Uridine 5'-monophosphate synthase

Overview
NameUridine 5'-monophosphate synthase
Smed IDSMED30011127
Length (bp)1540
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Uridine 5'-monophosphate synthase (SMED30011127) t-SNE clustered cells

Violin plots show distribution of expression levels for Uridine 5'-monophosphate synthase (SMED30011127) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Uridine 5'-monophosphate synthase (SMED30011127) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Uridine 5'-monophosphate synthase (SMED30011127) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011127

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30011127SMESG000010153.1 SmedASXL_011704SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
epidermisSMED30011127SMESG000010153.1 dd_Smed_v4_9082_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30011127SMESG000010153.1 dd_Smed_v4_9082_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Uridine 5'-monophosphate synthase vs. Ensembl Human
Match: UMPS (uridine monophosphate synthetase [Source:HGNC Symbol;Acc:HGNC:12563])

HSP 1 Score: 336.65 bits (862), Expect = 6.344e-110
Identity = 179/411 (43.55%), Postives = 254/411 (61.80%), Query Frame = 3
Query:  198 NVDQICGVPYTALPIASCISINNNIPMIIKRKEMKDYGTKKLVEGVFEKNMSCCIIEDVITTGSSIIETVKELINVGLKVTEAIVLIDRGQGGKENINNLGITVKSLITLDEILKILLSADKISQTQYHICKEFAEISQVI--------ISVPKKVTEINWKYRYEKSD-NKITKKVFELINTKKTNLCVAADVNTMADLMNLARKIAPFICILKIHSDIIHDFDLSSMKELKSFSKIKNFLLMEDRKFGDIGNTVKLQLQNKHYDYLSWCDLITIHGLPGDGILEGIKSAAQDSGTDI--GCLIVAEMSSKGSLCNAEYKINCAEMALRHSDIVAGFIAQSMVKDDLPGFIHCTPGVKLEKATDNLGQNYKSVSDLKELGFVDIFIVGRGITESKNPDQVASIYQKATFD 1397
            + D +CGVPYTALP+A+ I   N IPM+I+RKE KDYGTK+LVEG      +C IIEDV+T+GSS++ETV+ L   GLKVT+AIVL+DR QGGK+ +   GI + S+ TL ++L+IL    K+        K F + +  +        +S+ +   E+++  R E    + +  K+  L+  K+TNLC++ADV+   +L+ LA  + P IC+LK H DI++DF L  MKEL + +K   FL+ EDRKF DIGNTVK Q +   +   SW DL+  H +PG G+++G+    Q+ G  +  GCL++AEMSS GSL   +Y      MA  HS+ V GFI+ S V    P F+H TPGV+LE   DNLGQ Y S  ++      DI IVGRGI  + +  + A +Y+KA ++
Sbjct:   67 SFDTVCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGTINPGETCLIIEDVVTSGSSVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQAHGIRLHSVCTLSKMLEILEQQKKVDAETVGRVKRFIQENVFVAANHNGSPLSIKEAPKELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGL----QEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMK-PEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWE 472          

HSP 2 Score: 58.151 bits (139), Expect = 2.352e-8
Identity = 24/48 (50.00%), Postives = 38/48 (79.17%), Query Frame = 2
Query:   38 LVLRLFDIKAIKFGEFKLKSGLVSPIYLDVREIIGYPKLINEISKAMF 181
            LV  L+D++A KFG+F LKSGL SPIY+D+R I+  P+L+++++  +F
Sbjct:   11 LVTGLYDVQAFKFGDFVLKSGLSSPIYIDLRGIVSRPRLLSQVADILF 58          
BLAST of Uridine 5'-monophosphate synthase vs. Ensembl Human
Match: UMPS (uridine monophosphate synthetase [Source:HGNC Symbol;Acc:HGNC:12563])

HSP 1 Score: 227.254 bits (578), Expect = 7.435e-70
Identity = 119/263 (45.25%), Postives = 169/263 (64.26%), Query Frame = 3
Query:  198 NVDQICGVPYTALPIASCISINNNIPMIIKRKEMKDYGTKKLVEGVFEKNMSCCIIEDVITTGSSIIETVKELINVGLKVTEAIVLIDRGQGGKENINNLGITVKSLITLDEILKILLSADKISQTQYHICKEFAEISQVI--------ISVPKKVTEINWKYRYEKSD-NKITKKVFELINTKKTNLCVAADVNTMADLMNLARKIAPFICILKIHSDIIHDFDLSSMKELKSFSKIKNFLLMEDRKFGDIGNTVKLQLQNK 959
            + D +CGVPYTALP+A+ I   N IPM+I+RKE KDYGTK+LVEG      +C IIEDV+T+GSS++ETV+ L   GLKVT+AIVL+DR QGGK+ +   GI + S+ TL ++L+IL    K+        K F + +  +        +S+ +   E+++  R E    + +  K+  L+  K+TNLC++ADV+   +L+ LA  + P IC+LK H DI++DF L  MKEL + +K   FL+ EDRKF DIGNTVK Q + K
Sbjct:   67 SFDTVCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGTINPGETCLIIEDVVTSGSSVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQAHGIRLHSVCTLSKMLEILEQQKKVDAETVGRVKRFIQENVFVAANHNGSPLSIKEAPKELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGK 329          

HSP 2 Score: 58.151 bits (139), Expect = 7.435e-70
Identity = 24/48 (50.00%), Postives = 38/48 (79.17%), Query Frame = 2
Query:   38 LVLRLFDIKAIKFGEFKLKSGLVSPIYLDVREIIGYPKLINEISKAMF 181
            LV  L+D++A KFG+F LKSGL SPIY+D+R I+  P+L+++++  +F
Sbjct:   11 LVTGLYDVQAFKFGDFVLKSGLSSPIYIDLRGIVSRPRLLSQVADILF 58          
BLAST of Uridine 5'-monophosphate synthase vs. Ensembl Human
Match: UMPS (uridine monophosphate synthetase [Source:HGNC Symbol;Acc:HGNC:12563])

HSP 1 Score: 61.2326 bits (147), Expect = 1.483e-20
Identity = 24/44 (54.55%), Postives = 33/44 (75.00%), Query Frame = 3
Query:  198 NVDQICGVPYTALPIASCISINNNIPMIIKRKEMKDYGTKKLVE 329
            + D +CGVPYTALP+A+ I   N IPM+I+RKE KDYG+ +  +
Sbjct:   67 SFDTVCGVPYTALPLATVICSTNQIPMLIRRKETKDYGSTQRTQ 110          

HSP 2 Score: 58.9214 bits (141), Expect = 1.483e-20
Identity = 24/51 (47.06%), Postives = 39/51 (76.47%), Query Frame = 2
Query:   29 MDDLVLRLFDIKAIKFGEFKLKSGLVSPIYLDVREIIGYPKLINEISKAMF 181
            +  LV  L+D++A KFG+F LKSGL SPIY+D+R I+  P+L+++++  +F
Sbjct:    8 LGPLVTGLYDVQAFKFGDFVLKSGLSSPIYIDLRGIVSRPRLLSQVADILF 58          
BLAST of Uridine 5'-monophosphate synthase vs. Ensembl Human
Match: UMPS (uridine monophosphate synthetase [Source:HGNC Symbol;Acc:HGNC:12563])

HSP 1 Score: 54.6842 bits (130), Expect = 3.697e-9
Identity = 23/47 (48.94%), Postives = 36/47 (76.60%), Query Frame = 2
Query:   38 LVLRLFDIKAIKFGEFKLKSGLVSPIYLDVREIIGYPKLINEISKAM 178
            LV  L+D++A KFG+F LKSGL SPIY+D+R I+  P+L++++   +
Sbjct:   11 LVTGLYDVQAFKFGDFVLKSGLSSPIYIDLRGIVSRPRLLSQMGSLL 57          
BLAST of Uridine 5'-monophosphate synthase vs. Ensembl Human
Match: UMPS (uridine monophosphate synthetase [Source:HGNC Symbol;Acc:HGNC:12563])

HSP 1 Score: 54.6842 bits (130), Expect = 3.697e-9
Identity = 23/47 (48.94%), Postives = 36/47 (76.60%), Query Frame = 2
Query:   38 LVLRLFDIKAIKFGEFKLKSGLVSPIYLDVREIIGYPKLINEISKAM 178
            LV  L+D++A KFG+F LKSGL SPIY+D+R I+  P+L++++   +
Sbjct:   11 LVTGLYDVQAFKFGDFVLKSGLSSPIYIDLRGIVSRPRLLSQMGSLL 57          
BLAST of Uridine 5'-monophosphate synthase vs. Ensembl Celegans
Match: umps-1 (Uridine 5'-monophosphate synthase Orotate phosphoribosyltransferase Orotidine 5'-phosphate decarboxylase [Source:UniProtKB/Swiss-Prot;Acc:G5EDZ2])

