EF-hand calcium-binding domain-containing protein 7

Overview
NameEF-hand calcium-binding domain-containing protein 7
Smed IDSMED30011138
Length (bp)2181
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of EF-hand calcium-binding domain-containing protein 7 (SMED30011138) t-SNE clustered cells

Violin plots show distribution of expression levels for EF-hand calcium-binding domain-containing protein 7 (SMED30011138) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of EF-hand calcium-binding domain-containing protein 7 (SMED30011138) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for EF-hand calcium-binding domain-containing protein 7 (SMED30011138) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011138

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30011138SMESG000047677.1 SmedASXL_017395SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30011138SMESG000047677.1 dd_Smed_v4_12168_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30011138SMESG000047677.1 dd_Smed_v6_12168_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30011138SMESG000047677.1 dd_Smed_v4_12168_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of EF-hand calcium-binding domain-containing protein 7 vs. Ensembl Human
Match: EFCAB7 (EF-hand calcium binding domain 7 [Source:HGNC Symbol;Acc:HGNC:29379])

HSP 1 Score: 90.8929 bits (224), Expect = 2.698e-18
Identity = 59/215 (27.44%), Postives = 103/215 (47.91%), Query Frame = 3
Query:  663 EPKTLKNWRKTILRGCLFLGDISSSNSVQDPNIESHLYKFTVNTATNVFIMMSPLTILQKLDLREVP----DLGFVILNKSEEIVALSMPADAS----GAVYFSGNLNPGSYNVLPFTTGAKLKSKANEAKDNFSNLRPLKKDSNGDYEFSNEVKTMLEDIFKICDIDGNGYLNKEEFIWYSTKTSEDDWEEDMWTELKNAAINNFKIARGQMRK 1283
            EP  +K+W+    +GC FL         +D  I SH Y+  +   + V++ + PL  L +++ +  P    D    IL ++E    L +             ++G L PG Y ++P TTG +L+ K     D     + + +D  G+   + E K+ L DIF++ D+DGNG L+ EE+ ++  +TS +  +ED W   +     NF   R ++ +
Sbjct:  263 EPNLIKDWQHMQSKGCFFLE--------EDGEIISHQYRMQIAQRSMVYLTIKPLN-LSQVEGKPSPWLSVDTALYILKENESQANLQLVCFTELRNREVFGWTGELGPGIYWLIPSTTGCRLRKKIKPVTDE---AQLVYRDETGELFLTKEFKSTLSDIFEVIDLDGNGLLSLEEYNFFELRTSGEKCDEDAWAVCR----ENFDTKRNELTR 461          

HSP 2 Score: 67.781 bits (164), Expect = 4.402e-11
Identity = 35/123 (28.46%), Postives = 68/123 (55.28%), Query Frame = 2
Query:   23 DCHGIYLIFYNSIKENIKSKDELLTILRESGRNVGSDLISKYW--KSREINYEEYIKICQEVPIITKTDLIKALKMMDTKKYGYLEKSEFIRTMSTSESPLSRKDILEIIKRIDVKDDGKLQF 385
            +C   YL  + S  ENI SKD+L   L+ +GRN     I+KYW  ++ ++N++++  I ++    +K +L+K+ K +D    G +  ++  + ++     ++R+++  II   DV  DGK  +
Sbjct:   38 NCRAAYLTVFKSSLENIISKDQLYLALQHAGRNPSQKTINKYWTPQTAKLNFDDFCIILRKEKPTSKAELLKSFKQLDVNDDGCILHTDLYKFLTKRGEKMTREEVNAIINLADVNADGKFDY 160          
BLAST of EF-hand calcium-binding domain-containing protein 7 vs. Ensembl Zebrafish
Match: efcab7 (EF-hand calcium binding domain 7 [Source:ZFIN;Acc:ZDB-GENE-040625-115])

HSP 1 Score: 95.9005 bits (237), Expect = 4.253e-20
Identity = 62/218 (28.44%), Postives = 112/218 (51.38%), Query Frame = 3
Query:  621 IHIEKITSARFEYTEPKTLKNWRKTILRGCLFLGDISSSNSVQDPNIESHLYKFTVNTATNVFIMMSPLTILQKLDLREVPDLG--FVILNKSEEIVALSMPADASGAVYFS-----------GNLNPGSYNVLPFTTGAKLKSKANEAKDNFSNLRPLKKDSNGDYEFSNEVKTMLEDIFKICDIDGNGYLNKEEFIWYSTKTSEDDWEEDMWTELK 1235
            + I  I + R    EPK+L++W  T +RGC ++ D  S  S+Q        Y+  V   T+V++ + PL      +L  +PD    ++ ++ +  ++  +   + S  V F+           G L+ GSY ++PFTTG +LK      K++    + + +  +G+ E + E K +L DIF++ D+DG+G L+ EE+ ++  +TS +  +ED W   K
Sbjct:  223 MGIGGIKTGRL--AEPKSLQDWHHTFMRGCFYMEDDGSIISLQ--------YRLHVPQTTSVYLTIQPL------NLSPIPDKPSPWMCVDTALYVLTGNETKEDSNLVCFTELRDKERFLWRGELSAGSYLLMPFTTGCRLKRMR---KNSPKTAQLVNRVQSGELELTKEFKAVLSDIFEVIDLDGSGLLSLEEYNFFEQRTSGEKCDEDAWAICK 421          

HSP 2 Score: 80.1073 bits (196), Expect = 4.399e-15
Identity = 43/142 (30.28%), Postives = 74/142 (52.11%), Query Frame = 2
Query:   26 CHGIYLIFYNSIKENIKSKDELLTILRESGRNVGSDLISKYWK--SREINYEEYIKICQEVPIITKTDLIKALKMMDTKKYGYLEKSEFIRTMSTSESPLSRKDILEIIKRIDVKDDGKLQFEVVADLLLSNLESFKTRSFE 445
            C   YL  + S   N+ SKD+L T+L+++GRN     + KYW   ++++N++++ +I ++        L+   K  DT   GY+   E  R +++S   +S K++ EI    DV  DGKL +     LL S +E  +  + E
Sbjct:   13 CRAAYLSVFRSSLVNMTSKDQLCTVLQQAGRNPSQKALDKYWPPGTKKLNFDDFCEILKKEKTAEPDQLMTIFKKFDTNGDGYISHDELSRILTSSGEKMSHKEVDEIFTLADVNKDGKLDYAEFCRLLGSTVEKCQAAALE 154          
BLAST of EF-hand calcium-binding domain-containing protein 7 vs. Ensembl Zebrafish
Match: efcab7 (EF-hand calcium binding domain 7 [Source:ZFIN;Acc:ZDB-GENE-040625-115])

HSP 1 Score: 95.9005 bits (237), Expect = 4.852e-20
Identity = 62/216 (28.70%), Postives = 111/216 (51.39%), Query Frame = 3
Query:  627 IEKITSARFEYTEPKTLKNWRKTILRGCLFLGDISSSNSVQDPNIESHLYKFTVNTATNVFIMMSPLTILQKLDLREVPDLG--FVILNKSEEIVALSMPADASGAVYFS-----------GNLNPGSYNVLPFTTGAKLKSKANEAKDNFSNLRPLKKDSNGDYEFSNEVKTMLEDIFKICDIDGNGYLNKEEFIWYSTKTSEDDWEEDMWTELK 1235
            I  I + R    EPK+L++W  T +RGC ++ D  S  S+Q        Y+  V   T+V++ + PL      +L  +PD    ++ ++ +  ++  +   + S  V F+           G L+ GSY ++PFTTG +LK      K++    + + +  +G+ E + E K +L DIF++ D+DG+G L+ EE+ ++  +TS +  +ED W   K
Sbjct:  228 IGGIKTGRL--AEPKSLQDWHHTFMRGCFYMEDDGSIISLQ--------YRLHVPQTTSVYLTIQPL------NLSPIPDKPSPWMCVDTALYVLTGNETKEDSNLVCFTELRDKERFLWRGELSAGSYLLMPFTTGCRLKRMR---KNSPKTAQLVNRVQSGELELTKEFKAVLSDIFEVIDLDGSGLLSLEEYNFFEQRTSGEKCDEDAWAICK 424          

HSP 2 Score: 75.485 bits (184), Expect = 1.042e-13
Identity = 43/144 (29.86%), Postives = 73/144 (50.69%), Query Frame = 2
Query:   26 CHGIYLIFYNSIKENIKSKDELLTILRESGRNVGSDLISKYWK--SREINYEEYIKICQEVPIITKTDLIKALKMMDTKKYGYLEKSEFIRTMSTSESPLSRKDILEIIKRIDVKDDGKLQFEVVADLLLSNLESFKTRSFENC 451
            C   YL  + S   N+ SKD+L T+L+++GRN     + KYW   ++++N++++ +I ++        L+   K  DT   GY+   E  R +++S   +S K++ EI    DV  DGKL +  V   +      F +R  E C
Sbjct:   13 CRAAYLSVFRSSLVNMTSKDQLCTVLQQAGRNPSQKALDKYWPPGTKKLNFDDFCEILKKEKTAEPDQLMTIFKKFDTNGDGYISHDELSRILTSSGEKMSHKEVDEIFTLADVNKDGKLDYAEVWFTIF-----FMSRVVEKC 151          
BLAST of EF-hand calcium-binding domain-containing protein 7 vs. Ensembl Xenopus
Match: bud23 (BUD23, rRNA methyltransferase and ribosome maturation factor [Source:Xenbase;Acc:XB-GENE-1000537])

