTASPDQPEKLKIHFHKGVPVEVENLTNSKTVKGSLDLYQYLNEIGGLHGIGRIDIVENRVIGMKSRGIYETPAGTILYHAHLDIENLTMDRELRKIKQRLCIDFGEQIYYGMWFSPECDFLRNSIEYSQKCVTGTVTIKLFKGQVYILARQSPHSLYNEELVSMDVQGKYEPTDAAGFIKINALRLQEYHRIR 1304
            +  V+LAYSGGLDTSCILVWL+E+GY VIA+LA++GQ EDF+AA+KKAL+LGA K +  D+   FVE++I+ A++ANA+YEDRY+LG++LARP IA+ ++ IA++EG +Y++HGATGKGNDQ+RFEL CYAL P I++I+PW++PEFY RF GR++L EYA+ H IP+P+T   PWSMD NLMHISYE+GILENP N AP DLY  T +P T SPD P++L+I F KGVPV+V N  N  T + +L+L+ YLN+I   HG+GR+DIVENR +GMKSRGIYETPAGTILYHAHLDIE  TMDRE+RKIKQ L + F E +Y G W+SPEC+FL++ I  SQ+ V GTV + +FKGQVY+L R+SPHSLYNEELVSMDVQG YEP DA GFI INALRL+EYHR++
Sbjct:    5 RDTVVLAYSGGLDTSCILVWLKEQGYTVIAFLANIGQTEDFDAAQKKALALGAKKVYIQDVCREFVEDFIWPAVRANALYEDRYMLGSALARPCIARHLVLIAQEEGARYIAHGATGKGNDQVRFELGCYALCPSIKVIAPWRMPEFYQRFPGRRELMEYAQKHGIPVPVTPKAPWSMDENLMHISYEAGILENPKNRAPLDLYTKTCNPTT-SPDVPDELEIEFEKGVPVKVTNTRNGVTHRSALELFVYLNDIASKHGVGRVDIVENRFVGMKSRGIYETPAGTILYHAHLDIEAFTMDREVRKIKQGLSLKFSELVYNGFWYSPECEFLKHCIARSQQAVAGTVHVSVFKGQVYVLGRESPHSLYNEELVSMDVQGDYEPADATGFININALRLKEYHRLQ 407          
BLAST of Argininosuccinate synthase vs. UniProt/SwissProt
Match: sp|P09034|ASSY_RAT (Argininosuccinate synthase OS=Rattus norvegicus OX=10116 GN=Ass1 PE=1 SV=1)

HSP 1 Score: 572.392 bits (1474), Expect = 0.000e+0
Identity = 275/407 (67.57%), Postives = 333/407 (81.82%), Query Frame = 3
Query:   87 LTGKKKVILAYSGGLDTSCILVWLQEKGYDVIAYLADVGQEEDFEAAKKKALSLGAVKFFCLDLKLAFVEEYIFKAIQANAIYEDRYLLGTSLARPIIAKGMIEIAKQEGCKYLSHGATGKGNDQIRFELACYALYPDIEIISPWKIPEFYNRFKGRQDLFEYAKVHNIPLPITKSEPWSMDSNLMHISYESGILENPSNEA-PDLYQMTKDPVTASPDQPEKLKIHFHKGVPVEVENLTNSKTVKGSLDLYQYLNEIGGLHGIGRIDIVENRVIGMKSRGIYETPAGTILYHAHLDIENLTMDRELRKIKQRLCIDFGEQIYYGMWFSPECDFLRNSIEYSQKCVTGTVTIKLFKGQVYILARQSPHSLYNEELVSMDVQGKYEPTDAAGFIKINALRLQEYHRIR 1304
            ++ K  V+LAYSGGLDTSCILVWL+E+GYDVIAYLA++GQ+EDFE A+KKAL LGA K F  D+   FVEE+I+ A+Q++A+YEDRYLLGTSLARP IA+  +EIA++EG KY+SHGATGKGNDQ+RFEL CY+L P I++I+PW++PEFYNRFKGR DL EYAK H IP+P+T   PWSMD NLMHISYE+GILENP N+A P LY  T+DP  A P+ P+ L+I F KGVPV+V N+ +  T   SLDL+ YLNE+ G HG+GRIDIVENR IGMKSRGIYETPAGTILYHAHLDIE  TMDRE+RKIKQ L + F E +Y G W SPEC+F+R+ I+ SQ+ V G V + +FKGQVYIL R+SP SLYNEELVSM+VQG YEP DA GFI IN+LRL+EYHR++
Sbjct:    1 MSSKGSVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVFIEDVSKEFVEEFIWPAVQSSALYEDRYLLGTSLARPCIARKQVEIAQREGAKYVSHGATGKGNDQVRFELTCYSLAPQIKVIAPWRMPEFYNRFKGRNDLMEYAKQHGIPIPVTPKSPWSMDENLMHISYEAGILENPKNQAPPGLYTKTQDPAKA-PNTPDVLEIEFKKGVPVKVTNVKDGTTHSTSLDLFMYLNEVAGKHGVGRIDIVENRFIGMKSRGIYETPAGTILYHAHLDIEAFTMDREVRKIKQGLGLKFAELVYTGFWHSPECEFVRHCIDKSQERVEGKVQVSVFKGQVYILGRESPLSLYNEELVSMNVQGDYEPIDATGFININSLRLKEYHRLQ 406          
BLAST of Argininosuccinate synthase vs. TrEMBL
Match: A0A1I8GT52 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018132g1 PE=3 SV=1)