HSP 1 Score: 240.736 bits (613), Expect = 4.126e-73
Identity = 141/421 (33.49%), Postives = 232/421 (55.11%), Query Frame = 3
Query:  210 ICGVPYTALPIASCISINN-NIPMIIKRKEMKDYGTKKLVEGVFEKNMSCCIIEDVITTGSSIIETVKELINVGLKVTEAIVLIDRGQGGKENINNLGITVKSLITLDEILKILLSADKISQTQYH-----------------ICKEFAEISQV--IISVPKKVTEINWKYRYEKSDNKITKKVFELINTKKTNLCVAADVNTMADLMNLARKIAPFICILKIHSDIIHDFDLSSMKELKSFSKIKNFLLMEDRKFGDIGNTVKLQLQNKHYDYLSWCDLITIHGLPGDGILEGI-KSAAQDSGTDI-GCLIVAEMSSKGSLCNAE-YKINCAEMALRHSDIVAGFIAQSMVK--DDLPGFIHCTPGVKLEKATDNLGQNYKSVSDLKELGFVDIFIVGRGITESKNPDQVASIYQKATFD 1397
            + G+PY ALP AS  + N    P++I RKE K YGTKKL+EG+++ N    +IEDV+TTG SI++ VK L    L  ++   ++DR QGG++ + + G+T+ SL+ +  +L  L S   I   Q+H                 I  E   +S +  + +V   + E     R   +++ + KK+  ++  KK+NLC+A D  T+   + +     PF+  +K+H+D I DF+    ++L + +   +F++ EDRKFGD GNT  LQL        +W D++T+H + G   + G+ +  A+D    + G L++A++S+KGSL   E Y     ++A  + D+++GFI Q+ V    DL   ++ TPGV L+  +D+ GQ ++ V +  E+   DI IVGRG+T S  P Q    Y++  +D
Sbjct:   77 VLGIPYAALPYASVAAGNYLKKPLLIVRKEAKSYGTKKLIEGLYQPNDRLILIEDVVTTGGSILDVVKVLHTENLVASDVFCILDREQGGRQKLQDAGVTLHSLLDMQTVLTFLYSTGAIGDEQWHGIVQALNLPYTSPTKLEINSELENLSSLPYVENVRTPLAE-----RESLTESALIKKILGIMRRKKSNLCLAVDYTTVEQCLQMIELAGPFVLAIKLHADAITDFNEEFTRKLTTMANDMDFIIFEDRKFGDTGNTNLLQLTGAQ-KIANWADVVTVHAVQGSDSIAGVFRKLAKDPTYRLSGVLLIAQLSTKGSLTALEGYTETAVKIANENRDVISGFITQTRVSACSDL---LNWTPGVNLDAKSDSAGQQWRGVDEAIEVQQNDIIIVGRGVTSSSEPVQQLKRYRQIAWD 488          

HSP 2 Score: 53.1434 bits (126), Expect = 3.445e-7
Identity = 23/48 (47.92%), Postives = 35/48 (72.92%), Query Frame = 2
Query:   35 DLVLRLFDIKAIKFGEFKLKSGLVSPIYLDVREIIGYPKLINEISKAM 178
            +L+ ++      KFGEF+LKSG +SPIY+D+RE  G+P L+  IS+A+
Sbjct:   16 NLLRQMLKASVFKFGEFQLKSGQISPIYIDLRECFGHPGLLMLISEAI 63          
BLAST of Uridine 5'-monophosphate synthase vs. Ensembl Celegans
Match: umps-1 (Uridine 5'-monophosphate synthase Orotate phosphoribosyltransferase Orotidine 5'-phosphate decarboxylase [Source:UniProtKB/Swiss-Prot;Acc:G5EDZ2])

HSP 1 Score: 240.736 bits (613), Expect = 4.126e-73
Identity = 141/421 (33.49%), Postives = 232/421 (55.11%), Query Frame = 3
Query:  210 ICGVPYTALPIASCISINN-NIPMIIKRKEMKDYGTKKLVEGVFEKNMSCCIIEDVITTGSSIIETVKELINVGLKVTEAIVLIDRGQGGKENINNLGITVKSLITLDEILKILLSADKISQTQYH-----------------ICKEFAEISQV--IISVPKKVTEINWKYRYEKSDNKITKKVFELINTKKTNLCVAADVNTMADLMNLARKIAPFICILKIHSDIIHDFDLSSMKELKSFSKIKNFLLMEDRKFGDIGNTVKLQLQNKHYDYLSWCDLITIHGLPGDGILEGI-KSAAQDSGTDI-GCLIVAEMSSKGSLCNAE-YKINCAEMALRHSDIVAGFIAQSMVK--DDLPGFIHCTPGVKLEKATDNLGQNYKSVSDLKELGFVDIFIVGRGITESKNPDQVASIYQKATFD 1397
            + G+PY ALP AS  + N    P++I RKE K YGTKKL+EG+++ N    +IEDV+TTG SI++ VK L    L  ++   ++DR QGG++ + + G+T+ SL+ +  +L  L S   I   Q+H                 I  E   +S +  + +V   + E     R   +++ + KK+  ++  KK+NLC+A D  T+   + +     PF+  +K+H+D I DF+    ++L + +   +F++ EDRKFGD GNT  LQL        +W D++T+H + G   + G+ +  A+D    + G L++A++S+KGSL   E Y     ++A  + D+++GFI Q+ V    DL   ++ TPGV L+  +D+ GQ ++ V +  E+   DI IVGRG+T S  P Q    Y++  +D
Sbjct:   77 VLGIPYAALPYASVAAGNYLKKPLLIVRKEAKSYGTKKLIEGLYQPNDRLILIEDVVTTGGSILDVVKVLHTENLVASDVFCILDREQGGRQKLQDAGVTLHSLLDMQTVLTFLYSTGAIGDEQWHGIVQALNLPYTSPTKLEINSELENLSSLPYVENVRTPLAE-----RESLTESALIKKILGIMRRKKSNLCLAVDYTTVEQCLQMIELAGPFVLAIKLHADAITDFNEEFTRKLTTMANDMDFIIFEDRKFGDTGNTNLLQLTGAQ-KIANWADVVTVHAVQGSDSIAGVFRKLAKDPTYRLSGVLLIAQLSTKGSLTALEGYTETAVKIANENRDVISGFITQTRVSACSDL---LNWTPGVNLDAKSDSAGQQWRGVDEAIEVQQNDIIIVGRGVTSSSEPVQQLKRYRQIAWD 488          

HSP 2 Score: 53.1434 bits (126), Expect = 3.445e-7
Identity = 23/48 (47.92%), Postives = 35/48 (72.92%), Query Frame = 2
Query:   35 DLVLRLFDIKAIKFGEFKLKSGLVSPIYLDVREIIGYPKLINEISKAM 178
            +L+ ++      KFGEF+LKSG +SPIY+D+RE  G+P L+  IS+A+
Sbjct:   16 NLLRQMLKASVFKFGEFQLKSGQISPIYIDLRECFGHPGLLMLISEAI 63          
BLAST of Uridine 5'-monophosphate synthase vs. Ensembl Celegans
Match: R12E2.11 (Orotate phosphoribosyltransferase [Source:UniProtKB/Swiss-Prot;Acc:O61790])

HSP 1 Score: 114.005 bits (284), Expect = 2.989e-32
Identity = 52/127 (40.94%), Postives = 87/127 (68.50%), Query Frame = 3
Query:  204 DQICGVPYTALPIASCISINNNIPMIIKRKEMKDYGTKKLVEGVFEKNMSCCIIEDVITTGSSIIETVKELINVGLKVTEAIVLIDRGQGGKENINNLGITVKSLITLDEILKILLSADKISQTQYH 584
            D + GVPY ALP+A+ +S   N+PM++KRKE K YGTK+L+EGV++   +  ++EDV+T+G SI ET + + N  L VT+AI ++DR QG   N+    +   S +T+++IL  L++ +++++ + H
Sbjct:   91 DYVVGVPYAALPLATLVSDILNVPMLMKRKEAKAYGTKQLIEGVYQPGGTVLLVEDVVTSGESIRETAEAIRNENLLVTDAIAVLDRQQGATANLAEDNLNFLSFLTMEKILDGLITKNEMTEERKH 217          

HSP 2 Score: 44.2838 bits (103), Expect = 2.989e-32
Identity = 19/52 (36.54%), Postives = 34/52 (65.38%), Query Frame = 2
Query:   35 DLVLRLFDIKAIKFGEFKLKSGLVSPIYLDVREIIGYPKLINEISKAMFIKM 190
            D    L+ ++  + GEF LKSG ++PIY+D+R I+  P+++   ++AM  K+
Sbjct:   32 DFFENLYQMECFRTGEFYLKSGQMTPIYIDLRRIMSSPRVLRMAAQAMCEKI 83          
BLAST of Uridine 5'-monophosphate synthase vs. Ensembl Celegans
Match: R12E2.11 (Orotate phosphoribosyltransferase [Source:UniProtKB/Swiss-Prot;Acc:O61790])

HSP 1 Score: 114.005 bits (284), Expect = 2.989e-32
Identity = 52/127 (40.94%), Postives = 87/127 (68.50%), Query Frame = 3
Query:  204 DQICGVPYTALPIASCISINNNIPMIIKRKEMKDYGTKKLVEGVFEKNMSCCIIEDVITTGSSIIETVKELINVGLKVTEAIVLIDRGQGGKENINNLGITVKSLITLDEILKILLSADKISQTQYH 584
            D + GVPY ALP+A+ +S   N+PM++KRKE K YGTK+L+EGV++   +  ++EDV+T+G SI ET + + N  L VT+AI ++DR QG   N+    +   S +T+++IL  L++ +++++ + H
Sbjct:   91 DYVVGVPYAALPLATLVSDILNVPMLMKRKEAKAYGTKQLIEGVYQPGGTVLLVEDVVTSGESIRETAEAIRNENLLVTDAIAVLDRQQGATANLAEDNLNFLSFLTMEKILDGLITKNEMTEERKH 217          