HSP 1 Score: 93.5893 bits (231), Expect = 3.506e-19
Identity = 76/247 (30.77%), Postives = 121/247 (48.99%), Query Frame = 3
Query:  582 SSRKSSDRKSENEIHI---EKITSARF-EYTEPKTLKNWRKTILRGCLFLGDISSSNSVQDPNIESHLYKFTVNTATNVFIMMSPLTILQKLDLREVP----DLGFVILNKSE---EIVALS--MPADASGAVYFSGNLNPGSYNVLPFTTGAKLKSKANEAKDNFSNLRPLKKDSNGDYEFSNEVKTMLEDIFKICDIDGNGYLNKEEFIWYSTKTSEDDWEEDMWTELKNAAINNFKIARGQMRK 1283
            SSR SS R  +  I       I S R  + TEP  LKNW  T  +GC FL D        + +I SH YK  V   + V + + PL  L K + +  P    D    IL +++   ++++ +     + SG   + G L  G Y ++PFTTG +L+ K    K      R + +D N D   + E K+ L D+F+I D+DGNG L+ EE+ ++  ++S +  ++D W   K     NF+  + ++ +
Sbjct:  232 SSRPSSARSFKATISTVINMGIPSTRIAKLTEPNNLKNWLTTASKGCFFLED--------NGDIISHHYKLQVLQKSAVHLTIKPLN-LSKAEGKLSPWMSVDTALYILKENDGQADLISFTELRNKETSG---WKGELGVGVYWLIPFTTGCRLRKKK---KQTIKEARLVYRDENEDLVLTPEFKSALSDMFEIIDLDGNGLLSLEEYNFFEMRSSCEKCDDDAWEVCK----ENFETKKNELTR 459          

HSP 2 Score: 72.7886 bits (177), Expect = 1.048e-12
Identity = 36/144 (25.00%), Postives = 80/144 (55.56%), Query Frame = 2
Query:   32 GIYLIFYNSIKENIKSKDELLTILRESGRNVGSDLISKYW--KSREINYEEYIKICQEVPIITKTDLIKALKMMDTKKYGYLEKSEFIRTMSTSESPLSRKDILEIIKRIDVKDDGKLQFEVVADLLLSNLESFKTRSFENCGK 457
              YL  + S  +NI +KD+L  +L+++GRN  + +++KYW  +++++N++++  I ++    TK +L+KA + +DT   GY+  ++  + ++T    +S +++  + +  +V  +GKL +    +           R+ E C K
Sbjct:   41 AAYLTVFKSSLDNITNKDQLRLVLQQTGRNPSNRVLNKYWTPRTKQLNFDDFCAILKKEKPATKNELLKAFRNIDTYNKGYILHNDLYQVLTTKGEKMSHEEVNSVFRLAEVNSNGKLDYNKFCNTFF--------RTSEQCAK 176          
BLAST of EF-hand calcium-binding domain-containing protein 7 vs. Ensembl Xenopus
Match: bud23 (BUD23, rRNA methyltransferase and ribosome maturation factor [Source:Xenbase;Acc:XB-GENE-1000537])

HSP 1 Score: 82.4185 bits (202), Expect = 4.240e-16
Identity = 61/212 (28.77%), Postives = 105/212 (49.53%), Query Frame = 3
Query:  675 LKNWRKTILRGCLFLGDISSSNSVQDPNIESHLYKFTVNTATNVFIMMSPLTILQKLDLREVP----DLGFVILNKSE---EIVALS--MPADASGAVYFSGNLNPGSYNVLPFTTGAKLKSKANEAKDNFSNLRPLKKDSNGDYEFSNEVKTMLEDIFKICDIDGNGYLNKEEFIWYSTKTSEDDWEEDMWTELKNAAINNFKIARGQMRK 1283
             +NW  T  +GC FL D        + +I SH YK  V   + V + + PL  L K + +  P    D    IL +++   ++++ +     + SG   + G L  G Y ++PFTTG +L+ K    K      R + +D N D   + E K+ L D+F+I D+DGNG L+ EE+ ++  ++S +  ++D W   K     NF+  + ++ +
Sbjct:   39 FQNWLTTASKGCFFLED--------NGDIISHHYKLQVLQKSAVHLTIKPLN-LSKAEGKLSPWMSVDTALYILKENDGQADLISFTELRNKETSG---WKGELGVGVYWLIPFTTGCRLRKKK---KQTIKEARLVYRDENEDLVLTPEFKSALSDMFEIIDLDGNGLLSLEEYNFFEMRSSCEKCDDDAWEVCK----ENFETKKNELTR 231          
BLAST of EF-hand calcium-binding domain-containing protein 7 vs. Ensembl Xenopus
Match: bud23 (BUD23, rRNA methyltransferase and ribosome maturation factor [Source:Xenbase;Acc:XB-GENE-1000537])

HSP 1 Score: 83.1889 bits (204), Expect = 6.043e-16
Identity = 61/212 (28.77%), Postives = 105/212 (49.53%), Query Frame = 3
Query:  675 LKNWRKTILRGCLFLGDISSSNSVQDPNIESHLYKFTVNTATNVFIMMSPLTILQKLDLREVP----DLGFVILNKSE---EIVALS--MPADASGAVYFSGNLNPGSYNVLPFTTGAKLKSKANEAKDNFSNLRPLKKDSNGDYEFSNEVKTMLEDIFKICDIDGNGYLNKEEFIWYSTKTSEDDWEEDMWTELKNAAINNFKIARGQMRK 1283
             +NW  T  +GC FL D        + +I SH YK  V   + V + + PL  L K + +  P    D    IL +++   ++++ +     + SG   + G L  G Y ++PFTTG +L+ K    K      R + +D N D   + E K+ L D+F+I D+DGNG L+ EE+ ++  ++S +  ++D W   K     NF+  + ++ +
Sbjct:  241 FQNWLTTASKGCFFLED--------NGDIISHHYKLQVLQKSAVHLTIKPLN-LSKAEGKLSPWMSVDTALYILKENDGQADLISFTELRNKETSG---WKGELGVGVYWLIPFTTGCRLRKKK---KQTIKEARLVYRDENEDLVLTPEFKSALSDMFEIIDLDGNGLLSLEEYNFFEMRSSCEKCDDDAWEVCK----ENFETKKNELTR 433          

HSP 2 Score: 72.7886 bits (177), Expect = 1.040e-12
Identity = 36/144 (25.00%), Postives = 80/144 (55.56%), Query Frame = 2
Query:   32 GIYLIFYNSIKENIKSKDELLTILRESGRNVGSDLISKYW--KSREINYEEYIKICQEVPIITKTDLIKALKMMDTKKYGYLEKSEFIRTMSTSESPLSRKDILEIIKRIDVKDDGKLQFEVVADLLLSNLESFKTRSFENCGK 457
              YL  + S  +NI +KD+L  +L+++GRN  + +++KYW  +++++N++++  I ++    TK +L+KA + +DT   GY+  ++  + ++T    +S +++  + +  +V  +GKL +    +           R+ E C K
Sbjct:   15 AAYLTVFKSSLDNITNKDQLRLVLQQTGRNPSNRVLNKYWTPRTKQLNFDDFCAILKKEKPATKNELLKAFRNIDTYNKGYILHNDLYQVLTTKGEKMSHEEVNSVFRLAEVNSNGKLDYNKFCNTFF--------RTSEQCAK 150          
BLAST of EF-hand calcium-binding domain-containing protein 7 vs. Ensembl Xenopus
Match: bud23 (BUD23, rRNA methyltransferase and ribosome maturation factor [Source:Xenbase;Acc:XB-GENE-1000537])

HSP 1 Score: 73.9442 bits (180), Expect = 5.016e-13
Identity = 34/127 (26.77%), Postives = 76/127 (59.84%), Query Frame = 2
Query:   38 YLIFYNSIKENIKSKDELLTILRESGRNVGSDLISKYWKSR--EINYEEYIKICQEVPIITKTDLIKALKMMDTKKYGYLEKSEFIRTMSTSESPLSRKDILEIIKRIDVKDDGKLQFEVVADLLLS 412
            YL  + S  +NI +KD+L  +L+++GRN  + +++KYW  R  ++N++++  I ++    TK +L+KA + +DT   GY+  ++  + ++T    +S +++  + +  +V  +GKL +  +  L++ 
Sbjct:   43 YLTVFKSSLDNITNKDQLRLVLQQTGRNPSNRVLNKYWTPRTKQLNFDDFCAILKKEKPATKNELLKAFRNIDTYNKGYILHNDLYQVLTTKGEKMSHEEVNSVFRLAEVNSNGKLDYNKIGRLVIG 169          
BLAST of EF-hand calcium-binding domain-containing protein 7 vs. Ensembl Mouse
Match: Efcab7 (EF-hand calcium binding domain 7 [Source:MGI Symbol;Acc:MGI:2385199])