HSP 1 Score: 612.068 bits (1577), Expect = 0.000e+0
Identity = 285/404 (70.54%), Postives = 338/404 (83.66%), Query Frame = 3
Query:   96 KKKVILAYSGGLDTSCILVWLQEKGYDVIAYLADVGQEEDFEAAKKKALSLGAVKFFCLDLKLAFVEEYIFKAIQANAIYEDRYLLGTSLARPIIAKGMIEIAKQEGCKYLSHGATGKGNDQIRFELACYALYPDIEIISPWKIPEFYNRFKGRQDLFEYAKVHNIPLPITKSEPWSMDSNLMHISYESGILENPSNEAP-DLYQMTKDPVTASPDQPEKLKIHFHKGVPVEVENLTNSKTVKGSLDLYQYLNEIGGLHGIGRIDIVENRVIGMKSRGIYETPAGTILYHAHLDIENLTMDRELRKIKQRLCIDFGEQIYYGMWFSPECDFLRNSIEYSQKCVTGTVTIKLFKGQVYILARQSPHSLYNEELVSMDVQGKYEPTDAAGFIKINALRLQEYHRIR 1304
            KKK++LAYSGGLDTSCILVWL E+GYDVIA+ ADVGQ++DFEAAK+KALSLGA+K+ CLDL+  FV+ YIF A+QA+AIYEDRYLLGT+LARP IA G+I +A +EG  ++SHGATGKGNDQIRFELA YAL P +E++SPW++PEFY RF GRQ LFEYAK HNIPLP+T   PWSMD NLMHISYESGILE+P  EAP DL  MTK P  A PDQ  ++ I F +G+PV+V NLT  + + GSL+LY YLN+IGG HGIGR+DIVENR IGMKSRG+YETPAGTIL  AH+DIE LTMDRELR+IKQRL +DFGEQ+Y G WFSPEC FLR+ I+ SQ+ V+GTV + LFKG V++ AR S  SLYN+ELVSMDVQG YEP DA GFI+INALRL+EYHR++
Sbjct:    7 KKKIVLAYSGGLDTSCILVWLIEQGYDVIAFTADVGQDDDFEAAKQKALSLGAIKYVCLDLRRDFVDNYIFPAVQADAIYEDRYLLGTALARPCIASGIIRVASEEGASHVSHGATGKGNDQIRFELASYALCPQVEVVSPWRLPEFYERFAGRQALFEYAKAHNIPLPVTPKSPWSMDGNLMHISYESGILEDPKVEAPQDLCTMTKSPAEA-PDQAARISIRFEQGIPVKVTNLTTGEEITGSLELYTYLNKIGGEHGIGRVDIVENRFIGMKSRGVYETPAGTILRQAHIDIEVLTMDRELRRIKQRLALDFGEQVYRGFWFSPECKFLRDCIKRSQERVSGTVQLSLFKGGVHVTARDSEFSLYNQELVSMDVQGNYEPRDAEGFIRINALRLREYHRLQ 409          
BLAST of Argininosuccinate synthase vs. TrEMBL
Match: A0A267GHP4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018132g2 PE=3 SV=1)

HSP 1 Score: 611.298 bits (1575), Expect = 0.000e+0
Identity = 285/404 (70.54%), Postives = 339/404 (83.91%), Query Frame = 3
Query:   96 KKKVILAYSGGLDTSCILVWLQEKGYDVIAYLADVGQEEDFEAAKKKALSLGAVKFFCLDLKLAFVEEYIFKAIQANAIYEDRYLLGTSLARPIIAKGMIEIAKQEGCKYLSHGATGKGNDQIRFELACYALYPDIEIISPWKIPEFYNRFKGRQDLFEYAKVHNIPLPITKSEPWSMDSNLMHISYESGILENPSNEAP-DLYQMTKDPVTASPDQPEKLKIHFHKGVPVEVENLTNSKTVKGSLDLYQYLNEIGGLHGIGRIDIVENRVIGMKSRGIYETPAGTILYHAHLDIENLTMDRELRKIKQRLCIDFGEQIYYGMWFSPECDFLRNSIEYSQKCVTGTVTIKLFKGQVYILARQSPHSLYNEELVSMDVQGKYEPTDAAGFIKINALRLQEYHRIR 1304
            KKK++LAYSGGLDTSCILVWL E+GYDVIA+ ADVGQ++DFEAAK+KALSLGA+K+ CLDL+  FV+ YIF A+QA+AIYEDRYLLGT+LARP IA G+I +A +EG  ++SHGATGKGNDQIRFELA YAL P +E++SPW++PEFY RF GRQ LFEYAK HNIPLP+T   PWSMD NLMHISYESGILE+P  EAP DL  MTK P  A PDQ  ++ I F +G+PV+V+NLT  + + GSL+LY YLN+IGG HGIGR+DIVENR IGMKSRG+YETPAGTIL  AH+DIE LTMDRELR+IKQRL +DFGEQ+Y G WFSPEC FLR+ I+ SQ+ V+GTV + LFKG V++ AR S  SLYN+ELVSMDVQG YEP DA GFI+INALRL+EYHR++
Sbjct:    7 KKKIVLAYSGGLDTSCILVWLIEQGYDVIAFTADVGQDDDFEAAKQKALSLGAIKYVCLDLRRDFVDNYIFPAVQADAIYEDRYLLGTALARPCIASGIIRVASEEGASHVSHGATGKGNDQIRFELASYALCPQVEVVSPWRLPEFYERFAGRQALFEYAKAHNIPLPVTPKSPWSMDGNLMHISYESGILEDPKVEAPQDLCTMTKSPAEA-PDQAVRISIRFEQGIPVKVKNLTTGEEITGSLELYTYLNKIGGEHGIGRVDIVENRFIGMKSRGVYETPAGTILRQAHIDIEVLTMDRELRRIKQRLALDFGEQVYRGFWFSPECKFLRDCIKRSQERVSGTVQLSLFKGGVHVTARDSEFSLYNQELVSMDVQGNYEPRDAEGFIRINALRLREYHRLQ 409          
BLAST of Argininosuccinate synthase vs. TrEMBL
Match: A0A1S3H2S6 (argininosuccinate synthase-like OS=Lingula unguis OX=7574 GN=LOC106151499 PE=3 SV=1)