HSP 2 Score: 44.2838 bits (103), Expect = 2.989e-32
Identity = 19/52 (36.54%), Postives = 34/52 (65.38%), Query Frame = 2
Query:   35 DLVLRLFDIKAIKFGEFKLKSGLVSPIYLDVREIIGYPKLINEISKAMFIKM 190
            D    L+ ++  + GEF LKSG ++PIY+D+R I+  P+++   ++AM  K+
Sbjct:   32 DFFENLYQMECFRTGEFYLKSGQMTPIYIDLRRIMSSPRVLRMAAQAMCEKI 83          
BLAST of Uridine 5'-monophosphate synthase vs. Ensembl Fly
Match: r-l (gene:FBgn0003257 transcript:FBtr0084038)

HSP 1 Score: 315.079 bits (806), Expect = 1.172e-101
Identity = 169/416 (40.62%), Postives = 259/416 (62.26%), Query Frame = 3
Query:  192 QKNVDQICGVPYTALPIASCISINNNIPMIIKRKEMKDYGTKKLVEGVFEKNMSCCIIEDVITTGSSIIETVKELINVGLKVTEAIVLIDRGQGGKENINNLGITVKSLITLDEILKILLSADKISQTQYHICKEFAEISQ--------------VIISVPKKVTEINWKYRYEKSDNKITKKVFELINTKKTNLCVAADVNTMADLMNLARKIAPFICILKIHSDIIHDFDLSSMKELKSFSKIKNFLLMEDRKFGDIGNTVKLQLQNKHYDYLSWCDLITIHGLPGDGILEGIKSAAQD--SGTDIGCLIVAEMSSKGSLCNAEYKINCAEMALRHSDI--VAGFIAQSMVKDDLPGFIHCTPGVKLEKATDNLGQNYKSVSD-LKELGFVDIFIVGRGITESKNPDQVASIYQ 1382
            Q +   +CGVPYTALP+A+ +S+    PM+++RKE K YGTKKLVEG+F    +C I+EDV+T+GSSI++TV++L   G+ VT+A+V++DR QGG  NI   G+ + SL TL  +L  L  A +I ++      ++    Q              V+ +   + T++ ++ R   + + + K++F LI +K+TNLC+AAD+    +++++A K  P+IC+LK H DI+ DF    + +L++ ++  NFLLMEDRKF DIGNTV LQ     Y   SW DL+T H LPG  IL+G+K+   +  +G + G  ++AEMS+ G+L +A+YK N  ++A   +D+  VAG + QS      PG +  TPGVK+++  D LGQ Y+S    +KE G  DI +VGRGI ++ +P Q A  Y+
Sbjct:   66 QLSAKHVCGVPYTALPLATIVSVQQGTPMLVRRKEAKAYGTKKLVEGIFNAGDTCLIVEDVVTSGSSILDTVRDLQGEGIVVTDAVVVVDREQGGVANIAKHGVRMHSLFTLSFLLNTLHEAGRIEKSTVEAVAKYIAAVQINSDGTFVGGDKGDVVRANDLQRTKLTYENRANLAKSAVAKRLFNLIASKQTNLCLAADLTHADEILDVADKCGPYICLLKTHVDIVEDFSDKFIADLQALAQRHNFLLMEDRKFADIGNTVSLQYGKGIYKISSWADLVTAHTLPGRSILQGLKAGLGEGGAGKERGVFLLAEMSASGNLIDAKYKENSNKIATEGADVDFVAGVVCQSSDAFAFPGLLQLTPGVKIDEGVDQLGQQYQSPEHVVKERG-ADIGVVGRGILKASSPKQAAQTYR 480          

HSP 2 Score: 55.4546 bits (132), Expect = 7.024e-8
Identity = 23/48 (47.92%), Postives = 35/48 (72.92%), Query Frame = 2
Query:   26 RMDDLVLRLFDIKAIKFGEFKLKSGLVSPIYLDVREIIGYPKLINEIS 169
            +M  L L+LF+I A KFG+FK+K G+ SP+Y D+R I+ YP ++  +S
Sbjct:    8 KMRALALKLFEINAFKFGDFKMKVGINSPVYFDLRVIVSYPDVMQTVS 55          
BLAST of Uridine 5'-monophosphate synthase vs. Ensembl Zebrafish
Match: umps (uridine monophosphate synthetase [Source:ZFIN;Acc:ZDB-GENE-040426-785])

HSP 1 Score: 314.309 bits (804), Expect = 1.728e-101
Identity = 168/406 (41.38%), Postives = 243/406 (59.85%), Query Frame = 3
Query:  204 DQICGVPYTALPIASCISINNNIPMIIKRKEMKDYGTKKLVEGVFEKNMSCCIIEDVITTGSSIIETVKELINVGLKVTEAIVLIDRGQGGKENINNLGITVKSLITLDEILKILLSADKISQTQYHICKEFAEISQVII-------SVPKKVTEINWKYRYEKSD-NKITKKVFELINTKKTNLCVAADVNTMADLMNLARKIAPFICILKIHSDIIHDFDLSSMKELKSFSKIKNFLLMEDRKFGDIGNTVKLQLQNKHYDYLSWCDLITIHGLPGDGILEGIKSAAQDSGTDIGCLIVAEMSSKGSLCNAEYKINCAEMALRHSDIVAGFIAQSMVKDDLPGFIHCTPGVKLEKATDNLGQNYKSVSDLKELGFVDIFIVGRGITESKNPDQVASIYQKATFD 1397
            D +CGVPYTALP+A+ I  +   PM+I+RKE KDYGTK+L+EG       C I+EDV+T+GSS++ET + L   GLK+T+A+VL+DR QGG   + + GIT+ S+I++  +L++LL A +I        K F + +   I       +  K   E+++  R    D + +  ++ +++  KKTNLCV+ADV    +L+++A  + P IC+LK H DI+ DF       LK  +K  NFL+ EDRKF DIGNTVK Q +   Y   SW  +I  H LPG G+L+G+       G   GCL++A+MSS+GSL   +Y     +MA  HSD V GFI+ S + +  PG +H TPGV+++   D LGQ Y S  D+      DI IVGRGI  S +  + A  Y+ A ++
Sbjct:   67 DSVCGVPYTALPLATIICSSKQYPMLIRRKEAKDYGTKRLIEGTIRPGDRCLIVEDVVTSGSSVLETAEVLEKEGLKITDAVVLMDREQGGSTRLADSGITLHSVISISRLLEVLLKAGRIDTDTAQSVKRFVQDNNTYILKKNGSSAAKKSCGELSYGARAGLPDTHPLAARLMQIMEDKKTNLCVSADVTHSKELLDIAVTLGPLICVLKTHVDILEDFTADVASNLKELAKKHNFLIFEDRKFADIGNTVKHQYEGGLYRISSWAHIINAHALPGPGVLQGLGGVGNPLGH--GCLLIAQMSSQGSLATGDYTQAVVKMAEDHSDFVFGFISGSKISEK-PGMVHMTPGVQMQTGGDGLGQQYSSPEDVICTKGSDIIIVGRGILGSPDRLRAAGEYRTAGWE 469          

HSP 2 Score: 66.2402 bits (160), Expect = 3.888e-11
Identity = 27/47 (57.45%), Postives = 39/47 (82.98%), Query Frame = 2
Query:   29 MDDLVLRLFDIKAIKFGEFKLKSGLVSPIYLDVREIIGYPKLINEIS 169
            +D L+L+L DI+A+KFG FKLKSGL SPIY D+R I+ +P L+N+++
Sbjct:    6 LDSLILKLHDIQAVKFGTFKLKSGLSSPIYFDLRVIVSHPALMNQVA 52          
BLAST of Uridine 5'-monophosphate synthase vs. Ensembl Mouse
Match: Umps (uridine monophosphate synthetase [Source:MGI Symbol;Acc:MGI:1298388])