HSP 1 Score: 84.7297 bits (208), Expect = 1.565e-16
Identity = 57/202 (28.22%), Postives = 99/202 (49.01%), Query Frame = 3
Query:  660 TEPKTLKNWRKTILRGCLFLGDISSSNSVQDPNIESHLYKFTVNTATNVFIMMSPLTILQKLDLREVP----DLGFVILNKSEEIVALSMPADASGAVY----------FSGNLNPGSYNVLPFTTGAKLKSKANEAKDNFSNLRPLKKDSNGDYEFSNEVKTMLEDIFKICDIDGNGYLNKEEFIWYSTKTSEDDWEEDMW 1223
            TEP  LK+W+    +GC FL +        D  + SH YK  +   + +++ + PL  L +L+ +  P    D    IL K+E       PA+     +          ++G L  G Y ++P TTG +LK    E K      + + +D  G+   ++E ++ L +IF++ D+DGNG ++ EE+ ++  +TS +  +ED W
Sbjct:  204 TEP-NLKDWQCAQSKGCFFLEE--------DGEVVSHQYKMHIAQRSVLYLTIKPL-YLSQLEGKRCPWLSVDTALYILKKNEN------PAEPQLMCFTELRNREVFGWTGELEAGIYWLIPSTTGCRLK---KETKPVTEEAQLVHRDETGELSLTSEFRSTLSEIFEVIDLDGNGLISLEEYNFFELRTSGEKCDEDAW 386          
BLAST of EF-hand calcium-binding domain-containing protein 7 vs. Ensembl Mouse
Match: Efcab7 (EF-hand calcium binding domain 7 [Source:MGI Symbol;Acc:MGI:2385199])

HSP 1 Score: 84.7297 bits (208), Expect = 1.565e-16
Identity = 57/202 (28.22%), Postives = 99/202 (49.01%), Query Frame = 3
Query:  660 TEPKTLKNWRKTILRGCLFLGDISSSNSVQDPNIESHLYKFTVNTATNVFIMMSPLTILQKLDLREVP----DLGFVILNKSEEIVALSMPADASGAVY----------FSGNLNPGSYNVLPFTTGAKLKSKANEAKDNFSNLRPLKKDSNGDYEFSNEVKTMLEDIFKICDIDGNGYLNKEEFIWYSTKTSEDDWEEDMW 1223
            TEP  LK+W+    +GC FL +        D  + SH YK  +   + +++ + PL  L +L+ +  P    D    IL K+E       PA+     +          ++G L  G Y ++P TTG +LK    E K      + + +D  G+   ++E ++ L +IF++ D+DGNG ++ EE+ ++  +TS +  +ED W
Sbjct:  204 TEP-NLKDWQCAQSKGCFFLEE--------DGEVVSHQYKMHIAQRSVLYLTIKPL-YLSQLEGKRCPWLSVDTALYILKKNEN------PAEPQLMCFTELRNREVFGWTGELEAGIYWLIPSTTGCRLK---KETKPVTEEAQLVHRDETGELSLTSEFRSTLSEIFEVIDLDGNGLISLEEYNFFELRTSGEKCDEDAW 386          
BLAST of EF-hand calcium-binding domain-containing protein 7 vs. Ensembl Mouse
Match: Efcab7 (EF-hand calcium binding domain 7 [Source:MGI Symbol;Acc:MGI:2385199])

HSP 1 Score: 83.9593 bits (206), Expect = 1.765e-16
Identity = 56/202 (27.72%), Postives = 99/202 (49.01%), Query Frame = 3
Query:  660 TEPKTLKNWRKTILRGCLFLGDISSSNSVQDPNIESHLYKFTVNTATNVFIMMSPLTILQKLDLREVP----DLGFVILNKSEEIVALSMPADASGAVY----------FSGNLNPGSYNVLPFTTGAKLKSKANEAKDNFSNLRPLKKDSNGDYEFSNEVKTMLEDIFKICDIDGNGYLNKEEFIWYSTKTSEDDWEEDMW 1223
            TEP  LK+W+    +GC FL         +D  + SH YK  +   + +++ + PL  L +++ +  P    D    IL K+E       PA+     +          ++G L  G Y ++P TTG +LK    E K      + + +D  G+   ++E ++ L +IF++ D+DGNG ++ EE+ ++  +TS +  +ED W
Sbjct:  100 TEP-NLKDWQCAQSKGCFFLE--------EDGEVVSHQYKMHIAQRSVLYLTIKPL-YLSQVEGKRCPWLSVDTALYILKKNEN------PAEPQLMCFTELRNREVFGWTGELEAGIYWLIPSTTGCRLK---KETKPVTEEAQLVHRDETGELSLTSEFRSTLSEIFEVIDLDGNGLISLEEYNFFELRTSGEKCDEDAW 282          
BLAST of EF-hand calcium-binding domain-containing protein 7 vs. Ensembl Mouse
Match: Efcab7 (EF-hand calcium binding domain 7 [Source:MGI Symbol;Acc:MGI:2385199])

HSP 1 Score: 83.9593 bits (206), Expect = 1.765e-16
Identity = 56/202 (27.72%), Postives = 99/202 (49.01%), Query Frame = 3
Query:  660 TEPKTLKNWRKTILRGCLFLGDISSSNSVQDPNIESHLYKFTVNTATNVFIMMSPLTILQKLDLREVP----DLGFVILNKSEEIVALSMPADASGAVY----------FSGNLNPGSYNVLPFTTGAKLKSKANEAKDNFSNLRPLKKDSNGDYEFSNEVKTMLEDIFKICDIDGNGYLNKEEFIWYSTKTSEDDWEEDMW 1223
            TEP  LK+W+    +GC FL         +D  + SH YK  +   + +++ + PL  L +++ +  P    D    IL K+E       PA+     +          ++G L  G Y ++P TTG +LK    E K      + + +D  G+   ++E ++ L +IF++ D+DGNG ++ EE+ ++  +TS +  +ED W
Sbjct:  100 TEP-NLKDWQCAQSKGCFFLE--------EDGEVVSHQYKMHIAQRSVLYLTIKPL-YLSQVEGKRCPWLSVDTALYILKKNEN------PAEPQLMCFTELRNREVFGWTGELEAGIYWLIPSTTGCRLK---KETKPVTEEAQLVHRDETGELSLTSEFRSTLSEIFEVIDLDGNGLISLEEYNFFELRTSGEKCDEDAW 282          
BLAST of EF-hand calcium-binding domain-containing protein 7 vs. UniProt/SwissProt
Match: sp|Q6DCF6|EFCB7_XENLA (EF-hand calcium-binding domain-containing protein 7 OS=Xenopus laevis OX=8355 GN=efcab7 PE=2 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 2.875e-18
Identity = 66/216 (30.56%), Postives = 106/216 (49.07%), Query Frame = 3
Query:  663 EPKTLKNWRKTILRGCLFLGDISSSNSVQDPNIESHLYKFTVNTATNVFIMMSPLTILQKLDLREVP----DLGFVIL---NKSEEIVALS--MPADASGAVYFSGNLNPGSYNVLPFTTGAKLKSKANEAKDNFSNLRPLKKDSNGDYEFSNEVKTMLEDIFKICDIDGNGYLNKEEFIWYSTKTSEDDWEEDMWTELKNAAINNFKIARGQMRK 1283
            EP  LK+W  T  +GC FL D        + +I SH YK  V+  + V++ + PL  L K++ +  P    D    IL   N   ++V+ +     + SG   + G L  G Y ++PFTTG +L+ K    K      R + +D N D   + E K+ L D+F I D+DGNG L+  E+ ++  +TS +  + D W   K     NF+  + ++ +
Sbjct:  256 EPNNLKDWHTTSTKGCFFLED--------NGDIISHHYKLQVSEKSTVYLTIKPLN-LSKVEGKPSPWMSVDTSLFILKENNGRADLVSFTELRNQETSG---WKGELGVGVYWLIPFTTGCRLRKKK---KQTIKEARLVYRDGNEDLVLTPEFKSALSDMFDIIDLDGNGLLSLAEYNFFEMRTSGEKCDLDAWEVCK----ENFETKKNELTR 452          