HSP 1 Score: 598.201 bits (1541), Expect = 0.000e+0
Identity = 272/407 (66.83%), Postives = 341/407 (83.78%), Query Frame = 3
Query:   87 LTGKKKVILAYSGGLDTSCILVWLQEKGYDVIAYLADVGQEEDFEAAKKKALSLGAVKFFCLDLKLAFVEEYIFKAIQANAIYEDRYLLGTSLARPIIAKGMIEIAKQEGCKYLSHGATGKGNDQIRFELACYALYPDIEIISPWKIPEFYNRFKGRQDLFEYAKVHNIPLPITKSEPWSMDSNLMHISYESGILENPSNEAP-DLYQMTKDPVTASPDQPEKLKIHFHKGVPVEVENLTNSKTVKGSLDLYQYLNEIGGLHGIGRIDIVENRVIGMKSRGIYETPAGTILYHAHLDIENLTMDRELRKIKQRLCIDFGEQIYYGMWFSPECDFLRNSIEYSQKCVTGTVTIKLFKGQVYILARQSPHSLYNEELVSMDVQGKYEPTDAAGFIKINALRLQEYHRIR 1304
            ++  K V+LAYSGGLDTSCILVWL+++G++V+ Y+A+VGQ+EDFEAA+KKA+ LGA KF CLD++  FVEE+I+  +QANA+YEDRYL+GTS ARP IA+GM+++ K+EG  Y++HGATGKGNDQIRFEL+CYALYP +++I+PW++PEFY +F+GRQDLFE+AK +NIPLP+T   PWSMD+NLMHIS+ESGILE+P  EAP DLY MT DP  A P+QP +L+I F  GVPV+V+NL +   V  +L+LY YLN++GG HGIGRIDIVENR IGMKSRGIYETP GTIL+ AH+DIE  TMDRELRKIKQ L   F + +Y G W SPEC+F+R+ I+ SQ+CV GTVT+ L+KG +YIL R+SP SLYNEELVSMDVQG Y+P DA GFIK+NALRLQEYHR+R
Sbjct:    1 MSENKIVVLAYSGGLDTSCILVWLKQRGFEVVTYMANVGQDEDFEAAEKKAMMLGAKKFVCLDVRREFVEEFIWPGVQANAVYEDRYLMGTSFARPCIARGMVKVCKEEGAGYIAHGATGKGNDQIRFELSCYALYPQVKVIAPWRMPEFYEKFRGRQDLFEFAKENNIPLPVTPKSPWSMDANLMHISFESGILEDPKAEAPKDLYLMTTDPKDA-PEQPLRLEIDFKHGVPVKVKNLEDGTVVTSALELYLYLNKVGGSHGIGRIDIVENRFIGMKSRGIYETPGGTILFQAHMDIEVFTMDRELRKIKQSLSSKFSDMVYRGFWDSPECEFVRHCIDKSQECVEGTVTLALYKGGIYILGRESPLSLYNEELVSMDVQGNYDPIDAGGFIKVNALRLQEYHRLR 406          
BLAST of Argininosuccinate synthase vs. TrEMBL
Match: A0A1S3JTS4 (argininosuccinate synthase OS=Lingula unguis OX=7574 GN=LOC106176073 PE=3 SV=1)

HSP 1 Score: 596.66 bits (1537), Expect = 0.000e+0
Identity = 271/407 (66.58%), Postives = 341/407 (83.78%), Query Frame = 3
Query:   87 LTGKKKVILAYSGGLDTSCILVWLQEKGYDVIAYLADVGQEEDFEAAKKKALSLGAVKFFCLDLKLAFVEEYIFKAIQANAIYEDRYLLGTSLARPIIAKGMIEIAKQEGCKYLSHGATGKGNDQIRFELACYALYPDIEIISPWKIPEFYNRFKGRQDLFEYAKVHNIPLPITKSEPWSMDSNLMHISYESGILENPSNEAP-DLYQMTKDPVTASPDQPEKLKIHFHKGVPVEVENLTNSKTVKGSLDLYQYLNEIGGLHGIGRIDIVENRVIGMKSRGIYETPAGTILYHAHLDIENLTMDRELRKIKQRLCIDFGEQIYYGMWFSPECDFLRNSIEYSQKCVTGTVTIKLFKGQVYILARQSPHSLYNEELVSMDVQGKYEPTDAAGFIKINALRLQEYHRIR 1304
            ++  K V+LAYSGGLDTSCILVWL+++G++V+ Y+A+VGQ+EDFEAA+KKA+ LGA KF CLD++  FVEE+I+  ++ANA+YEDRYL+GTS ARP IA+GM+++ K+EG  Y++HGATGKGNDQIRFEL+CYALYP +++I+PW++PEFY +F+GRQDLFE+AK +NIPLP+T   PWSMD+NLMHIS+ESGILE+P  EAP DLY MT DP  A P+QP +L+I F  GVPV+V+NL +   V  +L+LY YLN++GG HGIGRIDIVENR IGMKSRGIYETP GTIL+ AH+DIE  TMDRELRKIKQ L   F + +Y G W SPEC+F+R+ I+ SQ+CV GTVT+ L+KG +YIL R+SP SLYNEELVSMDVQG Y+P DA GFIK+NALRLQEYHR+R
Sbjct:    1 MSENKIVVLAYSGGLDTSCILVWLKQRGFEVVTYMANVGQDEDFEAAEKKAMMLGAKKFVCLDVRREFVEEFIWPGVKANAVYEDRYLMGTSFARPCIARGMVKVCKEEGAGYIAHGATGKGNDQIRFELSCYALYPQVKVIAPWRMPEFYEKFRGRQDLFEFAKENNIPLPVTPKSPWSMDANLMHISFESGILEDPKAEAPKDLYLMTTDPKDA-PEQPLRLEIDFKHGVPVKVKNLEDGTVVTSALELYLYLNKVGGSHGIGRIDIVENRFIGMKSRGIYETPGGTILFQAHMDIEVFTMDRELRKIKQSLSSKFSDMVYRGFWDSPECEFVRHCIDKSQECVEGTVTLALYKGGIYILGRESPLSLYNEELVSMDVQGNYDPIDAGGFIKVNALRLQEYHRLR 406          
BLAST of Argininosuccinate synthase vs. TrEMBL
Match: A0A5N5JSY1 (Uncharacterized protein OS=Pangasianodon hypophthalmus OX=310915 GN=PHYPO_G00157880 PE=4 SV=1)