HSP 1 Score: 327.791 bits (839), Expect = 1.374e-106
Identity = 174/413 (42.13%), Postives = 252/413 (61.02%), Query Frame = 3
Query:  198 NVDQICGVPYTALPIASCISINNNIPMIIKRKEMKDYGTKKLVEGVFEKNMSCCIIEDVITTGSSIIETVKELINVGLKVTEAIVLIDRGQGGKENINNLGITVKSLITLDEILKILLSADKISQTQYHICKEFAEISQVIISVP----------KKVTEINWKYRYE-KSDNKITKKVFELINTKKTNLCVAADVNTMADLMNLARKIAPFICILKIHSDIIHDFDLSSMKELKSFSKIKNFLLMEDRKFGDIGNTVKLQLQNKHYDYLSWCDLITIHGLPGDGILEGIKSAAQDSGTDI--GCLIVAEMSSKGSLCNAEYKINCAEMALRHSDIVAGFIAQSMVKDDLPGFIHCTPGVKLEKATDNLGQNYKSVSDLKELGFVDIFIVGRGITESKNPDQVASIYQKATFD 1397
            + D +CGVPYTALP+A+ I   N+IPM+I+RKE KDYGTK+LVEG      +C +IEDV+T+G+S++ETV+ L   GLKVT+AIVL+DR QGGK+ +   GI + ++ TL ++L+IL   +KI        K F  I + + S            K   E+++  R E    + +  K+  L+  K+TNLC++ADV+   +L+ LA  + P IC+LK H DI++DF L  M+EL + +K   FL+ EDRKF DIGNTVK Q ++  +   SW D++  H +PG G+++G+    Q+ G  +   CL++AEMSS GSL    Y      MA  H + V GFI+ S V    P F+H TPGV+LE   D+LGQ Y S  ++      D+ IVGRGI  + N  + A +Y+KA ++
Sbjct:   67 SFDSVCGVPYTALPLATVICSANHIPMLIRRKETKDYGTKRLVEGEINPGQTCLVIEDVVTSGASVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQAQGIRLHAVCTLSQMLEILQQQEKIDADMVGRVKRF--IQENVFSAANHNGLPPPEKKACKELSFGARAELPGTHPLASKLLRLMQKKETNLCLSADVSEARELLQLADALGPSICMLKTHVDILNDFTLDVMEELTALAKRHEFLIFEDRKFADIGNTVKKQYESGTFKIASWADIVNAHVVPGSGVVKGL----QEVGLPLHRACLLIAEMSSAGSLATGNYTKAAVGMAEEHCEFVIGFISGSRVSMK-PEFLHLTPGVQLETGGDHLGQQYNSPQEVIGKRGSDVIIVGRGILAAANRLEAAEMYRKAAWE 472          

HSP 2 Score: 57.7658 bits (138), Expect = 1.978e-8
Identity = 23/48 (47.92%), Postives = 37/48 (77.08%), Query Frame = 2
Query:   38 LVLRLFDIKAIKFGEFKLKSGLVSPIYLDVREIIGYPKLINEISKAMF 181
            LV  L+D++A KFG F LKSGL SP+Y+D+R I+  P+L+++++  +F
Sbjct:   11 LVTELYDVQAFKFGSFVLKSGLSSPVYIDLRGIVSRPRLLSQVADILF 58          
BLAST of Uridine 5'-monophosphate synthase vs. Ensembl Mouse
Match: Umps (uridine monophosphate synthetase [Source:MGI Symbol;Acc:MGI:1298388])

HSP 1 Score: 55.0694 bits (131), Expect = 1.313e-9
Identity = 23/47 (48.94%), Postives = 36/47 (76.60%), Query Frame = 2
Query:   38 LVLRLFDIKAIKFGEFKLKSGLVSPIYLDVREIIGYPKLINEISKAM 178
            LV  L+D++A KFG F LKSGL SP+Y+D+R I+  P+L++++  A+
Sbjct:   11 LVTELYDVQAFKFGSFVLKSGLSSPVYIDLRGIVSRPRLLSQVPSAL 57          
BLAST of Uridine 5'-monophosphate synthase vs. UniProt/SwissProt
Match: sp|P11172|UMPS_HUMAN (Uridine 5'-monophosphate synthase OS=Homo sapiens OX=9606 GN=UMPS PE=1 SV=1)

HSP 1 Score: 336.65 bits (862), Expect = 3.047e-109
Identity = 179/411 (43.55%), Postives = 254/411 (61.80%), Query Frame = 3
Query:  198 NVDQICGVPYTALPIASCISINNNIPMIIKRKEMKDYGTKKLVEGVFEKNMSCCIIEDVITTGSSIIETVKELINVGLKVTEAIVLIDRGQGGKENINNLGITVKSLITLDEILKILLSADKISQTQYHICKEFAEISQVI--------ISVPKKVTEINWKYRYEKSD-NKITKKVFELINTKKTNLCVAADVNTMADLMNLARKIAPFICILKIHSDIIHDFDLSSMKELKSFSKIKNFLLMEDRKFGDIGNTVKLQLQNKHYDYLSWCDLITIHGLPGDGILEGIKSAAQDSGTDI--GCLIVAEMSSKGSLCNAEYKINCAEMALRHSDIVAGFIAQSMVKDDLPGFIHCTPGVKLEKATDNLGQNYKSVSDLKELGFVDIFIVGRGITESKNPDQVASIYQKATFD 1397
            + D +CGVPYTALP+A+ I   N IPM+I+RKE KDYGTK+LVEG      +C IIEDV+T+GSS++ETV+ L   GLKVT+AIVL+DR QGGK+ +   GI + S+ TL ++L+IL    K+        K F + +  +        +S+ +   E+++  R E    + +  K+  L+  K+TNLC++ADV+   +L+ LA  + P IC+LK H DI++DF L  MKEL + +K   FL+ EDRKF DIGNTVK Q +   +   SW DL+  H +PG G+++G+    Q+ G  +  GCL++AEMSS GSL   +Y      MA  HS+ V GFI+ S V    P F+H TPGV+LE   DNLGQ Y S  ++      DI IVGRGI  + +  + A +Y+KA ++
Sbjct:   67 SFDTVCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGTINPGETCLIIEDVVTSGSSVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQAHGIRLHSVCTLSKMLEILEQQKKVDAETVGRVKRFIQENVFVAANHNGSPLSIKEAPKELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGL----QEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMK-PEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWE 472          

HSP 2 Score: 58.151 bits (139), Expect = 1.129e-7
Identity = 24/48 (50.00%), Postives = 38/48 (79.17%), Query Frame = 2
Query:   38 LVLRLFDIKAIKFGEFKLKSGLVSPIYLDVREIIGYPKLINEISKAMF 181
            LV  L+D++A KFG+F LKSGL SPIY+D+R I+  P+L+++++  +F
Sbjct:   11 LVTGLYDVQAFKFGDFVLKSGLSSPIYIDLRGIVSRPRLLSQVADILF 58          
BLAST of Uridine 5'-monophosphate synthase vs. UniProt/SwissProt
Match: sp|Q5R514|UMPS_PONAB (Uridine 5'-monophosphate synthase OS=Pongo abelii OX=9601 GN=UMPS PE=2 SV=1)

HSP 1 Score: 335.495 bits (859), Expect = 7.139e-109
Identity = 179/411 (43.55%), Postives = 253/411 (61.56%), Query Frame = 3
Query:  198 NVDQICGVPYTALPIASCISINNNIPMIIKRKEMKDYGTKKLVEGVFEKNMSCCIIEDVITTGSSIIETVKELINVGLKVTEAIVLIDRGQGGKENINNLGITVKSLITLDEILKILLSADKISQTQYHICKEFAEISQVI--------ISVPKKVTEINWKYRYEKSD-NKITKKVFELINTKKTNLCVAADVNTMADLMNLARKIAPFICILKIHSDIIHDFDLSSMKELKSFSKIKNFLLMEDRKFGDIGNTVKLQLQNKHYDYLSWCDLITIHGLPGDGILEGIKSAAQDSGTDI--GCLIVAEMSSKGSLCNAEYKINCAEMALRHSDIVAGFIAQSMVKDDLPGFIHCTPGVKLEKATDNLGQNYKSVSDLKELGFVDIFIVGRGITESKNPDQVASIYQKATFD 1397
            + D +CGVPYTALP+A+ I   N IPM+I+RKE KDYGTK+LVEG      +C IIEDV+T+GSS++ET + L   GLKVT+AIVL+DR QGGK+ +   GI + S+ TL ++L+IL    KI        K F + +  +        +S+ +   E+++  R E    + +  K+  L+  K+TNLC++ADV+   +L+ LA  + P IC+LK H DI++DF L  MKEL + +K   FL+ EDRKF DIGNTVK Q +   +   SW DL+  H +PG G+++G+    Q+ G  +  GCL++AEMSS GSL   +Y      MA  HS+ V GFI+ S V    P F+H TPGV+LE   DNLGQ Y S  ++      DI IVGRGI  + +  + A +Y+KA ++
Sbjct:   67 SFDTVCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGTINPGETCLIIEDVVTSGSSVLETAEVLQKEGLKVTDAIVLLDREQGGKDKLQAHGIRLHSVCTLSKMLEILEQQKKIDAETVGRVKRFIQENVFVAANHNGSPLSIKEAPKELSFSARAELPRIHPVASKLLRLMQKKETNLCLSADVSEARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKRHEFLIFEDRKFADIGNTVKKQYEGGVFKIASWADLVNAHVVPGSGVVKGL----QEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMK-PEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADCLEAAEMYRKAAWE 472          

HSP 2 Score: 58.9214 bits (141), Expect = 5.756e-8
Identity = 24/48 (50.00%), Postives = 38/48 (79.17%), Query Frame = 2
Query:   38 LVLRLFDIKAIKFGEFKLKSGLVSPIYLDVREIIGYPKLINEISKAMF 181
            LV  L+D++A KFG+F LKSGL SPIY+D+R I+  P+L+++++  +F
Sbjct:   11 LVTGLYDVQAFKFGDFVLKSGLSSPIYIDLRGIVSRPRLLSQVADTLF 58          
BLAST of Uridine 5'-monophosphate synthase vs. UniProt/SwissProt
Match: sp|P31754|UMPS_BOVIN (Uridine 5'-monophosphate synthase OS=Bos taurus OX=9913 GN=UMPS PE=2 SV=1)