HSP 2 Score: 73.1738 bits (178), Expect = 4.427e-12
Identity = 34/120 (28.33%), Postives = 72/120 (60.00%), Query Frame = 2
Query:   32 GIYLIFYNSIKENIKSKDELLTILRESGRNVGSDLISKYWKSR--EINYEEYIKICQEVPIITKTDLIKALKMMDTKKYGYLEKSEFIRTMSTSESPLSRKDILEIIKRIDVKDDGKLQF 385
              YL  + S  +NI +KD+L  +L+++GRN  + +++KYW  R  E+N++++  I ++    TK +L+KA + +DT   GY+  ++    ++T    +S++++  + +  +V  +GKL +
Sbjct:   37 AAYLTVFKSSLDNITTKDQLQLVLQQTGRNPSNRVLNKYWTPRTKELNFDDFCAILKKEKPATKNELLKAFRKIDTNNKGYILHNDLYEILTTKGEKMSQEEVNSVFRLAEVNSNGKLDY 156          
BLAST of EF-hand calcium-binding domain-containing protein 7 vs. UniProt/SwissProt
Match: sp|A8K855|EFCB7_HUMAN (EF-hand calcium-binding domain-containing protein 7 OS=Homo sapiens OX=9606 GN=EFCAB7 PE=1 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 1.296e-17
Identity = 59/215 (27.44%), Postives = 103/215 (47.91%), Query Frame = 3
Query:  663 EPKTLKNWRKTILRGCLFLGDISSSNSVQDPNIESHLYKFTVNTATNVFIMMSPLTILQKLDLREVP----DLGFVILNKSEEIVALSMPADAS----GAVYFSGNLNPGSYNVLPFTTGAKLKSKANEAKDNFSNLRPLKKDSNGDYEFSNEVKTMLEDIFKICDIDGNGYLNKEEFIWYSTKTSEDDWEEDMWTELKNAAINNFKIARGQMRK 1283
            EP  +K+W+    +GC FL         +D  I SH Y+  +   + V++ + PL  L +++ +  P    D    IL ++E    L +             ++G L PG Y ++P TTG +L+ K     D     + + +D  G+   + E K+ L DIF++ D+DGNG L+ EE+ ++  +TS +  +ED W   +     NF   R ++ +
Sbjct:  263 EPNLIKDWQHMQSKGCFFLE--------EDGEIISHQYRMQIAQRSMVYLTIKPLN-LSQVEGKPSPWLSVDTALYILKENESQANLQLVCFTELRNREVFGWTGELGPGIYWLIPSTTGCRLRKKIKPVTDE---AQLVYRDETGELFLTKEFKSTLSDIFEVIDLDGNGLLSLEEYNFFELRTSGEKCDEDAWAVCR----ENFDTKRNELTR 461          

HSP 2 Score: 67.781 bits (164), Expect = 2.114e-10
Identity = 35/123 (28.46%), Postives = 68/123 (55.28%), Query Frame = 2
Query:   23 DCHGIYLIFYNSIKENIKSKDELLTILRESGRNVGSDLISKYW--KSREINYEEYIKICQEVPIITKTDLIKALKMMDTKKYGYLEKSEFIRTMSTSESPLSRKDILEIIKRIDVKDDGKLQF 385
            +C   YL  + S  ENI SKD+L   L+ +GRN     I+KYW  ++ ++N++++  I ++    +K +L+K+ K +D    G +  ++  + ++     ++R+++  II   DV  DGK  +
Sbjct:   38 NCRAAYLTVFKSSLENIISKDQLYLALQHAGRNPSQKTINKYWTPQTAKLNFDDFCIILRKEKPTSKAELLKSFKQLDVNDDGCILHTDLYKFLTKRGEKMTREEVNAIINLADVNADGKFDY 160          
BLAST of EF-hand calcium-binding domain-containing protein 7 vs. UniProt/SwissProt
Match: sp|Q8VDY4|EFCB7_MOUSE (EF-hand calcium-binding domain-containing protein 7 OS=Mus musculus OX=10090 GN=Efcab7 PE=1 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 2.548e-15
Identity = 56/202 (27.72%), Postives = 99/202 (49.01%), Query Frame = 3
Query:  660 TEPKTLKNWRKTILRGCLFLGDISSSNSVQDPNIESHLYKFTVNTATNVFIMMSPLTILQKLDLREVP----DLGFVILNKSEEIVALSMPADASGAVY----------FSGNLNPGSYNVLPFTTGAKLKSKANEAKDNFSNLRPLKKDSNGDYEFSNEVKTMLEDIFKICDIDGNGYLNKEEFIWYSTKTSEDDWEEDMW 1223
            TEP  LK+W+    +GC FL         +D  + SH YK  +   + +++ + PL  L +++ +  P    D    IL K+E       PA+     +          ++G L  G Y ++P TTG +LK    E K      + + +D  G+   ++E ++ L +IF++ D+DGNG ++ EE+ ++  +TS +  +ED W
Sbjct:  262 TEP-NLKDWQCAQSKGCFFLE--------EDGEVVSHQYKMHIAQRSVLYLTIKPL-YLSQVEGKRCPWLSVDTALYILKKNEN------PAEPQLMCFTELRNREVFGWTGELEAGIYWLIPSTTGCRLK---KETKPVTEEAQLVHRDETGELSLTSEFRSTLSEIFEVIDLDGNGLISLEEYNFFELRTSGEKCDEDAW 444          

HSP 2 Score: 63.1586 bits (152), Expect = 5.595e-9
Identity = 34/135 (25.19%), Postives = 71/135 (52.59%), Query Frame = 2
Query:   23 DCHGIYLIFYNSIKENIKSKDELLTILRESGRNVGSDLISKYW--KSREINYEEYIKICQEVPIITKTDLIKALKMMDTKKYGYLEKSEFIRTMSTSESPLSRKDILEIIKRIDVKDDGKLQFEVVADLLLSNLE 421
            +C   YL  + S  ENI SKD+L   L+ +GRN     I+KYW  ++ ++N++++  I  +    +K +L+K+ K +D    G +  S+  + ++     ++++++  +I   D+  +GK  +     L ++  E
Sbjct:   38 NCRAAYLTIFKSSLENIISKDQLYLALQHAGRNPSQKTINKYWTPQTAKLNFDDFCIILSKEKPTSKAELLKSFKKLDVNDDGAILHSDLQKYLTKRGEKMTQEEVNAVINLADINANGKFDYVKFCKLYMTTSE 172          
BLAST of EF-hand calcium-binding domain-containing protein 7 vs. TrEMBL
Match: A0A087RHY2 (EF-hand calcium-binding domain-containing protein 7 OS=Aptenodytes forsteri OX=9233 GN=AS27_01076 PE=4 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 4.663e-32
Identity = 82/299 (27.42%), Postives = 135/299 (45.15%), Query Frame = 3
Query:  411 PT*KVSKLGRSKIAEKEGKSPTKSVQEVAQHRKSQSNSNRNSLSITXXXXXXXXIVLSSRKSSDRKSENEIHIEKITSARFEYTEPKTLKNWRKTILRGCLFLGDISSSNSVQDPNIESHLYKFTVNTATNVFIMMSPLTILQ---KLDLREVPDLGFVIL--NKSEEIVALSMPADASGAVYFS--GNLNPGSYNVLPFTTGAKLKSKANEAKDNFSN-LRPLKKDSNGDYEFSNEVKTMLEDIFKICDIDGNGYLNKEEFIWYSTKTSEDDWEEDMWTELKNAAINNFKIARGQMRK 1283
            P+ +VS+    K+A  +G S T S       R S + S + S+S T          +S+  SS+R ++                EP T+K W+    +GC +L D        D  I SH YK  +   + V I + PL + Q   K       D    IL  N+++E + L    +      F   G L  G Y +LPFTTG +LK    + K  F+   + + +  +G+   + E + +L DIF+  D+DGNG L+ EE+ ++  +TS +  +E+ W   K     NF + + ++ +
Sbjct:  211 PSPRVSRKTDHKLAPTKGDSRTPS-------RPSSAQSCKASVSTT----------ISNCASSNRNTK--------------LIEPDTIKEWQCAQSKGCFYLED--------DGEIISHKYKLHLPQRSTVCITIKPLNVHQVEGKSCHWLSVDTALYILKENETQENLQLVSFTEQQNKEMFGWKGELGSGIYWLLPFTTGCRLK----KVKTQFTGEAKLVYRGEDGELALTKEFRAVLLDIFETIDLDGNGLLSLEEYNFFELRTSGEKCDEEAWAVCK----ENFDMKKNELTR 462          