HSP 1 Score: 596.275 bits (1536), Expect = 0.000e+0
Identity = 277/424 (65.33%), Postives = 345/424 (81.37%), Query Frame = 3
Query:   36 INLFVIYFICIFNAIMTLTGKKKVILAYSGGLDTSCILVWLQEKGYDVIAYLADVGQEEDFEAAKKKALSLGAVKFFCLDLKLAFVEEYIFKAIQANAIYEDRYLLGTSLARPIIAKGMIEIAKQEGCKYLSHGATGKGNDQIRFELACYALYPDIEIISPWKIPEFYNRFKGRQDLFEYAKVHNIPLPITKSEPWSMDSNLMHISYESGILENPSNEAP-DLYQMTKDPVTASPDQPEKLKIHFHKGVPVEVENLTNSKTVKGSLDLYQYLNEIGGLHGIGRIDIVENRVIGMKSRGIYETPAGTILYHAHLDIENLTMDRELRKIKQRLCIDFGEQIYYGMWFSPECDFLRNSIEYSQKCVTGTVTIKLFKGQVYILARQSPHSLYNEELVSMDVQGKYEPTDAAGFIKINALRLQEYHRIR 1304
            I + + YF  I+   +    K  V+LAYSGGLDTSCILVWL+E+GYDVIAYLA++GQEEDF+AA+KKA +LGA K F  DL+  FV+E+I+  +QANAIYEDRYLLGTS+ARP IA+  ++IA+QEG +Y+SHGATGKGNDQ+RFEL CYALYP+++IISPW+IPEFYNRF+GR+DL EYA+ H IP+P+T   PWSMD+NLMHISYESGILENP N AP DLY MTK+P   SP+ P+ L+I F KGVPV+V +L   ++    L+++ YLNE+GG HG+GRIDIVENR +GMKSRGIYETP GTILYHAHLDIE  TMDRE+R+IKQ L + F E +Y G W+SPEC+F+R+ I  SQ+ V G V + +FKG VYIL R+SP SLYNEELVSMDVQG Y+P+DA GFIKINA+RL+E+HR++
Sbjct:   23 ICILIAYFSSIWVPKVEKMSKGTVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQEEDFDAARKKAENLGAKKVFIEDLRAEFVQEFIWTMVQANAIYEDRYLLGTSIARPCIARRQVQIARQEGAQYVSHGATGKGNDQVRFELTCYALYPEVKIISPWRIPEFYNRFRGRKDLMEYAEKHGIPIPVTPKAPWSMDANLMHISYESGILENPKNHAPTDLYLMTKNP-EDSPNTPDVLEIEFSKGVPVKVSHLKEGRSKDTPLEIFSYLNEVGGKHGVGRIDIVENRFVGMKSRGIYETPGGTILYHAHLDIEAFTMDREVRRIKQGLGVKFSELLYNGFWYSPECEFVRHCIAKSQENVEGKVQLSVFKGHVYILGRESPKSLYNEELVSMDVQGDYDPSDATGFIKINAVRLREHHRLQ 445          
BLAST of Argininosuccinate synthase vs. Ensembl Cavefish
Match: ASS1 (argininosuccinate synthase 1 [Source:NCBI gene;Acc:103037508])

HSP 1 Score: 592.808 bits (1527), Expect = 0.000e+0
Identity = 276/412 (66.99%), Postives = 343/412 (83.25%), Query Frame = 3
Query:   72 NAIMTLTGKKKVILAYSGGLDTSCILVWLQEKGYDVIAYLADVGQEEDFEAAKKKALSLGAVKFFCLDLKLAFVEEYIFKAIQANAIYEDRYLLGTSLARPIIAKGMIEIAKQEGCKYLSHGATGKGNDQIRFELACYALYPDIEIISPWKIPEFYNRFKGRQDLFEYAKVHNIPLPITKSEPWSMDSNLMHISYESGILENPSNEAP-DLYQMTKDPVTASPDQPEKLKIHFHKGVPVEVENLTNSKTVKGSLDLYQYLNEIGGLHGIGRIDIVENRVIGMKSRGIYETPAGTILYHAHLDIENLTMDRELRKIKQRLCIDFGEQIYYGMWFSPECDFLRNSIEYSQKCVTGTVTIKLFKGQVYILARQSPHSLYNEELVSMDVQGKYEPTDAAGFIKINALRLQEYHRIR 1304
             ++  ++ K  V+LAYSGGLDTSCILVWL+E+GYDVI YLA++GQ+EDFEAA+KKA SLGA K F  DL+  FVEE+I+ ++QANA+YEDRYLLGTS+ARP IA+  ++IA+QEG +++SHGATGKGNDQIRFEL CYALYP+++II+PW+IPEFYNRF+GR+DL EYA+ H IP+P+T   PWSMD+NLMHISYESGILENP + AP DLY MTK+P  A P+ P++L+I F KGVPV+V +L   KT    LD++ YLNE+GG HGIGRIDIVENR IGMKSRGIYETP GTILYHAHLDIE  TMDRE+R+IKQ L I F E +Y G W+SPEC+F+R+ I+ SQ+ V G V + +FKG VYIL R+SP SLYNEELVSMDVQG Y+P DA+GFI+INA+RL+E+HR++
Sbjct:   30 TSLEKMSSKGTVVLAYSGGLDTSCILVWLKEQGYDVITYLANIGQDEDFEAARKKAESLGAKKVFIDDLRSEFVEEFIWPSVQANAMYEDRYLLGTSIARPCIARRQVQIARQEGAQFVSHGATGKGNDQIRFELTCYALYPEVKIIAPWRIPEFYNRFRGRKDLMEYAEKHGIPVPVTPKAPWSMDANLMHISYESGILENPKSHAPSDLYLMTKNPEDA-PNTPDELEIEFKKGVPVKVTHLKEGKTKDTPLDIFCYLNEVGGKHGIGRIDIVENRFIGMKSRGIYETPGGTILYHAHLDIETFTMDREVRRIKQGLGIKFSELLYNGFWYSPECEFVRHCIDKSQENVEGKVQLSVFKGHVYILGRESPSSLYNEELVSMDVQGDYDPCDASGFIRINAVRLREHHRLQ 440          
BLAST of Argininosuccinate synthase vs. Ensembl Cavefish
Match: ASS1 (argininosuccinate synthase 1 [Source:NCBI gene;Acc:103037508])