HSP 1 Score: 334.339 bits (856), Expect = 2.631e-108
Identity = 178/411 (43.31%), Postives = 251/411 (61.07%), Query Frame = 3
Query:  198 NVDQICGVPYTALPIASCISINNNIPMIIKRKEMKDYGTKKLVEGVFEKNMSCCIIEDVITTGSSIIETVKELINVGLKVTEAIVLIDRGQGGKENINNLGITVKSLITLDEILKILLSADKISQTQYHICKEF--------AEISQVIISVPKKVTEINWKYRYE-KSDNKITKKVFELINTKKTNLCVAADVNTMADLMNLARKIAPFICILKIHSDIIHDFDLSSMKELKSFSKIKNFLLMEDRKFGDIGNTVKLQLQNKHYDYLSWCDLITIHGLPGDGILEGIKSAAQDSGTDI--GCLIVAEMSSKGSLCNAEYKINCAEMALRHSDIVAGFIAQSMVKDDLPGFIHCTPGVKLEKATDNLGQNYKSVSDLKELGFVDIFIVGRGITESKNPDQVASIYQKATFD 1397
            N D +CGVPYTALP+A+ +   + IPM+I+RKE KDYGTK+L+EG      +C IIEDV+++GSS+ ET + L   GLKVT+A+VL+DR QGG++N+   GI + S+ TL  +L IL    KI+       K F        A  +  + SV K+  E+++  R E    + +  K+  L+  K+TNLC++ADV+   +L+ LA  +   IC+LKIH DI++DF L  MKEL + +K   FL+ EDRKF DIGNTVK Q +   +   SW DL+  H +PG G+++G+    ++ G  +   CL+VAEMSS G+L    Y     +MA  HS+ V GFI+ S V    P F+H TPGV+LE   DNLGQ Y S  ++      DI IVGRGI  S N  + A +Y+KA ++
Sbjct:   67 NFDTVCGVPYTALPLATIVCSTHEIPMLIRRKEKKDYGTKRLIEGAVNPGDTCLIIEDVVSSGSSVWETAEVLQKEGLKVTDAVVLVDREQGGRDNLQARGIRLHSVCTLSTVLCILEQQKKINAETVERVKRFIQENAFVAANPNDSLPSVKKEPKELSFGARAELPGTHPVAAKLLRLMQKKETNLCLSADVSESRELLQLADALGSRICLLKIHVDILNDFTLDVMKELTTLAKRHEFLIFEDRKFADIGNTVKKQYEGGVFKIASWADLVNAHAVPGSGVVKGL----EEVGLPLHRACLLVAEMSSAGTLATGSYTEAAVQMAEEHSEFVIGFISGSRVSMK-PEFLHLTPGVQLEAGGDNLGQQYHSPQEVIGKRGSDIIIVGRGIIASANQLEAAKMYRKAAWE 472          

HSP 2 Score: 59.3066 bits (142), Expect = 4.504e-8
Identity = 24/51 (47.06%), Postives = 38/51 (74.51%), Query Frame = 2
Query:   29 MDDLVLRLFDIKAIKFGEFKLKSGLVSPIYLDVREIIGYPKLINEISKAMF 181
            +  LV  L+D++A KFG F LKSGL SP+Y+D+R II  P ++N++++ +F
Sbjct:    8 LGSLVTGLYDVQAFKFGNFVLKSGLSSPVYIDLRGIISRPSILNQVAEMLF 58          
BLAST of Uridine 5'-monophosphate synthase vs. UniProt/SwissProt
Match: sp|Q42586|UMPS_ARATH (Uridine 5'-monophosphate synthase OS=Arabidopsis thaliana OX=3702 GN=PYRE-F PE=2 SV=2)

HSP 1 Score: 331.257 bits (848), Expect = 3.410e-107
Identity = 174/404 (43.07%), Postives = 255/404 (63.12%), Query Frame = 3
Query:  204 DQICGVPYTALPIASCISINNNIPMIIKRKEMKDYGTKKLVEGVFEKNMSCCIIEDVITTGSSIIETVKELINVGLKVTEAIVLIDRGQGGKENINNLGITVKSLITLDEILKILLSADKIS-QTQYHICKEFAEISQVIISVP------KKVTEINWKYRYEKSDNKITKKVFELINTKKTNLCVAADVNTMADLMNLARKIAPFICILKIHSDIIHDFDLSSMKELKSFSKIKNFLLMEDRKFGDIGNTVKLQLQNKHYDYLSWCDLITIHGLPGDGILEGIKSAAQDSGTDIGCLIVAEMSSKGSLCNAEYKINCAEMALRHSDIVAGFIAQSMVKDD----LPGFIHCTPGVKLEKATDNLGQNYKSVSDLKELGFVDIFIVGRGITESKNPDQVASIYQ 1382
            D +CGVPYTALPIA+ +S++N IPM+++RKE+KDYGT K +EG+FEK+ +C IIED++T+G+S++ET   L  VGLKV++A+VLIDR QGG+EN+   GI + S+I L +++++L    KI  + + ++ K   E  +V  SVP       K   + +K R E S N   KK+F+++  K+TNLC+AADV T A+L+++A K+ P IC+LK H DI+ DF      +L++ +    FL+ EDRKF DIGNTV +Q +   +  L W D+I  H + G GI++G+K      G   G L++AEMSS G+L   +Y     ++A  HSD V GFI+ +          P  IH TPGV++ K  D LGQ Y +   +      DI IVGRGI +++NP + A  Y+
Sbjct:   64 DVVCGVPYTALPIATVVSVSNGIPMLMRRKEIKDYGTSKAIEGIFEKDQTCLIIEDLVTSGASVLETAAPLRAVGLKVSDAVVLIDRQQGGRENLAENGIKLHSMIMLTDMVRVLKEKGKIEVEVEVNLLKFLEENRRV--SVPSVEKPKPKPRVLGFKERSELSKNPTGKKLFDIMLKKETNLCLAADVGTAAELLDIADKVGPEICLLKTHVDILPDFTPDFGSKLRAIADKHKFLIFEDRKFADIGNTVTMQYEGGIFKILEWADIINAHVISGPGIVDGLKLKGMPRGR--GLLLLAEMSSAGNLATGDYTAAAVKIADAHSDFVMGFISVNPASWKCGYVYPSMIHATPGVQMVKGGDALGQQYNTPHSVITERGSDIIIVGRGIIKAENPAETAHEYR 463          

HSP 2 Score: 63.1586 bits (152), Expect = 2.407e-9
Identity = 26/51 (50.98%), Postives = 40/51 (78.43%), Query Frame = 2
Query:   29 MDDLVLRLFDIKAIKFGEFKLKSGLVSPIYLDVREIIGYPKLINEISKAMF 181
            M+ L+L+L +I A+KFG FKLKSG+ SP+Y+D+R I+ YP L+ +IS+ + 
Sbjct:    4 MEALILQLHEIGAVKFGNFKLKSGIFSPVYIDLRLIVSYPSLLTQISQTLI 54          
BLAST of Uridine 5'-monophosphate synthase vs. UniProt/SwissProt
Match: sp|P13439|UMPS_MOUSE (Uridine 5'-monophosphate synthase OS=Mus musculus OX=10090 GN=Umps PE=1 SV=3)

HSP 1 Score: 327.791 bits (839), Expect = 9.614e-106
Identity = 174/413 (42.13%), Postives = 252/413 (61.02%), Query Frame = 3
Query:  198 NVDQICGVPYTALPIASCISINNNIPMIIKRKEMKDYGTKKLVEGVFEKNMSCCIIEDVITTGSSIIETVKELINVGLKVTEAIVLIDRGQGGKENINNLGITVKSLITLDEILKILLSADKISQTQYHICKEFAEISQVIISVP----------KKVTEINWKYRYE-KSDNKITKKVFELINTKKTNLCVAADVNTMADLMNLARKIAPFICILKIHSDIIHDFDLSSMKELKSFSKIKNFLLMEDRKFGDIGNTVKLQLQNKHYDYLSWCDLITIHGLPGDGILEGIKSAAQDSGTDI--GCLIVAEMSSKGSLCNAEYKINCAEMALRHSDIVAGFIAQSMVKDDLPGFIHCTPGVKLEKATDNLGQNYKSVSDLKELGFVDIFIVGRGITESKNPDQVASIYQKATFD 1397
            + D +CGVPYTALP+A+ I   N+IPM+I+RKE KDYGTK+LVEG      +C +IEDV+T+G+S++ETV+ L   GLKVT+AIVL+DR QGGK+ +   GI + ++ TL ++L+IL   +KI        K F  I + + S            K   E+++  R E    + +  K+  L+  K+TNLC++ADV+   +L+ LA  + P IC+LK H DI++DF L  M+EL + +K   FL+ EDRKF DIGNTVK Q ++  +   SW D++  H +PG G+++G+    Q+ G  +   CL++AEMSS GSL    Y      MA  H + V GFI+ S V    P F+H TPGV+LE   D+LGQ Y S  ++      D+ IVGRGI  + N  + A +Y+KA ++
Sbjct:   67 SFDSVCGVPYTALPLATVICSANHIPMLIRRKETKDYGTKRLVEGEINPGQTCLVIEDVVTSGASVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQAQGIRLHAVCTLSQMLEILQQQEKIDADMVGRVKRF--IQENVFSAANHNGLPPPEKKACKELSFGARAELPGTHPLASKLLRLMQKKETNLCLSADVSEARELLQLADALGPSICMLKTHVDILNDFTLDVMEELTALAKRHEFLIFEDRKFADIGNTVKKQYESGTFKIASWADIVNAHVVPGSGVVKGL----QEVGLPLHRACLLIAEMSSAGSLATGNYTKAAVGMAEEHCEFVIGFISGSRVSMK-PEFLHLTPGVQLETGGDHLGQQYNSPQEVIGKRGSDVIIVGRGILAAANRLEAAEMYRKAAWE 472          