HSP 2 Score: 81.6481 bits (200), Expect = 4.663e-32
Identity = 42/135 (31.11%), Postives = 76/135 (56.30%), Query Frame = 2
Query:   23 DCHGIYLIFYNSIKENIKSKDELLTILRESGRNVGSDLISKYWKSR--EINYEEYIKICQEVPIITKTDLIKALKMMDTKKYGYLEKSEFIRTMSTSESPLSRKDILEIIKRIDVKDDGKLQFEVVADLLLSNLE 421
            +C   YL    S  ENIKSK++LL +L+++GRN   + ++KYW S+   +N++++  I ++    TKT+L++A   +DT   GY+   E  + ++T    ++  ++  I K+ D    GKL +    DL ++  E
Sbjct:   38 NCRAAYLTVLKSSLENIKSKEQLLLVLQQAGRNPSQNTVNKYWTSQTTTLNFDDFCTILKKEKPATKTELLEAFGRIDTDNTGYILHDELYKILTTRGEKMTWDEVSTITKQADFNCSGKLDYNKFCDLYMTTSE 172          
BLAST of EF-hand calcium-binding domain-containing protein 7 vs. TrEMBL
Match: A0A091I979 (EF-hand calcium-binding domain-containing protein 7 (Fragment) OS=Calypte anna OX=9244 GN=N300_00637 PE=4 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 5.732e-32
Identity = 84/299 (28.09%), Postives = 136/299 (45.48%), Query Frame = 3
Query:  411 PT*KVSKLGRSKIAEKEGKSPTKSVQEVAQHRKSQSNSNRNSLSITXXXXXXXXIVLSSRKSSDRKSENEIHIEKITSARFEYTEPKTLKNWRKTILRGCLFLGDISSSNSVQDPNIESHLYKFTVNTATNVFIMMSPLTILQ---KLDLREVPDLGFVILNKSE-----EIVALSMPADASGAVYFSGNLNPGSYNVLPFTTGAKLKSKANEAKDNFSNLRPLKKDSNGDYEFSNEVKTMLEDIFKICDIDGNGYLNKEEFIWYSTKTSEDDWEEDMWTELKNAAINNFKIARGQMRK 1283
            P+ ++S+    K+   +G+S T S       R S + S + S+S T          LS   SS+R      H + I        EP T+K W     +GC +L         +D  I SH YK  +   + V I + PL+I Q   K       D    IL ++E     ++V+ +   +    + + G L  G Y +LPFTTG +LK KA       + L  + +D +G+   + E +  L DIF+  D+DGNG L+ EE+ ++  +TS +  +E+ W   K     NF + R ++ +
Sbjct:  211 PSPRISRKTDPKLPPTKGESRTPS-------RPSSAQSCKASVSTT----------LSMGPSSNR------HTKLI--------EPDTMKEWPCAQSKGCFYLE--------EDGEIISHKYKLYLPQKSAVCITIKPLSIPQGEGKYCHWLSVDTALYILKENETQENLQLVSFTEQQNKE-MLGWKGELGSGVYWLLPFTTGCRLK-KAKTPITGEAKL--VSRDEDGELALTKEFRAALLDIFETIDLDGNGLLSLEEYNFFELRTSGEKCDEEAWAVCK----ENFDMKRNELTR 462          

HSP 2 Score: 82.0333 bits (201), Expect = 5.732e-32
Identity = 43/135 (31.85%), Postives = 76/135 (56.30%), Query Frame = 2
Query:   23 DCHGIYLIFYNSIKENIKSKDELLTILRESGRNVGSDLISKYWKSRE--INYEEYIKICQEVPIITKTDLIKALKMMDTKKYGYLEKSEFIRTMSTSESPLSRKDILEIIKRIDVKDDGKLQFEVVADLLLSNLE 421
            +C   YL    S  ENIKSK++L  +L+++GRN     ++KYW S+   +N++++  I ++    TKTDL++A + +DT   GY+   E  + ++     ++R ++  IIK+ D    GKL +    DL ++  E
Sbjct:   38 NCRAAYLTVLKSSLENIKSKEQLSLVLQQAGRNPSQKTVNKYWTSQTTTLNFDDFCTILKKEKPATKTDLLEAFEKIDTDNTGYVLHDELYKILTMRGEKMTRDEVSAIIKQADFNCRGKLDYHKFCDLYVATRE 172          
BLAST of EF-hand calcium-binding domain-containing protein 7 vs. TrEMBL
Match: A0A091P0J2 (EF-hand calcium-binding domain-containing protein 7 OS=Haliaeetus albicilla OX=8969 GN=N329_07429 PE=4 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 3.765e-31
Identity = 43/135 (31.85%), Postives = 77/135 (57.04%), Query Frame = 2
Query:   23 DCHGIYLIFYNSIKENIKSKDELLTILRESGRNVGSDLISKYWKSRE--INYEEYIKICQEVPIITKTDLIKALKMMDTKKYGYLEKSEFIRTMSTSESPLSRKDILEIIKRIDVKDDGKLQFEVVADLLLSNLE 421
            +C   YL  + S  ENIKSK++L  +L+++GRN     ++KYW S+   +N++++  I ++    TKT+L++A   +DT   GY+   E  + ++T    ++R ++  IIK+ D    GKL +    DL ++  E
Sbjct:   38 NCRAAYLTVFKSSLENIKSKEQLSLVLQQAGRNPCQKTVNKYWTSQTTTLNFDDFCTILKKEKPATKTELLEAFGKIDTDNTGYILHDELYKILTTRGEKMTRDEVSAIIKQADFNCSGKLDYNKFCDLYMTTSE 172          

HSP 2 Score: 82.4185 bits (202), Expect = 3.765e-31
Identity = 81/302 (26.82%), Postives = 132/302 (43.71%), Query Frame = 3
Query:  411 PT*KVSKLGRSKIAEKEGKSPTKSVQEVAQHRKSQSNSNRNSLSITXXXXXXXXIVLSSRKSSDRKSENEIHIEKITSARFEYTEPKTLKNWRKTILRGCLFLGDISSSNSVQDPNIESHLYKFTVNTATNVFIMMSPLTILQ---KLDLREVPDLGFVIL--NKSEEIVALSMPADASGAVYFS--GNLNPGSYNVLPFTTGAKLKSK----ANEAKDNFSNLRPLKKDSNGDYEFSNEVKTMLEDIFKICDIDGNGYLNKEEFIWYSTKTSEDDWEEDMWTELKNAAINNFKIARGQMRK 1283
            P+ ++S+    K+A  +G S T S       R S + S + S+S T          +S   SS+R ++                EP T+K W+    +GC +L +        D  I SH YK  +   + V I + PL + Q   K       D    IL  N+++E + L    +      F   G L  G Y +LPFTTG +LK      A EAK  +       +  +G+   + + +  L DIF+  D+DGNG L+ EE+ ++  +TS +  +E+ W   K     NF + + ++ +
Sbjct:  211 PSPRISRKTDHKLAPTKGDSRTPS-------RPSSAQSCKASISTT----------ISMGASSNRNTK--------------LIEPDTMKEWQWAQSKGCFYLEE--------DGEIVSHKYKLHLPQRSTVCITIKPLNVRQVEGKSYHWLSVDTALYILKENETQENLQLVSFTEQQNKEMFGWKGELGSGVYWLLPFTTGCRLKKVKPQIAGEAKLVY-------RGEDGELALTKDFRAALLDIFETIDLDGNGLLSLEEYNFFELRTSGEKCDEEAWAVCK----ENFDMKKNELTR 462          
BLAST of EF-hand calcium-binding domain-containing protein 7 vs. TrEMBL
Match: A0A091V4Z9 (EF-hand calcium-binding domain-containing protein 7 OS=Opisthocomus hoazin OX=30419 GN=N306_03652 PE=4 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 5.068e-31
Identity = 76/300 (25.33%), Postives = 134/300 (44.67%), Query Frame = 3
Query:  411 PT*KVSKLGRSKIAEKEGKSPTKSVQEVAQHRKSQSNSNRNSLSITXXXXXXXXIVLSSRKSSDRKSENEIHIEKITSARFEYTEPKTLKNWRKTILRGCLFLGDISSSNSVQDPNIESHLYKFTVNTATNVFIMMSPLTILQKLDLREVP----DLGFVILNKSE-----EIVALSMPADASGAVYFSGNLNPGSYNVLPFTTGAKLKSKANEAKDNFSNLRPLKKDSNGDYEFSNEVKTMLEDIFKICDIDGNGYLNKEEFIWYSTKTSEDDWEEDMWTELKNAAINNFKIARGQMRK 1283
            P+ ++S+    K+A K+G S T S       R S + S + S+S T          +S   SS+R ++                EP T+K W+    +GC +L +        D  I SH YK  +   + V I + PL + Q ++ +       D    IL ++E     ++V+ +   +      + G L  G Y +LPFTTG +LK    +        + + +  +G+   + E +  L DIF+  D+DGNG L+ EE+ ++  +TS +  +E+ W   K     NF + + ++ +
Sbjct:  211 PSPRISRKTDHKLAPKKGDSKTPS-------RPSSAQSCKASISTT----------ISMGASSNRNAK--------------LIEPDTVKEWQCAQSKGCFYLEE--------DGEIISHKYKLHLPQRSTVCITIKPLNVRQ-VEGKSCHWLSVDTALYILKENETPENLQLVSFTEQQNKE-TFGWKGELGSGVYWLLPFTTGCRLKKVKTQIT---GEAKLVYRGEDGELALTKEFRAALLDIFETIDLDGNGLLSLEEYNFFELRTSGEKCDEEAWAVCK----ENFDMKKNELTR 462          