HSP 1 Score: 520.005 bits (1338), Expect = 0.000e+0
Identity = 252/406 (62.07%), Postives = 313/406 (77.09%), Query Frame = 3
Query:   87 LTGKKKVILAYSGGLDTSCILVWLQEKGYDVIAYLADVGQEEDFEAAKKKALSLGAVKFFCLDLKLAFVEEYIFKAIQANAIYEDRYLLGTSLARPIIAKGMIEIAKQEGCKYLSHGATGKGNDQIRFELACYALYPDIEIISPWKIPEFYNRFKGRQDLFEYAKVHNIPLPITKSEPWSMDSNLMHISYESGILENPSNEAPDLYQMTKDPVTASPDQPEKLKIHFHKGVPVEVENLTNSKTVKGSLDLYQYLNEIGGLHGIGRIDIVENRVIGMKSRGIYETPAGTILYHAHLDIENLTMDRELRKIKQRLCIDFGEQIYYGMWFSPECDFLRNSIEYSQKCVTGTVTIKLFKGQVYILARQSPHSLYNEELVSMDVQGKYEPTDAAGFIKINALRLQEYHRIR 1304
            ++ K  V+LAYSGGLDTSCILVWL+E+GYDVI YLA++GQ+EDFEAA+KKA SLGA K F  DL+  FVEE+I+ ++QANA+YEDRYLLGTS+ARP IA+  ++IA+QEG +++SHGATGKGNDQIRFEL CYALYP+++II+PW+IPEFYNRF+GR+DL EYA+ H                              PS    DLY MTK+P  A P+ P++L+I F KGVPV+V +L   KT    LD++ YLNE+GG HGIGRIDIVENR IGMKSRGIYETP GTILYHAHLDIE  TMDRE+R+IKQ L I F E +Y G W+SPEC+F+R+ I+ SQ+ V G V + +FKG VYIL R+SP SLYNEELVSMDVQG Y+P DA+GFI+INA+RL+E+HR++
Sbjct:    1 MSSKGTVVLAYSGGLDTSCILVWLKEQGYDVITYLANIGQDEDFEAARKKAESLGAKKVFIDDLRSEFVEEFIWPSVQANAMYEDRYLLGTSIARPCIARRQVQIARQEGAQFVSHGATGKGNDQIRFELTCYALYPEVKIIAPWRIPEFYNRFRGRKDLMEYAESHA-----------------------------PS----DLYLMTKNPEDA-PNTPDELEIEFKKGVPVKVTHLKEGKTKDTPLDIFCYLNEVGGKHGIGRIDIVENRFIGMKSRGIYETPGGTILYHAHLDIETFTMDREVRRIKQGLGIKFSELLYNGFWYSPECEFVRHCIDKSQENVEGKVQLSVFKGHVYILGRESPSSLYNEELVSMDVQGDYDPCDASGFIRINAVRLREHHRLQ 372          
BLAST of Argininosuccinate synthase vs. Ensembl Yeast
Match: ARG1 (Arginosuccinate synthetase; catalyzes the formation of L-argininosuccinate from citrulline and L-aspartate in the arginine biosynthesis pathway; potential Cdc28p substrate [Source:SGD;Acc:S000005419])

HSP 1 Score: 433.335 bits (1113), Expect = 1.945e-150
Identity = 209/407 (51.35%), Postives = 292/407 (71.74%), Query Frame = 3
Query:   96 KKKVILAYSGGLDTSCILVWLQEKGYDVIAYLADVGQEEDFEAAKKKALSLGAVKFFCLDLKLAFVEEYIFKAIQANAIYEDRYLLGTSLARPIIAKGMIEIAKQEGCKYLSHGATGKGNDQIRFELACYALYPDIEIISPWKIPEFYNRFKGRQDLFEYAKVHNIPLPITKSEPWSMDSNLMHISYESGILENPSNEAP-DLYQMTKDPVTASPDQPEKLKIHFHKGVPVEVENLTNSKT-----VKGSLDLYQYLNEIGGLHGIGRIDIVENRVIGMKSRGIYETPAGTILYHAHLDIENLTMDRELRKIKQRLCI-DFGEQIYYGMWFSPECDFLRNSIEYSQKCVTGTVTIKLFKGQVYILARQS-PHSLYNEELVSMDVQGKYEPTDAAGFIKINALRLQEY 1292
            K KV LAYSGGLDTS IL WL ++GY+V+A++A+VGQEEDF+AAK+KAL +GA KF C+D +  FV++ +F A+Q NA+YED YLLGTSLARP+IAK  I++AKQEGC  +SHG TGKGNDQIRFEL+ YAL PD++ I+PW++PEF+ RF GR+DL +YA    IP+  TK++PWS D N  HISYE+GILE+P    P D++++  DP+ A PDQP+ L I F +G+PV++   T++KT     V   LD++   + +   +G+GRIDIVE+R I +KSRG YE    T+L  AH+D+E LT+D+E+R+++      ++   IY G +F+PEC+++R+ I+ SQ  V GTV ++L+KG V IL R +    LY+    SMD    + PTD  GFI I A+R+++Y
Sbjct:    3 KGKVCLAYSGGLDTSVILAWLLDQGYEVVAFMANVGQEEDFDAAKEKALKIGACKFVCVDCREDFVKDILFPAVQVNAVYEDVYLLGTSLARPVIAKAQIDVAKQEGCFAVSHGCTGKGNDQIRFELSFYALKPDVKCITPWRMPEFFERFAGRKDLLDYAAQKGIPVAQTKAKPWSTDENQAHISYEAGILEDPDTTPPKDMWKLIVDPMDA-PDQPQDLTIDFERGLPVKL-TYTDNKTSKEVSVTKPLDVFLAASNLARANGVGRIDIVEDRYINLKSRGCYEQAPLTVLRKAHVDLEGLTLDKEVRQLRDSFVTPNYSRLIYNGSYFTPECEYIRSMIQPSQNSVNGTVRVRLYKGNVIILGRSTKTEKLYDPTESSMDELTGFLPTDTTGFIAIQAIRIKKY 407          
BLAST of Argininosuccinate synthase vs. Ensembl Nematostella
Match: EDO33307 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSL8])

HSP 1 Score: 538.11 bits (1385), Expect = 0.000e+0
Identity = 258/397 (64.99%), Postives = 310/397 (78.09%), Query Frame = 3
Query:   93 GKKKVILAYSGGLDTSCILVWLQEKGYDVIAYLADVGQEEDFEAAKKKALSLGAVKFFCLDLKLAFVEEYIFKAIQANAIYEDRYLLGTSLARPIIAKGMIEIAKQEGCKYLSHGATGKGNDQIRFELACYALYPDIEIISPWKIPEFYNRFKGRQDLFEYAKVHNIPLPITKSEPWSMDSNLMHISYESGILENPSNEAP-DLYQMTKDPVTASPDQPEKLKIHFHKGVPVEVENLTNSKTVKGSLDLYQYLNEIGGLHGIGRIDIVENRVIGMKSRGIYETPAGTILYHAHLDIENLTMDRELRKIKQRLCIDFGEQIYYGMWFSPECDFLRNSIEYSQKCVTGTVTIKLFKGQVYILARQSPHSLYNEELVSMDVQGKYEPTDAAGFIKINALR 1280
            G+K  +LAYSGGLDTSCILVWLQE+GYDVIAYLAD+GQ EDFEAA++KA  LGA K +  DLK  FV ++IF ++QANAIYEDRYLLGT++ARP IAK  IEIA +EG ++++HGATGKGNDQ+RFEL  YAL+P +  ISPW++PEF+ +FKGR++LFEYAK H+IPLP+T   PWSMD+NLMHISYE+GILENP  +AP D+Y MTK+P+T SPD+P  L I F  G+PV V N  +         +YQYLN IGG HG+GRIDIVENR +GMKSRGIYE PAG IL  AHLDIE  T+DRELRKIKQ L   F E +Y G W+SPE DF+R  I  SQ+ V G VT+ + KG VYI AR+S  SLY E+LVSMD +G Y+P DAAGFIKINALR
Sbjct:    6 GRKTCVLAYSGGLDTSCILVWLQEQGYDVIAYLADIGQTEDFEAAREKAKKLGAKKVYIEDLKEEFVTDFIFPSLQANAIYEDRYLLGTAIARPCIAKRQIEIALKEGAQFVTHGATGKGNDQVRFELTYYALFPGVRTISPWRMPEFFEKFKGRKELFEYAKAHDIPLPVTPKNPWSMDANLMHISYEAGILENPKTQAPEDIYLMTKNPIT-SPDKPALLDIEFKNGIPVRVTNKKDGTVKDSPFAIYQYLNTIGGEHGVGRIDIVENRFVGMKSRGIYECPAGEILRAAHLDIETFTLDRELRKIKQSLSSKFSELVYNGFWYSPEGDFVRFCINKSQENVEGVVTLAVSKGHVYIKARESNASLYCEKLVSMDEKGDYDPGDAAGFIKINALR 401          
BLAST of Argininosuccinate synthase vs. Ensembl Medaka
Match: ASS1 (argininosuccinate synthase 1 [Source:NCBI gene;Acc:101159031])