HSP 2 Score: 57.7658 bits (138), Expect = 1.384e-7
Identity = 23/48 (47.92%), Postives = 37/48 (77.08%), Query Frame = 2
Query:   38 LVLRLFDIKAIKFGEFKLKSGLVSPIYLDVREIIGYPKLINEISKAMF 181
            LV  L+D++A KFG F LKSGL SP+Y+D+R I+  P+L+++++  +F
Sbjct:   11 LVTELYDVQAFKFGSFVLKSGLSSPVYIDLRGIVSRPRLLSQVADILF 58          
BLAST of Uridine 5'-monophosphate synthase vs. TrEMBL
Match: A7RH78 (Predicted protein OS=Nematostella vectensis OX=45351 GN=v1g81583 PE=3 SV=1)

HSP 1 Score: 367.081 bits (941), Expect = 9.574e-119
Identity = 181/402 (45.02%), Postives = 258/402 (64.18%), Query Frame = 3
Query:  204 DQICGVPYTALPIASCISINNNIPMIIKRKEMKDYGTKKLVEGVFEKNMSCCIIEDVITTGSSIIETVKELINVGLKVTEAIVLIDRGQGGKENINNLGITVKSLITLDEILKILLSADKISQTQYHICKEFAEISQV-----IISVPKKVTEINWKYRYEKSDNKITKKVFELINTKKTNLCVAADVNTMADLMNLARKIAPFICILKIHSDIIHDFDLSSMKELKSFSKIKNFLLMEDRKFGDIGNTVKLQLQNKHYDYLSWCDLITIHGLPGDGILEGIKSAAQDSGTDIGCLIVAEMSSKGSLCNAEYKINCAEMALRHSDIVAGFIAQSMVKDDLPGFIHCTPGVKLEKATDNLGQNYKSVSDLKELGFVDIFIVGRGITESKNPDQVASIYQKATF 1394
            D ICGVPYTALPIASC+S+NNN PM+++RKE K YGTKKL+EG FE+  +C +IED++T+GSS++ETV+ L +V L+VT+ +VL+DR QGGK+ ++  GI + SL TL  +LK+L +  K+        +EF E +Q      +  VP K  ++++  R E S N + KKVF+++++K+TNL V+ D+    +++NL  ++ P +CI+K H DII DF    +  L++ +   NFL+ EDRKF DIGNTVK Q     Y    W  +   H +PG+G++ G+K      G   GCLI+AEMS+KG+  N EY     EMA  H D V GFI+   + DD PGF+H TPGVKL K  D LGQ Y +  ++      D+ IVGRGI E++NP   A  Y++A +
Sbjct:   67 DVICGVPYTALPIASCMSVNNNAPMVMRRKEAKSYGTKKLIEGHFEEGSTCLVIEDIVTSGSSVLETVESLTSVKLQVTDTVVLLDRCQGGKDKLDCAGIRLHSLFTLPRVLKVLHAQGKVDDAVVESVREFLEANQFKATSDVTPVPPKGRDLSFLKRLEMSSNPVAKKVFKIMHSKETNLAVSVDLTKSGNILNLVNQVGPHVCIVKTHVDIIEDFTPGFVASLQNLATKHNFLIFEDRKFADIGNTVKHQYSKGIYHISDWAHITNAHPVPGEGVITGLKEIGAPKGN--GCLIIAEMSAKGNFANGEYTKAAIEMAKNHQDFVFGFISIGSIVDD-PGFVHMTPGVKLIKGGDALGQQYLTPEEVVGKKGSDVIIVGRGIYEAENPASAAIEYKEAAY 465          
BLAST of Uridine 5'-monophosphate synthase vs. TrEMBL
Match: A0A3M6TMT2 (OMPdecase domain-containing protein OS=Pocillopora damicornis OX=46731 GN=pdam_00025418 PE=3 SV=1)

HSP 1 Score: 348.591 bits (893), Expect = 1.533e-111
Identity = 175/406 (43.10%), Postives = 258/406 (63.55%), Query Frame = 3
Query:  192 QKNVDQICGVPYTALPIASCISINNNIPMIIKRKEMKDYGTKKLVEGVFEKNMSCCIIEDVITTGSSIIETVKELINVGLKVTEAIVLIDRGQGGKENINNLGITVKSLITLDEILKILLSADKISQTQYHICKEFAEIS----QVIISVPKKV-TEINWKYRYEKSDNKITKKVFELINTKKTNLCVAADVNTMADLMNLARKIAPFICILKIHSDIIHDFDLSSMKELKSFSKIKNFLLMEDRKFGDIGNTVKLQLQNKHYDYLSWCDLITIHGLPGDGILEGIKSAAQDSGTDIGCLIVAEMSSKGSLCNAEYKINCAEMALRHSDIVAGFIAQSMVKDDLPGFIHCTPGVKLEKATDNLGQNYKSVSDLKELGFVDIFIVGRGITESKNPDQVASIYQKATF 1394
            + N   ICGVPYTALPIAS IS++ N+PM+++RKE K YGTK+L+EGVF    +C +IEDV+T+GSS++ETV+ L +V L V++A+VL+DR QGGKE +   G+ + SL+TL E+L +LL+  K+ Q       EF   +      +  VP K  ++++++ R + + N +TKK+FE+++ KK+NL V+ D  +   +++L  KI P +CI+K H DI+ DF     K L+  +   N L+ EDRKF DIGNTVK Q     Y    W DL+  H +PGDG++ G+K      G    CL++ EMSSKG+L   EY    A+MA  H D V GFI+ S + +D P F+H TPGV+L    DNLGQ Y +  ++      D+ IVGRGI ++++P + A+ Y++A +
Sbjct:   62 RANFSVICGVPYTALPIASAISVSQNVPMVMRRKEAKSYGTKRLIEGVFTPKSNCLVIEDVVTSGSSVLETVEALASVELVVSDAVVLLDRFQGGKEMLQFQGVKLHSLLTLSEVLDVLLAKGKVGQEMAGKVSEFLSTNTFTPPAVAKVPAKPGSKLSFEARAQIASNSVTKKLFEVMHIKKSNLAVSVDFTSCDKVLSLVDKIGPHVCIVKTHVDILEDFTPEFSKSLQMLAAKHNVLIFEDRKFADIGNTVKNQYSKGLYHIAEWADLVNAHVVPGDGVINGLKEVGLPLGK--ACLLIGEMSSKGTLATGEYTKAAADMAQAHKDFVMGFISLSCLVND-PQFVHMTPGVQLSAGGDNLGQQYLTPEEVILNRGSDVIIVGRGIYQAEDPVKAAAQYKEAAY 464          

HSP 2 Score: 62.7734 bits (151), Expect = 1.172e-6
Identity = 26/58 (44.83%), Postives = 43/58 (74.14%), Query Frame = 2
Query:   32 DDLVLRLFDIKAIKFGEFKLKSGLVSPIYLDVREIIGYPKLINEISKAMFIKMTKKRG 205
            ++L+ +L DI+AIKFG+F LKSG+ SP+Y+D+R I+ YP+++ +IS  ++   T  R 
Sbjct:    6 ENLIEKLHDIQAIKFGDFTLKSGIQSPVYVDLRVIVSYPEILKQISGMLWDVATSSRA 63          
BLAST of Uridine 5'-monophosphate synthase vs. TrEMBL
Match: K7IX88 (OMPdecase domain-containing protein OS=Nasonia vitripennis OX=7425 GN=100123466 PE=3 SV=1)

HSP 1 Score: 347.821 bits (891), Expect = 2.379e-111
Identity = 182/408 (44.61%), Postives = 262/408 (64.22%), Query Frame = 3
Query:  192 QKNVDQICGVPYTALPIASCISINNNIPMIIKRKEMKDYGTKKLVEGVFEKNMSCCIIEDVITTGSSIIETVKELINVGLKVTEAIVLIDRGQGGKENINNLGITVKSLITLDEILKILLSADKISQTQYHICKEFAEISQVIISVPKKVTEINWKY------RYEKSDNKITKKVFELINTKKTNLCVAADVNTMADLMNLARKIAPFICILKIHSDIIHDFDLSSMKELKSFSKIKNFLLMEDRKFGDIGNTVKLQLQNKHYDYLSWCDLITIHGLPGDGILEGIKSAAQDSGTDIGCLIVAEMSSKGSLCNAEYKINCAEMALRHSDIVAGFIAQSMVKDDLPGFIHCTPGVKLEKATDNLGQNYKSVSDLKELGFVDIFIVGRGITESKNPDQVASIYQKATFD 1397
            +K  + +CGVPYTALPIA+ IS  +NIPMII+RKE K YGTKK++EGVF+   +  I+ED+IT+GSS+IETVK+L N GLKV  A+V++DR QGGK+N+ N GI VK+L T+ E++  L  A ++++    + K++  I+ V    P K+ + N +       R + + N    K+F L++ K+T LC+AAD     ++++LA    P I +LKIH DII DFD + +++LKS +   NFL+MEDRKFGDIG TV  Q +N  Y+   W DLIT+H + G G+L+GIK        D G  IVAEMSS+G+L    Y +  A    + SD+ +GF+ Q+ + DD  G I  TPGV+L K+TDNLGQ Y +  D+   G  D+ +VGRGIT++ +       Y+K  ++
Sbjct:   60 KKEFNHVCGVPYTALPIATVISTESNIPMIIRRKEAKSYGTKKMIEGVFKAGDTAVIVEDIITSGSSVIETVKDLQNEGLKVNTALVIVDREQGGKQNLENAGIVVKNLFTITELVGYLQEAGRLNEESVKVVKDY--ITSV--KAPLKIKDFNNRLIQNFLARAKMTKNAAAAKLFRLMSEKQTTLCLAADFTKSQEIIDLANVAGPHIAVLKIHVDIIDDFDKNFIQQLKSIATKYNFLIMEDRKFGDIGQTVSYQYRNGIYNIAEWADLITVHPVSGKGVLQGIKQGLHGISEDRGVFIVAEMSSEGALTTGNY-LTSAVSDSKDSDLTSGFVCQNNIFDD-AGLIQLTPGVQLTKSTDNLGQQYNTPQDVVSKG-ADLVVVGRGITQANDKLSAVLEYKKVLWE 460          