HSP 2 Score: 82.0333 bits (201), Expect = 5.068e-31
Identity = 42/135 (31.11%), Postives = 75/135 (55.56%), Query Frame = 2
Query:   23 DCHGIYLIFYNSIKENIKSKDELLTILRESGRNVGSDLISKYWKSRE--INYEEYIKICQEVPIITKTDLIKALKMMDTKKYGYLEKSEFIRTMSTSESPLSRKDILEIIKRIDVKDDGKLQFEVVADLLLSNLE 421
            +C   YL    S  ENIKSK++L  +L+++GRN     ++KYW S+   +N++++  I +E    TKT+L++A   +DT   GY+   E  + ++T    ++R ++  I ++ D    GKL +    DL ++  E
Sbjct:   38 NCRAAYLAVLKSSLENIKSKEQLSLVLQQAGRNPSQKTVNKYWTSQTTTLNFDDFCAILKEEKPATKTELLEAFGKIDTHNTGYILHDELYKILTTRGEKMTRDEVSAITEQADFNCSGKLDYNKFCDLYMTTSE 172          
BLAST of EF-hand calcium-binding domain-containing protein 7 vs. TrEMBL
Match: A0A093NVS6 (EF-hand calcium-binding domain-containing protein 7 OS=Pygoscelis adeliae OX=9238 GN=AS28_04166 PE=4 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 7.228e-31
Identity = 82/299 (27.42%), Postives = 134/299 (44.82%), Query Frame = 3
Query:  411 PT*KVSKLGRSKIAEKEGKSPTKSVQEVAQHRKSQSNSNRNSLSITXXXXXXXXIVLSSRKSSDRKSENEIHIEKITSARFEYTEPKTLKNWRKTILRGCLFLGDISSSNSVQDPNIESHLYKFTVNTATNVFIMMSPLTILQ---KLDLREVPDLGFVIL--NKSEEIVALSMPADASGAVYFS--GNLNPGSYNVLPFTTGAKLKSKANEAKDNFSN-LRPLKKDSNGDYEFSNEVKTMLEDIFKICDIDGNGYLNKEEFIWYSTKTSEDDWEEDMWTELKNAAINNFKIARGQMRK 1283
            P+ +VS+    K+A  +G S T S       R S + S + S+S T          +S+  SS+R ++                EP T+K W+    +GC +L D        D  I SH YK  +   + V I + PL + Q   K       D    IL  N+++E + L    +      F   G L  G Y +LPFTTG +LK    + K  F+   + + +  +G+   + E +  L DIF+  D+DGNG L+ EE+ ++  +TS +  +E+ W   K     NF + + ++ +
Sbjct:  211 PSPRVSRKTDHKLAPTKGDSRTPS-------RPSSAQSCKASVSTT----------ISNCASSNRNTK--------------LIEPDTIKEWQCAQSKGCFYLED--------DGEIISHKYKLHLPQRSTVCITIKPLNVHQVEGKSCHWLSVDTALYILKENETQENLQLVSFTEQQNKEMFGWKGELGSGIYWLLPFTTGCRLK----KVKTQFTGEAKLVYRGEDGELALTKEFRAALLDIFETIDLDGNGLLSLEEYNFFELRTSGEKCDEEAWAVCK----ENFDMKKNELTR 462          

HSP 2 Score: 78.1814 bits (191), Expect = 7.228e-31
Identity = 41/135 (30.37%), Postives = 74/135 (54.81%), Query Frame = 2
Query:   23 DCHGIYLIFYNSIKENIKSKDELLTILRESGRNVGSDLISKYWKSR--EINYEEYIKICQEVPIITKTDLIKALKMMDTKKYGYLEKSEFIRTMSTSESPLSRKDILEIIKRIDVKDDGKLQFEVVADLLLSNLE 421
            +C   YL    S  ENIKSK++LL +L+++GRN     ++KYW S+   +N++++  I ++    TKT+L++A   +DT   GY+   E  + ++T    ++  ++  I K+      GKL +    DL ++  E
Sbjct:   38 NCRAAYLTVLKSSLENIKSKEQLLLVLQQAGRNPSQKTVNKYWTSQTTTLNFDDFCTILKKEKPATKTELLEAFGKIDTDNTGYILHDELYKILTTRGEKMTWDEVSAITKQAGFNCSGKLDYNKFCDLYMTTSE 172          
BLAST of EF-hand calcium-binding domain-containing protein 7 vs. Ensembl Sea Lamprey
Match: efcab7 (EF-hand calcium binding domain 7 [Source:ZFIN;Acc:ZDB-GENE-040625-115])

HSP 1 Score: 100.523 bits (249), Expect = 9.710e-32
Identity = 79/297 (26.60%), Postives = 139/297 (46.80%), Query Frame = 3
Query:  435 GRSKIAEKEGKSPTKSVQEVAQHRKSQSNSNRNSLSITXXXXXXXXIVLSSRKSSDRKSENEIHIEKITSARFEYTEPKTLKNWRKTILRGCLFLGDISSSNSVQDPNIESHLYKFTVNTATNVFIMMSPLTILQKLDLREV---PDLGFVILNKSEEIVALSMPADASGAVYFS-----------GNLNPGSYNVLPFTTGAKLKSKANEAKDNFSNLRPLKKDSNGDYEFSNEVKTMLEDIFKICDIDGNGYLNKEEFIWYSTKTSEDDWEEDMWTELKNAAINNFKIARGQMRK 1283
            GR ++ +   ++P + +   A   KS++ S R S  +T +         SS     R S + +       AR +  EPK LK+W+    +GC F+         +D ++ SH Y+  +   T+V+I + PL +  +   R      D    IL ++ +       A+A   V F+           G+L  GSY +LPFTTG +L+ +++ A     +   +    NG+ E + + +T+L DIF+I D+DGNG L+ EE+  +  +TS ++ +   W   K     NF + R ++ +
Sbjct:  158 GRGRVWQLGSQAPERGISSRAG--KSEA-SPRASPRVTPQPAMRAASRPSSSGRDRRPSVSSMVSVSAGKARGKLPEPKNLKDWKHIRSKGCFFVE--------EDGSLASHHYRLELTQPTSVYIKVQPLDLSPEDGPRSTWFGVDTAVFILRENGD------SANAKDLVSFTELCHKETFAWRGDLQKGSYLLLPFTTGCRLRKRSSTAATASRSTALITTAENGELELTRQFRTVLSDIFEIIDLDGNGLLSLEEYNLFELRTSGEECDTSAWEVCK----ANFDMKRNELTR 433          

HSP 2 Score: 54.6842 bits (130), Expect = 9.710e-32
Identity = 28/130 (21.54%), Postives = 66/130 (50.77%), Query Frame = 2
Query:   26 CHGIYLIFYNSIKENIKSKDELLTILRESGRNVGSDLISKYWKSR--EINYEEYIKICQEVPIITKTDLIKALKMMDTKKYGYLEKSEFIRTMSTSESPLSRKDILEIIKRIDVKDDGKLQFEVVADLLL 409
            C   YL+   S  E I ++ +L  +L+ +GR+     + +Y+      +++E+  ++ ++   + + +L+ A + +D    G+L   E  R ++T    ++ K++  + +  DV  DGKL +   + ++L
Sbjct:   11 CRAAYLMVCKSTLEKITTRQQLCQVLQNAGRSPSRRALEQYFPVSMSALDFEDVCEVARQERPVAREELLDAFRKIDRNSDGFLTCDELRRVLTTRGERMTEKELQGVFEDADVNRDGKLDYAEFSRMVL 140          
BLAST of EF-hand calcium-binding domain-containing protein 7 vs. Ensembl Nematostella
Match: EDO42554 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S185])

HSP 1 Score: 70.8626 bits (172), Expect = 8.935e-13
Identity = 40/146 (27.40%), Postives = 72/146 (49.32%), Query Frame = 2
Query:   23 DCHGIYLIFYNSIKENIKSKDELLTILRESGRNVGSDLISKYWKSR--EINYEEYIKICQEVPIITKTDLIKALKMMDTKKYGYLEKSEFIRTMSTSESPLSRKDILEIIKRIDVKDDGKLQFEVVADLLLSNLESFKTRSFENCG 454
            +C   YL    S  E I S +EL+  L+  GRN    ++ KYWK+    I Y ++  I ++    +K  L+KA K +D    G++   E  + ++T    +++ ++  I+   D   DGKL +    ++++S  ES   +S +  G
Sbjct:   46 ECRAAYLSVLPSTSEKITSTEELMQALQFGGRNPSRKVMEKYWKTNTDNITYNDFCDIMRKERPTSKETLLKAFKKIDVNGDGFITFDELFKMLTTKGERMTKSEVQSILDEADYNHDGKLDYNEFCNMIMSTSESCVQKSMDKFG 191          