HSP 1 Score: 578.556 bits (1490), Expect = 0.000e+0
Identity = 267/404 (66.09%), Postives = 335/404 (82.92%), Query Frame = 3
Query:   96 KKKVILAYSGGLDTSCILVWLQEKGYDVIAYLADVGQEEDFEAAKKKALSLGAVKFFCLDLKLAFVEEYIFKAIQANAIYEDRYLLGTSLARPIIAKGMIEIAKQEGCKYLSHGATGKGNDQIRFELACYALYPDIEIISPWKIPEFYNRFKGRQDLFEYAKVHNIPLPITKSEPWSMDSNLMHISYESGILENPSNEA-PDLYQMTKDPVTASPDQPEKLKIHFHKGVPVEVENLTNSKTVKGSLDLYQYLNEIGGLHGIGRIDIVENRVIGMKSRGIYETPAGTILYHAHLDIENLTMDRELRKIKQRLCIDFGEQIYYGMWFSPECDFLRNSIEYSQKCVTGTVTIKLFKGQVYILARQSPHSLYNEELVSMDVQGKYEPTDAAGFIKINALRLQEYHRIR 1304
            K  V+LAYSGGLDTSCILVWL+E+GYDVI YLA++GQ+EDFEAA+KKA SLGA K F  DL+  FVE++I+ ++QANA+YEDRYL+GT++ARP IA+  +EIA++EG +++SHGATGKGNDQIRFEL CYALYP+++II+PW+IPEFYNRF+GR+DL EYA+   IP+P+T   PWSMD+NLMHISYESGILENP ++A PDLY MTK+P   SP+ P+ L++ F  GVP++V N TN  +    L+++ YLNEIGG HG+GRIDIVENR IGMKSRGIYETP GTIL  AHLDIE  TMD+E+R+IKQ L I F E +Y G W+SPECDF+R+ I  SQ+ V G V + +FKGQVYIL R+SP SLYNEELVSMDVQG Y+P DA+GFI+INA+RL+E+HR++
Sbjct:    3 KGTVVLAYSGGLDTSCILVWLKEQGYDVITYLANIGQDEDFEAARKKAESLGAKKIFIEDLRKEFVEDFIWPSVQANAVYEDRYLMGTAIARPCIARRQVEIARKEGAQFVSHGATGKGNDQIRFELTCYALYPEVKIIAPWRIPEFYNRFRGRKDLMEYAQKFGIPVPVTPKAPWSMDANLMHISYESGILENPKSQAPPDLYLMTKNPAD-SPNDPDVLEMEFRNGVPIKVTNETNGISKNAPLEIFSYLNEIGGKHGVGRIDIVENRFIGMKSRGIYETPGGTILLKAHLDIETFTMDKEVRRIKQGLGIKFSELVYNGFWYSPECDFVRHCIAKSQENVEGKVQLSVFKGQVYILGRESPKSLYNEELVSMDVQGDYDPCDASGFIRINAVRLREHHRLQ 405          
BLAST of Argininosuccinate synthase vs. Ensembl Medaka
Match: ASS1 (argininosuccinate synthase 1 [Source:NCBI gene;Acc:101159031])

HSP 1 Score: 512.301 bits (1318), Expect = 0.000e+0
Identity = 243/406 (59.85%), Postives = 307/406 (75.62%), Query Frame = 3
Query:   87 LTGKKKVILAYSGGLDTSCILVWLQEKGYDVIAYLADVGQEEDFEAAKKKALSLGAVKFFCLDLKLAFVEEYIFKAIQANAIYEDRYLLGTSLARPIIAKGMIEIAKQEGCKYLSHGATGKGNDQIRFELACYALYPDIEIISPWKIPEFYNRFKGRQDLFEYAKVHNIPLPITKSEPWSMDSNLMHISYESGILENPSNEAPDLYQMTKDPVTASPDQPEKLKIHFHKGVPVEVENLTNSKTVKGSLDLYQYLNEIGGLHGIGRIDIVENRVIGMKSRGIYETPAGTILYHAHLDIENLTMDRELRKIKQRLCIDFGEQIYYGMWFSPECDFLRNSIEYSQKCVTGTVTIKLFKGQVYILARQSPHSLYNEELVSMDVQGKYEPTDAAGFIKINALRLQEYHRIR 1304
            +  K  V+LAYSGGLDTSCILVWL+E+GYDVI YLA++GQ+EDFEAA+KKA SLGA K F  DL+  FVE++I+ ++QANA+YEDRYL+GT++ARP IA+  +EIA++EG +++SHGATGKGNDQIRFEL CYALYP+++II+PW+IPEFYNRF+GR+DL EYA+                                 S   PDLY MTK+P   SP+ P+ L++ F  GVP++V N TN  +    L+++ YLNEIGG HG+GRIDIVENR IGMKSRGIYETP GTIL  AHLDIE  TMD+E+R+IKQ L I F E +Y G W+SPECDF+R+ I  SQ+ V G V + +FKGQVYIL R+SP SLYNEELVSMDVQG Y+P DA+GFI+INA+RL+E+HR++
Sbjct:    1 IMSKGTVVLAYSGGLDTSCILVWLKEQGYDVITYLANIGQDEDFEAARKKAESLGAKKIFIEDLRKEFVEDFIWPSVQANAVYEDRYLMGTAIARPCIARRQVEIARKEGAQFVSHGATGKGNDQIRFELTCYALYPEVKIIAPWRIPEFYNRFRGRKDLMEYAQ---------------------------------SQAPPDLYLMTKNPAD-SPNDPDVLEMEFRNGVPIKVTNETNGISKNAPLEIFSYLNEIGGKHGVGRIDIVENRFIGMKSRGIYETPGGTILLKAHLDIETFTMDKEVRRIKQGLGIKFSELVYNGFWYSPECDFVRHCIAKSQENVEGKVQLSVFKGQVYILGRESPKSLYNEELVSMDVQGDYDPCDASGFIRINAVRLREHHRLQ 372          
BLAST of Argininosuccinate synthase vs. Planmine SMEST
Match: SMESG000053053.1 (SMESG000053053.1)