HSP 2 Score: 59.6918 bits (143), Expect = 9.620e-6
Identity = 27/62 (43.55%), Postives = 42/62 (67.74%), Query Frame = 2
Query:   17 FKLRMDDLVLRLFDIKAIKFGEFKLKSGLVSPIYLDVREIIGYPKLINEISKAMFIKMTKKR 202
             K+ + +L + L+DI A+K+G F  K GL +PIY+D+R II YP L+  IS+++F  + KK 
Sbjct:    1 MKIDLKELAVELYDIGAVKYGNFTTKVGLQTPIYIDLRVIISYPDLLRRISESLFNLVDKKE 62          
BLAST of Uridine 5'-monophosphate synthase vs. TrEMBL
Match: A0A3Q7RK13 (uridine 5'-monophosphate synthase OS=Vulpes vulpes OX=9627 GN=UMPS PE=3 SV=1)

HSP 1 Score: 347.051 bits (889), Expect = 8.543e-111
Identity = 185/409 (45.23%), Postives = 252/409 (61.61%), Query Frame = 3
Query:  198 NVDQICGVPYTALPIASCISINNNIPMIIKRKEMKDYGTKKLVEGVFEKNMSCCIIEDVITTGSSIIETVKELINVGLKVTEAIVLIDRGQGGKENINNLGITVKSLITLDEILKILLSADKISQTQYHICKEF--------AEISQVIISVPKKVTEINWKYRYEKSD-NKITKKVFELINTKKTNLCVAADVNTMADLMNLARKIAPFICILKIHSDIIHDFDLSSMKELKSFSKIKNFLLMEDRKFGDIGNTVKLQLQNKHYDYLSWCDLITIHGLPGDGILEGIKSAAQDSGTDIGCLIVAEMSSKGSLCNAEYKINCAEMALRHSDIVAGFIAQSMVKDDLPGFIHCTPGVKLEKATDNLGQNYKSVSDLKELGFVDIFIVGRGITESKNPDQVASIYQKATFD 1397
            N D +CGVPYTALP+A+ I   N IPM+I+RKE KDYGTK+LVEG      +C IIEDV+T+GSS++ETV+ L   GLKVT+AIVL+DR QGGK+ +   GI + S+ TL ++L+IL    KI        K F        A  +  ++SV K   E+++  R E    + +  K+F+L+  K+TNLC++AD++   +L+ LA  + P ICILK H DI++DF L  MKEL + +K   FL+ EDRKF DIGNTVK Q +   +   SW DL+  H +PG G+++G++          GCL++AEMSS GSL    Y      MA  HS+ V GFI+ S V    P F+H TPGV+LE   DNLGQ Y S  ++      DI IVGRGI  S N  + A +Y+KA ++
Sbjct:   67 NFDTVCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGAINPGETCLIIEDVVTSGSSVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQAHGIHLHSVCTLSKMLEILEQQKKIDAEMVERVKRFIQENVFVAANHNDSLLSVNKAPRELSFGARAELPRIHPVASKLFKLMQKKETNLCLSADISESRELLQLADALGPSICILKTHVDILNDFTLDVMKELTALAKRHEFLIFEDRKFADIGNTVKKQYEGGVFKIASWADLVNAHVVPGSGVVQGLREVGLP--LHRGCLLIAEMSSAGSLATGNYTKAAVRMAEEHSEFVVGFISGSRVSMK-PEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIITSFNRLEAAELYRKAAWE 472          
BLAST of Uridine 5'-monophosphate synthase vs. TrEMBL
Match: A0A336KMV5 (CSON010207 protein OS=Culicoides sonorensis OX=179676 GN=CSON013067 PE=3 SV=1)

HSP 1 Score: 346.665 bits (888), Expect = 1.307e-110
Identity = 187/413 (45.28%), Postives = 265/413 (64.16%), Query Frame = 3
Query:  198 NVDQICGVPYTALPIASCISINNNIPMIIKRKEMKDYGTKKLVEGVFEKNMSCCIIEDVITTGSSIIETVKELINVGLKVTEAIVLIDRGQGGKENINNLGITVKSLITLDEILKILLSADKISQTQYHICKEFAEISQVIIS---------VPKKV--TEINWKYRYEKSDNKITKKVFELINTKKTNLCVAADVNTMADLMNLARKIAPFICILKIHSDIIHDFDLSSMKELKSFSKIKNFLLMEDRKFGDIGNTVKLQLQNKHYDYLSWCDLITIHGLPGDGILEGIKSAAQDSGTDIGCLIVAEMSSKGSLCNAEYKINCAEMALRHSDI--VAGFIAQSMVKDDLPGFIHCTPGVKLEKATDNLGQNYKS-VSDLKELGFVDIFIVGRGITESKNPDQVASIYQKATF 1394
            N + +CGVPYTALPIA+ IS+ +N PM+I+RKE KDYGTKKL+EG F  N +C IIEDV+T+GSSI++TVK+L + GL VT++IV++DR QGG  N  N G+ + SL TL  +LK+LL A K+ ++      ++ E  Q+ +          V  K+  T + +  R + + + ++K +F+L++ KK+NLCVAAD+    +++NLA+ I   ICILK+H+DII DF+   +  LKS SK+ NFL+MEDRKF DIGNTV LQ     +    W DL+T H LPG  +L+G+KS   D   + G  ++AE+SS G+L    Y     ++A    DI  V G ++Q+ V D+ PG I  TPGVKLE+  D LGQ Y + +  +KE G  DI +VGRGI E+KN    A  Y+ A +
Sbjct:   68 NYNHVCGVPYTALPIATLISVKDNTPMLIRRKEAKDYGTKKLIEGKFAANETCLIIEDVVTSGSSIMDTVKDLRSEGLNVTDSIVVVDREQGGALNTENNGVKMHSLFTLSYLLKVLLDAGKVEKSTVEAVSKYIETCQIRVDGTFMNENAKVVNKLARTSMTFDSRADLAKSDLSKNLFKLMSIKKSNLCVAADLTKCDEILNLAKLIGSHICILKLHADIIEDFNQDFIASLKSISKMHNFLIMEDRKFADIGNTVALQYSGGVFRISEWADLVTAHSLPGQNVLKGLKSRMGDQLKNRGVFLLAELSSAGNLITPNYTTATMKIATEGCDIDVVTGVVSQNNVLDN-PGLIQLTPGVKLEQGGDELGQQYNTPLHVVKEKG-ADIGVVGRGIYEAKNMAVAAENYRNALW 478          
BLAST of Uridine 5'-monophosphate synthase vs. Ensembl Cavefish
Match: umps (uridine monophosphate synthetase [Source:ZFIN;Acc:ZDB-GENE-040426-785])