HSP 2 Score: 69.707 bits (169), Expect = 2.275e-12
Identity = 49/193 (25.39%), Postives = 90/193 (46.63%), Query Frame = 3
Query:  663 EPKTLKNWRKTILRGCLFLGDISSSNSVQDPNIESHLYKFTVNTATNVFIMMSPL-TILQKLDLREVPDLGFVILNKSEEIVALSMPADASGAVY-FSGNLNPGSYNVLPFTTGAKLKSKANEAKDNFSNLRPLKKDSNGDYEFSNEVKTMLEDIFKICDIDGNGYLNKEEFIWYSTKTSEDDWEEDMWTELK 1235
            EP+ LK+W  +  +G  F+         Q   I SH Y   +   T +++ +  + +     DLR V    F++   S E+V  +      G  Y     LN G Y +L FTTG +L  +  E     +    L + +  D + ++  +  L ++F   D+DG+GYL++ EF  + ++TS +  +++ W  ++
Sbjct:  237 EPRNLKSWSNSQSKGSFFVE--------QGGGISSHHYTLVIPKDTQLWLTIQSMPSKSATTDLRLVDMCVFIVEKNSGELVTFT--ESRLGQKYCVQCQLNRGKYQLLTFTTGCRLLPRKYEP----TKQAKLVQGTGEDMKLTSTFRNALTEVFTRSDLDGDGYLSRTEFDLFQSRTSGEPCDDEAWEVMR 415          
BLAST of EF-hand calcium-binding domain-containing protein 7 vs. Ensembl Medaka
Match: efcab7 (EF-hand calcium binding domain 7 [Source:NCBI gene;Acc:101154938])

HSP 1 Score: 95.9005 bits (237), Expect = 4.074e-20
Identity = 65/216 (30.09%), Postives = 109/216 (50.46%), Query Frame = 3
Query:  663 EPKTLKNWRKTILRGCLFLGDISSSNSVQDPNIESHLYKFTVNTATNVFIMMSPLTIL--QKLDLREVPDLGFVILNKSEE-----IVALSMPADASGAVYFSGNLNPGSYNVLPFTTGAKLKSKANEAKDNF--SNLRPLKKDSNGDYEFSNEVKTMLEDIFKICDIDGNGYLNKEEFIWYSTKTSEDDWEEDMWTELKNAAINNFKIARGQMRK 1283
            EP  L++W  +  +GC F+ +  S +S+Q        Y+  V   T V+I + PL I   +K       D    I++  E      +V  +   D    V+  G LN G+Y +LPFT+G +LK K N  K NF   ++  + K   G+ +F+ E++ +L DIF   D+DGNG L+ EE+ ++  +TS +  +++ W   K     NF + + Q+ +
Sbjct:  245 EPAGLQDWHHSFRKGCFFVEEDGSISSLQ--------YQLHVPQTTRVYITIRPLNIHGPEKPSSCMTVDTALFIMSAGETREEATLVCFTESKDKEKYVWM-GELNAGTYYLLPFTSGCRLK-KHN--KKNFPGKSVELVYKTDTGELDFTRELREVLSDIFDTIDLDGNGLLSLEEYNFFELRTSGEQCDKEAWAVCK----ENFDMRKNQLTR 444          

HSP 2 Score: 71.2478 bits (173), Expect = 2.113e-12
Identity = 38/142 (26.76%), Postives = 72/142 (50.70%), Query Frame = 2
Query:   26 CHGIYLIFYNSIKENIKSKDELLTILRESGRNVGSDLISKYWK--SREINYEEYIKICQEVPIITKTDLIKALKMMDTKKYGYLEKSEFIRTMSTSESPLSRKDILEIIKRIDVKDDGKLQFEVVADLLLSNLESFKTRSFE 445
            C   YL  + S   NI SK +L  +L+++GRN     +SKYW   + ++N++++ +I +      + +L++A K MD    GY+  S   + ++T    ++ +++  I    DV  DGKL +     L  S +   +T + +
Sbjct:   20 CRAAYLAVFRSSLTNITSKQQLCHVLQQAGRNPSQATLSKYWSPGTSKLNFDDFCEILKCERQTEEAELMRAFKTMDVNGDGYIFHSALEKALTTKGEKMTAEEVDTIFSLADVNKDGKLDYAEFCRLFASTVHQCQTVAMQ 161          
BLAST of EF-hand calcium-binding domain-containing protein 7 vs. Planmine SMEST
Match: SMESG000047677.1 (SMESG000047677.1)

HSP 1 Score: 529.635 bits (1363), Expect = 0.000e+0
Identity = 270/283 (95.41%), Postives = 275/283 (97.17%), Query Frame = 3
Query:  429 KLGRSKIAEKEGKSPTKSVQEVAQHRKSQSNSNRNSLSITXXXXXXXXIVLSSRKSSDRKSENEIHIEKITSARFEYTEPKTLKNWRKTILRGCLFLGDISSSNSVQDPNIESHLYKFTVNTATNVFIMMSPLTILQKLDLREVPDLGFVILNKSEEIVALSMPADASGAVYFSGNLNPGSYNVLPFTTGAKLKSKANEAKDNFSNLRPLKKDSNGDYEFSNEVKTMLEDIFKICDIDGNGYLNKEEFIWYSTKTSEDDWEEDMWTELKNAAINNFKIARGQM 1277
            KLGRSKIAEKEGKSPTKSVQEVAQHRKSQSNSNRNSLSITEEDEDEDDIVLSSRKSSDRKSENEIHIEKITSARFEYTEPKTLKNWRKTILRGCLFLGDISSSNSVQDPNIESHLYKFTVNTATNVFIMMSPLTILQKLDLREVPDLGFVILNKSEEIVALSMPADASGAVYFSGNLN GSYNVLPFTTGAKLKSKANEAKDNFSNLRPLKKDSNGDYEFSNEVKTMLEDIFKICDIDGNGYLNKEEFIWYSTKTSEDDWEEDMWTELK    ++ K+  G++
Sbjct:  143 KLGRSKIAEKEGKSPTKSVQEVAQHRKSQSNSNRNSLSITEEDEDEDDIVLSSRKSSDRKSENEIHIEKITSARFEYTEPKTLKNWRKTILRGCLFLGDISSSNSVQDPNIESHLYKFTVNTATNVFIMMSPLTILQKLDLREVPDLGFVILNKSEEIVALSMPADASGAVYFSGNLNAGSYNVLPFTTGAKLKSKANEAKDNFSNLRPLKKDSNGDYEFSNEVKTMLEDIFKICDIDGNGYLNKEEFIWYSTKTSEDDWEEDMWTELK----SHVKLHNGEL 421          