HSP 1 Score: 478.789 bits (1231), Expect = 1.552e-170
Identity = 229/229 (100.00%), Postives = 229/229 (100.00%), Query Frame = 3
Query:  627 MDSNLMHISYESGILENPSNEAPDLYQMTKDPVTASPDQPEKLKIHFHKGVPVEVENLTNSKTVKGSLDLYQYLNEIGGLHGIGRIDIVENRVIGMKSRGIYETPAGTILYHAHLDIENLTMDRELRKIKQRLCIDFGEQIYYGMWFSPECDFLRNSIEYSQKCVTGTVTIKLFKGQVYILARQSPHSLYNEELVSMDVQGKYEPTDAAGFIKINALRLQEYHRIRHLI 1313
            MDSNLMHISYESGILENPSNEAPDLYQMTKDPVTASPDQPEKLKIHFHKGVPVEVENLTNSKTVKGSLDLYQYLNEIGGLHGIGRIDIVENRVIGMKSRGIYETPAGTILYHAHLDIENLTMDRELRKIKQRLCIDFGEQIYYGMWFSPECDFLRNSIEYSQKCVTGTVTIKLFKGQVYILARQSPHSLYNEELVSMDVQGKYEPTDAAGFIKINALRLQEYHRIRHLI
Sbjct:    1 MDSNLMHISYESGILENPSNEAPDLYQMTKDPVTASPDQPEKLKIHFHKGVPVEVENLTNSKTVKGSLDLYQYLNEIGGLHGIGRIDIVENRVIGMKSRGIYETPAGTILYHAHLDIENLTMDRELRKIKQRLCIDFGEQIYYGMWFSPECDFLRNSIEYSQKCVTGTVTIKLFKGQVYILARQSPHSLYNEELVSMDVQGKYEPTDAAGFIKINALRLQEYHRIRHLI 229          
BLAST of Argininosuccinate synthase vs. Planmine SMEST
Match: SMESG000053052.1 (SMESG000053052.1)