HSP 2 Score: 285.034 bits (728), Expect = 0.000e+0
Identity = 141/142 (99.30%), Postives = 141/142 (99.30%), Query Frame = 2
Query:    5 MAFNKEDCHGIYLIFYNSIKENIKSKDELLTILRESGRNVGSDLISKYWKSREINYEEYIKICQEVPIITKTDLIKALKMMDTKKYGYLEKSEFIRTMSTSESPLSRKDILEIIKRIDVKDDGKLQFEVVADLLLSNLESFK 430
            MAFNKEDCHGIYLIFYNSIKENIKSKDELLTILRESGRNVGSDLISKYWKSREINYEEYIKICQEVPIITKTDLIKALKMMDT KYGYLEKSEFIRTMSTSESPLSRKDILEIIKRIDVKDDGKLQFEVVADLLLSNLESFK
Sbjct:    1 MAFNKEDCHGIYLIFYNSIKENIKSKDELLTILRESGRNVGSDLISKYWKSREINYEEYIKICQEVPIITKTDLIKALKMMDTNKYGYLEKSEFIRTMSTSESPLSRKDILEIIKRIDVKDDGKLQFEVVADLLLSNLESFK 142          
The following BLAST results are available for this feature:
BLAST of EF-hand calcium-binding domain-containing protein 7 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
EFCAB72.698e-1827.44EF-hand calcium binding domain 7 [Source:HGNC Symb... [more]
back to top
BLAST of EF-hand calcium-binding domain-containing protein 7 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand calcium-binding domain-containing protein 7 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand calcium-binding domain-containing protein 7 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
efcab74.253e-2028.44EF-hand calcium binding domain 7 [Source:ZFIN;Acc:... [more]
efcab74.852e-2028.70EF-hand calcium binding domain 7 [Source:ZFIN;Acc:... [more]
back to top
BLAST of EF-hand calcium-binding domain-containing protein 7 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
bud233.506e-1930.77BUD23, rRNA methyltransferase and ribosome maturat... [more]
bud234.240e-1628.77BUD23, rRNA methyltransferase and ribosome maturat... [more]
bud236.043e-1628.77BUD23, rRNA methyltransferase and ribosome maturat... [more]
bud235.016e-1326.77BUD23, rRNA methyltransferase and ribosome maturat... [more]
back to top
BLAST of EF-hand calcium-binding domain-containing protein 7 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Efcab71.565e-1628.22EF-hand calcium binding domain 7 [Source:MGI Symbo... [more]
Efcab71.565e-1628.22EF-hand calcium binding domain 7 [Source:MGI Symbo... [more]
Efcab71.765e-1627.72EF-hand calcium binding domain 7 [Source:MGI Symbo... [more]
Efcab71.765e-1627.72EF-hand calcium binding domain 7 [Source:MGI Symbo... [more]
back to top
BLAST of EF-hand calcium-binding domain-containing protein 7 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q6DCF6|EFCB7_XENLA2.875e-1830.56EF-hand calcium-binding domain-containing protein ... [more]
sp|A8K855|EFCB7_HUMAN1.296e-1727.44EF-hand calcium-binding domain-containing protein ... [more]
sp|Q8VDY4|EFCB7_MOUSE2.548e-1527.72EF-hand calcium-binding domain-containing protein ... [more]
back to top
BLAST of EF-hand calcium-binding domain-containing protein 7 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A087RHY24.663e-3227.42EF-hand calcium-binding domain-containing protein ... [more]
A0A091I9795.732e-3228.09EF-hand calcium-binding domain-containing protein ... [more]
A0A091P0J23.765e-3131.85EF-hand calcium-binding domain-containing protein ... [more]
A0A091V4Z95.068e-3125.33EF-hand calcium-binding domain-containing protein ... [more]
A0A093NVS67.228e-3127.42EF-hand calcium-binding domain-containing protein ... [more]
back to top
BLAST of EF-hand calcium-binding domain-containing protein 7 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand calcium-binding domain-containing protein 7 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
efcab79.710e-3226.60EF-hand calcium binding domain 7 [Source:ZFIN;Acc:... [more]
back to top
BLAST of EF-hand calcium-binding domain-containing protein 7 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand calcium-binding domain-containing protein 7 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO425548.935e-1327.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of EF-hand calcium-binding domain-containing protein 7 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
efcab74.074e-2030.09EF-hand calcium binding domain 7 [Source:NCBI gene... [more]
back to top
BLAST of EF-hand calcium-binding domain-containing protein 7 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000047677.10.000e+095.41SMESG000047677.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011138 ID=SMED30011138|Name=EF-hand calcium-binding domain-containing protein 7|organism=Schmidtea mediterranea sexual|type=transcript|length=2181bp
TATGATGGCTTTTAATAAAGAAGATTGTCATGGTATTTATTTAATTTTCT
ACAATTCTATCAAAGAAAATATAAAAAGCAAAGATGAATTACTAACTATT
TTAAGAGAAAGTGGTAGGAATGTAGGCAGTGATCTCATTTCAAAATATTG
GAAGTCAAGAGAAATTAACTATGAAGAATACATCAAAATTTGTCAAGAAG
TTCCTATAATCACGAAAACCGATTTAATTAAAGCCTTGAAAATGATGGAT
ACAAAAAAATACGGATATTTGGAAAAGTCAGAATTTATCAGGACTATGTC
AACGTCAGAATCTCCATTATCTAGAAAAGATATTTTAGAAATTATTAAAA
GAATTGACGTGAAAGACGATGGAAAATTACAATTTGAAGTAGTTGCTGAT
CTACTATTATCCAACTTAGAAAGTTTCAAAACTAGGTCGTTCGAAAATTG
CGGAAAAAGAAGGAAAGTCACCAACAAAATCTGTTCAAGAAGTCGCCCAA
CATCGTAAGTCTCAGTCAAATAGTAATAGGAATAGTTTGTCTATAACTGA
GGAAGATGAAGATGAAGATGATATTGTTCTCTCTTCTCGAAAATCATCTG
ATAGAAAGTCTGAAAATGAGATCCACATAGAAAAGATTACATCTGCCAGA
TTTGAATACACGGAGCCAAAAACTTTAAAAAACTGGCGGAAAACTATTTT
ACGTGGTTGTTTATTTTTGGGAGATATTAGTTCATCTAATAGCGTTCAAG
ATCCAAATATTGAGAGTCACTTGTACAAATTCACAGTGAACACTGCTACT
AACGTATTTATCATGATGTCACCGTTAACTATTCTTCAAAAGTTAGACCT
AAGGGAAGTTCCTGATTTGGGATTTGTAATATTGAATAAGTCAGAAGAAA
TTGTCGCCTTGAGTATGCCAGCTGATGCCAGTGGAGCAGTTTACTTTTCT
GGAAATCTCAATCCTGGCTCGTACAATGTTTTACCATTCACAACCGGCGC
GAAGTTGAAATCCAAAGCCAACGAGGCCAAAGATAACTTCAGTAATTTAC
GACCGTTGAAAAAAGATTCAAATGGAGACTATGAATTTTCCAATGAAGTG
AAGACCATGTTGGAAGATATTTTTAAAATTTGTGATATTGATGGAAATGG
ATATCTTAATAAAGAGGAATTCATTTGGTACTCTACAAAAACTAGTGAGG
ATGACTGGGAAGAAGATATGTGGACGGAACTGAAAAATGCCGCGATAAAT
AATTTTAAAATCGCCCGTGGACAAATGAGAAAGTTTTCAATTTTTATTTC
ATGACTCATTTCACATTAAAACTAACCGGAAATTACTGGAGAAAATAAAT
CAAAAAAAATTCAGAGGAAAAGAGCTCTCGTCGCTAGTGCTATATTTATT
ATTTACAGATGAAAGCGCCTTTGAATAATTAAAGAATATTGATTGAGCGG
TGAATGCTTCCGAAATAAATAGAGATTATTTTATTCGTGAAATTTATTTA
TTTAGTTTTAATGTTTCATATGGTTTTTATTCATAATATTTTATTATGTG
TCATCAAATCATAAGGATAACTCAATATGTTTTGACACACTCATCAATGA
GCAAACAACCAATTTACTTTACTTATTGCTCGTGGCATTGAGAATTATCT
AAATTATATTTTAGATTATTTGATTGGTTATTGAATAAATTTGTTTTACG
CTTTGAAATTTTATATTGATTGAATAGTTGTTTTTAATTATTTGGGTTTG
GGAGGCTCAACTTTCTAAAGCAAGTTTTAAAACTATATTGTAGAATTTTG
CTTTTTCTTCAAAGAGACGGCTGCCCCGTTGTCCGTGATACTAATTAGCT
TTGTTATTTGTATGTTCATTAAGTTATAATAGGAATGTTCTATGAGTTGC
AATAATAAACACAAATTGTAAAAAAACTCTATACAAAGCATATCTAATCA
TAGAAAGGCAACTGATGTAGGAATTTCAAAAGTTGAGATTTAGAAAGGAA
TAAGTGATGAAAATGGACAAATGAGTATATTTAAGAAAATATTATGAAGT
GTGGTTTTAAATTTTTTATTAAATTTCATATTTCTTATATTTAAATTACT
TAATTTTTCTAATAACAAATAATATTTTAAAAATTATTGCAATCCATTTT
AATCTTACCTTCTAACAATAATGTACACGAG
back to top

protein sequence of SMED30011138-orf-1

>SMED30011138-orf-1 ID=SMED30011138-orf-1|Name=SMED30011138-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=164bp
MMSPLTILQKLDLREVPDLGFVILNKSEEIVALSMPADASGAVYFSGNLN
PGSYNVLPFTTGAKLKSKANEAKDNFSNLRPLKKDSNGDYEFSNEVKTML
EDIFKICDIDGNGYLNKEEFIWYSTKTSEDDWEEDMWTELKNAAINNFKI
ARGQMRKFSIFIS*
back to top

protein sequence of SMED30011138-orf-2

>SMED30011138-orf-2 ID=SMED30011138-orf-2|Name=SMED30011138-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=169bp
MMAFNKEDCHGIYLIFYNSIKENIKSKDELLTILRESGRNVGSDLISKYW
KSREINYEEYIKICQEVPIITKTDLIKALKMMDTKKYGYLEKSEFIRTMS
TSESPLSRKDILEIIKRIDVKDDGKLQFEVVADLLLSNLESFKTRSFENC
GKRRKVTNKICSRSRPTS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR011992EF-hand-dom_pair
IPR002048EF_hand_dom
IPR018247EF_Hand_1_Ca_BS
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 20..160
e-value: 3.0E-15
score: 58.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 149..168
NoneNo IPR availablePANTHERPTHR46819FAMILY NOT NAMEDcoord: 7..164
IPR002048EF-hand domainPFAMPF13499EF-hand_7coord: 73..128
e-value: 4.3E-7
score: 30.3
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 105..140
score: 8.432
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 69..104
score: 9.185
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 25..39
score: 5.001
IPR002048EF-hand domainCDDcd00051EFhcoord: 73..128
e-value: 1.34504E-8
score: 47.1573
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 25..136