HSP 1 Score: 249.21 bits (635), Expect = 9.044e-82
Identity = 125/132 (94.70%), Postives = 128/132 (96.97%), Query Frame = 3
Query:   81 MTLTGKKKVILAYSGGLDTSCILVWLQEKGYDVIAYLADVGQEEDFEAAKKKALSLGAVKFFCLDLKLAFVEEYIFKAIQANAIYEDRYLLGTSLARPIIAKGMIEIAKQEGCKYLSHGATGKGNDQIRFEL 476
            MTLTGKKKVILAYSGGLDTSCILVWLQEKGYDVIAYLADVGQEEDFEAAKKKALSLGAVKFFCLDLKLAFVEEYIFKAIQANAIYEDRYLLGTSLARPIIAKGMIEIAKQEGCKYLSHGATGK  + I+ +L
Sbjct:    1 MTLTGKKKVILAYSGGLDTSCILVWLQEKGYDVIAYLADVGQEEDFEAAKKKALSLGAVKFFCLDLKLAFVEEYIFKAIQANAIYEDRYLLGTSLARPIIAKGMIEIAKQEGCKYLSHGATGK--EMIKLDL 130          
The following BLAST results are available for this feature:
BLAST of Argininosuccinate synthase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ASS10.000e+067.57argininosuccinate synthase 1 [Source:HGNC Symbol;A... [more]
ASS10.000e+067.57argininosuccinate synthase 1 [Source:HGNC Symbol;A... [more]
ASS10.000e+067.57argininosuccinate synthase 1 [Source:HGNC Symbol;A... [more]
ASS11.123e-9870.71argininosuccinate synthase 1 [Source:HGNC Symbol;A... [more]
ASS13.211e-8264.14argininosuccinate synthase 1 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Argininosuccinate synthase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Argininosuccinate synthase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Ass8.749e-15954.07gene:FBgn0026565 transcript:FBtr0081699[more]
Ass8.749e-15954.07gene:FBgn0026565 transcript:FBtr0337022[more]
back to top
BLAST of Argininosuccinate synthase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ASS11.549e-11367.23argininosuccinate synthase 1 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Argininosuccinate synthase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ass10.000e+068.32argininosuccinate synthase 1 [Source:NCBI gene;Acc... [more]
ass10.000e+068.69argininosuccinate synthase 1 [Source:NCBI gene;Acc... [more]
ass10.000e+064.85argininosuccinate synthase 1 [Source:NCBI gene;Acc... [more]
ass10.000e+064.59argininosuccinate synthase 1 [Source:NCBI gene;Acc... [more]
ass15.277e-16057.97argininosuccinate synthase 1 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Argininosuccinate synthase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Ass10.000e+067.32argininosuccinate synthetase 1 [Source:MGI Symbol;... [more]
back to top
BLAST of Argininosuccinate synthase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7ZWM4|ASSY_XENLA0.000e+069.06Argininosuccinate synthase OS=Xenopus laevis OX=83... [more]
sp|Q5M8Z6|ASSY_XENTR0.000e+068.32Argininosuccinate synthase OS=Xenopus tropicalis O... [more]
sp|Q66I24|ASSY_DANRE0.000e+067.82Argininosuccinate synthase OS=Danio rerio OX=7955 ... [more]
sp|Q5ZJ23|ASSY_CHICK0.000e+065.10Argininosuccinate synthase OS=Gallus gallus OX=903... [more]
sp|P09034|ASSY_RAT0.000e+067.57Argininosuccinate synthase OS=Rattus norvegicus OX... [more]
back to top
BLAST of Argininosuccinate synthase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8GT520.000e+070.54Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GHP40.000e+070.54Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1S3H2S60.000e+066.83argininosuccinate synthase-like OS=Lingula unguis ... [more]
A0A1S3JTS40.000e+066.58argininosuccinate synthase OS=Lingula unguis OX=75... [more]
A0A5N5JSY10.000e+065.33Uncharacterized protein OS=Pangasianodon hypophtha... [more]
back to top
BLAST of Argininosuccinate synthase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ASS10.000e+066.99argininosuccinate synthase 1 [Source:NCBI gene;Acc... [more]
ASS10.000e+062.07argininosuccinate synthase 1 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Argininosuccinate synthase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Argininosuccinate synthase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ARG11.945e-15051.35Arginosuccinate synthetase; catalyzes the formatio... [more]
back to top
BLAST of Argininosuccinate synthase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO333070.000e+064.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Argininosuccinate synthase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ASS10.000e+066.09argininosuccinate synthase 1 [Source:NCBI gene;Acc... [more]
ASS10.000e+059.85argininosuccinate synthase 1 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Argininosuccinate synthase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000053053.11.552e-170100.00SMESG000053053.1[more]
SMESG000053052.19.044e-8294.70SMESG000053052.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011140 ID=SMED30011140|Name=Argininosuccinate synthase|organism=Schmidtea mediterranea sexual|type=transcript|length=1392bp
CAATATCAAGGTCATTGAAATGAAATATTTAAGAAATAAATTTATTTGTC
ATTTATTTTATTTGCATTTTCAACGCAATCATGACACTTACTGGAAAGAA
AAAAGTTATTCTAGCCTATAGTGGAGGACTTGACACATCCTGCATTTTGG
TGTGGTTGCAAGAGAAAGGTTATGACGTAATCGCATATCTGGCAGATGTC
GGCCAAGAAGAAGACTTTGAAGCTGCAAAGAAAAAAGCTTTATCATTAGG
AGCTGTTAAGTTTTTCTGCCTCGATCTAAAACTGGCTTTCGTTGAAGAAT
ATATATTTAAGGCAATTCAAGCAAATGCAATTTATGAAGATCGCTATTTA
TTAGGCACATCCCTGGCCAGACCTATAATTGCCAAAGGTATGATAGAGAT
AGCAAAACAGGAAGGATGTAAATATCTCAGCCACGGAGCGACAGGGAAAG
GAAATGATCAAATTAGATTTGAATTAGCTTGCTATGCTCTTTATCCTGAT
ATTGAAATTATCAGTCCTTGGAAAATACCCGAGTTTTATAATCGTTTCAA
AGGTAGACAAGACCTCTTTGAATATGCTAAGGTTCATAATATCCCTCTCC
CAATCACGAAATCAGAGCCATGGAGCATGGATAGCAATCTCATGCATATT
AGTTATGAATCTGGAATTCTTGAAAATCCAAGTAATGAGGCTCCGGATCT
TTATCAAATGACTAAAGATCCGGTTACGGCTAGTCCTGACCAACCTGAGA
AATTAAAAATTCATTTTCACAAAGGCGTTCCAGTAGAAGTGGAAAATTTA
ACCAATTCCAAAACCGTGAAAGGCTCCTTGGATTTATACCAATATTTAAA
TGAAATTGGAGGTCTCCATGGAATCGGAAGAATAGACATTGTTGAAAACC
GAGTCATCGGGATGAAATCCAGAGGAATATACGAAACTCCAGCCGGAACA
ATTTTGTATCATGCACATCTCGACATTGAAAATTTGACGATGGATAGAGA
ATTAAGAAAAATTAAACAGCGTTTATGTATTGACTTCGGTGAACAAATTT
ATTATGGCATGTGGTTCAGTCCGGAATGTGATTTCTTGAGAAATTCAATT
GAATATTCGCAAAAATGTGTTACTGGAACTGTCACAATAAAACTTTTCAA
AGGCCAGGTCTACATTCTGGCTAGGCAATCTCCCCATAGTTTATATAACG
AAGAATTAGTGAGTATGGACGTTCAAGGGAAATACGAACCTACCGATGCC
GCTGGATTTATCAAAATAAATGCTCTAAGATTACAGGAGTATCATCGCAT
TCGACATCTTATTTGACTTTTGTTTCAATAATCCAACTTAGGTTTTAATT
TTAACACAAATAAATAAATAAATACTATTTTTGTCTAAAAAA
back to top

protein sequence of SMED30011140-orf-1

>SMED30011140-orf-1 ID=SMED30011140-orf-1|Name=SMED30011140-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=412bp
MTLTGKKKVILAYSGGLDTSCILVWLQEKGYDVIAYLADVGQEEDFEAAK
KKALSLGAVKFFCLDLKLAFVEEYIFKAIQANAIYEDRYLLGTSLARPII
AKGMIEIAKQEGCKYLSHGATGKGNDQIRFELACYALYPDIEIISPWKIP
EFYNRFKGRQDLFEYAKVHNIPLPITKSEPWSMDSNLMHISYESGILENP
SNEAPDLYQMTKDPVTASPDQPEKLKIHFHKGVPVEVENLTNSKTVKGSL
DLYQYLNEIGGLHGIGRIDIVENRVIGMKSRGIYETPAGTILYHAHLDIE
NLTMDRELRKIKQRLCIDFGEQIYYGMWFSPECDFLRNSIEYSQKCVTGT
VTIKLFKGQVYILARQSPHSLYNEELVSMDVQGKYEPTDAAGFIKINALR
LQEYHRIRHLI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005829cytosol
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000035Category 3 cell
PLANA:0000418head
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001518Arginosuc_synth
IPR024074AS_cat/multimer_dom_body
IPR014729Rossmann-like_a/b/a_fold
IPR018223Arginosuc_synth_CS
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004055argininosuccinate synthase activity
GO:0000166nucleotide binding
GO:0016874ligase activity
Vocabulary: biological process
TermDefinition
GO:0006526arginine biosynthetic process
GO:0000050urea cycle
GO:0008652cellular amino acid biosynthetic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001518Argininosuccinate synthasePFAMPF00764Arginosuc_synthcoord: 1..222
e-value: 3.4E-80
score: 270.2
IPR001518Argininosuccinate synthasePANTHERPTHR11587ARGININOSUCCINATE SYNTHASEcoord: 1..226
IPR024074Argininosuccinate synthetase, catalytic/multimerisation domain bodyGENE3DG3DSA:3.90.1260.10coord: 1..191
e-value: 1.6E-77
score: 261.5
IPR024074Argininosuccinate synthetase, catalytic/multimerisation domain bodySUPERFAMILYSSF69864Argininosuccinate synthetase, C-terminal domaincoord: 1..226
NoneNo IPR availableGENE3DG3DSA:1.20.5.470coord: 192..228
e-value: 2.2E-19
score: 70.9