HSP 1 Score: 298.516 bits (763), Expect = 1.762e-95
Identity = 162/406 (39.90%), Postives = 239/406 (58.87%), Query Frame = 3
Query:  204 DQICGVPYTALPIASCISINNNIPMIIKRKEMKDYGTKKLVEGVFEKNMSCCIIEDVITTGSSIIETVKELINVGLKVTEAIVLIDRGQGGKENINNLGITVKSLITLDEILKILLSADKISQTQYHICKEFAEISQVIIS-------VPKKVTEINWKYRYE-KSDNKITKKVFELINTKKTNLCVAADVNTMADLMNLARKIAPFICILKIHSDIIHDFDLSSMKELKSFSKIKNFLLMEDRKFGDIGNTVKLQLQNKHYDYLSWCDLITIHGLPGDGILEGIKSAAQDSGTDIGCLIVAEMSSKGSLCNAEYKINCAEMALRHSDIVAGFIAQSMVKDDLPGFIHCTPGVKLEKATDNLGQNYKSVSDLKELGFVDIFIVGRGITESKNPDQVASIYQKATFD 1397
            D +CGVPYTALP+A+ I    N PM+I+RKE KDYG K    G       C I+EDV+T+GSS++ET + L   GLKVT+A+VL+DR QGG   + + G+T+  +I++  +L +LLSA +I Q      + F   +Q   +       V +K  E+++  R      + +  ++  L+  K++NLCV+ADV   A+L+ LA  + P +C+LK H D++ DF       L+  +   +FLL EDRKF DIGNTVK Q Q   Y   SW  ++  H +PG G++EG+++  Q  G   GCL++A+MSS+GSL  AEY     +MA    D V GFI+ S +  + P  IH TPGV+++   D LGQ Y +  ++      DI IVGRGI  S++  + A  Y+KA ++
Sbjct:   66 DCVCGVPYTALPLATIICSTKNYPMLIRRKEAKDYG-KYTCYGNIRPGDKCLIVEDVVTSGSSVLETAQVLQAEGLKVTDAVVLLDREQGGGAKLEDEGVTLHPVISISTLLSVLLSAGRIDQEMCSSVERFVRENQTFRAGQENGSVVKRKCEELSYSARAALPGAHPLAARLLRLMEQKRSNLCVSADVTAAAELLELAELLGPLMCVLKTHVDVLQDFTPELRDRLQEIAHKHDFLLFEDRKFADIGNTVKHQYQGGVYQISSWAHIVNAHAVPGPGVVEGLRAVGQSLGR--GCLLIAQMSSQGSLATAEYTQAVVKMAESFPDFVFGFISGSKISSN-PELIHMTPGVQMQSGGDGLGQQYTTPDEVIGSKGSDIIIVGRGIIASEDRLKAAEEYRKAGWE 467          

HSP 2 Score: 71.633 bits (174), Expect = 1.762e-95
Identity = 28/48 (58.33%), Postives = 41/48 (85.42%), Query Frame = 2
Query:   38 LVLRLFDIKAIKFGEFKLKSGLVSPIYLDVREIIGYPKLINEISKAMF 181
            LVL LFD++A+KFG+FKLKSGL SP+Y D+R I+ YP+L+N++S  ++
Sbjct:    8 LVLELFDVRAVKFGQFKLKSGLTSPVYFDLRVIVSYPQLLNQVSSLLY 55          
BLAST of Uridine 5'-monophosphate synthase vs. Ensembl Yeast
Match: URA3 (Orotidine-5'-phosphate (OMP) decarboxylase; catalyzes the sixth enzymatic step in the de novo biosynthesis of pyrimidines, converting OMP into uridine monophosphate (UMP); converts 5-FOA into 5-fluorouracil, a toxic compound [Source:SGD;Acc:S000000747])

HSP 1 Score: 179.874 bits (455), Expect = 1.912e-53
Identity = 101/258 (39.15%), Postives = 150/258 (58.14%), Query Frame = 3
Query:  639 VTEINWKYRYEKSDNKITKKVFELINTKKTNLCVAADVNTMADLMNLARKIAPFICILKIHSDIIHDFDL-SSMKELKSFSKIKNFLLMEDRKFGDIGNTVKLQLQNKHYDYLSWCDLITIHGLPGDGILEGIKSAAQD-SGTDIGCLIVAEMSSKGSLCNAEYKINCAEMALRHSDIVAGFIAQSMV--KDDLPGFIHCTPGVKLEKATDNLGQNYKSVSDLKELGFVDIFIVGRGI-TESKNPDQVASIYQKATFD 1397
            +++  +K R     + +  K+F +++ K+TNLC + DV T  +L+ L   + P IC+LK H DI+ DF +  ++K LK+ S   NFLL EDRKF DIGNTVKLQ     Y    W D+   HG+ G GI+ G+K AA++ +    G L++AE+S KGSL   EY     ++A    D V GFIAQ  +  +D+   ++  TPGV L+   D LGQ Y++V D+   G  DI IVGRG+  + ++       Y+KA ++
Sbjct:    1 MSKATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELLELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFEDRKFADIGNTVKLQYSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLATGEYTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDDVVSTG-SDIIIVGRGLFAKGRDAKVEGERYRKAGWE 257          
BLAST of Uridine 5'-monophosphate synthase vs. Ensembl Yeast
Match: URA5 (Major orotate phosphoribosyltransferase (OPRTase) isozyme; catalyzes the fifth enzymatic step in de novo biosynthesis of pyrimidines, converting orotate into orotidine-5'-phosphate; URA5 has a paralog, URA10, that arose from the whole genome duplication [Source:SGD;Acc:S000004574])

HSP 1 Score: 48.9062 bits (115), Expect = 4.471e-7
Identity = 35/148 (23.65%), Postives = 67/148 (45.27%), Query Frame = 3
Query:   48 DCSILRXXXXXXXXXXQD*FHQFIWMFEKSLVIQNLLMKFPKPCLLK*QKNVDQICGVPYTALPIASCISIN---------NNIPMIIKRKEMKDYGTKKLVEGVFEKNMSCCIIEDVITTGSSIIETVKELINVGLKVTEAIVLIDR 464
            +C  LR  +    +  +  +   + +F    ++ NL   +    +++     D I G  Y  +P+A+ + +           NI     RKE KD+G   ++ G   +N    II+DV+T G++I E  + + N   +V  +I+ +DR
Sbjct:   18 ECQALRFGSFKLKSGRESPYFFNLGLFNTGKLLSNLATAYA-IAIIQSDLKFDVIFGPAYKGIPLAAIVCVKLAEIGGSKFQNIQYAFNRKEAKDHGEGGIIVGSALENKRILIIDDVMTAGTAINEAFEIISNAKGQVVGSIIALDR 164          
BLAST of Uridine 5'-monophosphate synthase vs. Ensembl Nematostella
Match: EDO49175 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH78])

HSP 1 Score: 367.081 bits (941), Expect = 1.324e-122
Identity = 181/402 (45.02%), Postives = 258/402 (64.18%), Query Frame = 3
Query:  204 DQICGVPYTALPIASCISINNNIPMIIKRKEMKDYGTKKLVEGVFEKNMSCCIIEDVITTGSSIIETVKELINVGLKVTEAIVLIDRGQGGKENINNLGITVKSLITLDEILKILLSADKISQTQYHICKEFAEISQV-----IISVPKKVTEINWKYRYEKSDNKITKKVFELINTKKTNLCVAADVNTMADLMNLARKIAPFICILKIHSDIIHDFDLSSMKELKSFSKIKNFLLMEDRKFGDIGNTVKLQLQNKHYDYLSWCDLITIHGLPGDGILEGIKSAAQDSGTDIGCLIVAEMSSKGSLCNAEYKINCAEMALRHSDIVAGFIAQSMVKDDLPGFIHCTPGVKLEKATDNLGQNYKSVSDLKELGFVDIFIVGRGITESKNPDQVASIYQKATF 1394
            D ICGVPYTALPIASC+S+NNN PM+++RKE K YGTKKL+EG FE+  +C +IED++T+GSS++ETV+ L +V L+VT+ +VL+DR QGGK+ ++  GI + SL TL  +LK+L +  K+        +EF E +Q      +  VP K  ++++  R E S N + KKVF+++++K+TNL V+ D+    +++NL  ++ P +CI+K H DII DF    +  L++ +   NFL+ EDRKF DIGNTVK Q     Y    W  +   H +PG+G++ G+K      G   GCLI+AEMS+KG+  N EY     EMA  H D V GFI+   + DD PGF+H TPGVKL K  D LGQ Y +  ++      D+ IVGRGI E++NP   A  Y++A +
Sbjct:   67 DVICGVPYTALPIASCMSVNNNAPMVMRRKEAKSYGTKKLIEGHFEEGSTCLVIEDIVTSGSSVLETVESLTSVKLQVTDTVVLLDRCQGGKDKLDCAGIRLHSLFTLPRVLKVLHAQGKVDDAVVESVREFLEANQFKATSDVTPVPPKGRDLSFLKRLEMSSNPVAKKVFKIMHSKETNLAVSVDLTKSGNILNLVNQVGPHVCIVKTHVDIIEDFTPGFVASLQNLATKHNFLIFEDRKFADIGNTVKHQYSKGIYHISDWAHITNAHPVPGEGVITGLKEIGAPKGN--GCLIIAEMSAKGNFANGEYTKAAIEMAKNHQDFVFGFISIGSIVDD-PGFVHMTPGVKLIKGGDALGQQYLTPEEVVGKKGSDVIIVGRGIYEAENPASAAIEYKEAAY 465          

HSP 2 Score: 58.5362 bits (140), Expect = 3.461e-9
Identity = 24/48 (50.00%), Postives = 37/48 (77.08%), Query Frame = 2
Query:   38 LVLRLFDIKAIKFGEFKLKSGLVSPIYLDVREIIGYPKLINEISKAMF 181
            L+ +LF+I A KFG+F LKSG+ SP+Y+D+R I+ YP ++  +SK M+
Sbjct:    9 LIAQLFEINAFKFGKFTLKSGIDSPVYIDLRVIVSYPDVLQSVSKLMW 56          
BLAST of Uridine 5'-monophosphate synthase vs. Ensembl Nematostella
Match: EDO26601 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TBK6])

HSP 1 Score: 50.447 bits (119), Expect = 1.199e-8
Identity = 25/71 (35.21%), Postives = 39/71 (54.93%), Query Frame = 3
Query:  204 DQICGVPYTALPIASCISINNNIPMIIKRKEMKDYGTKKLVEGVFEKNMSCCIIEDVITTGSSIIETVKEL 416
            D I GV   A+ I   ++    +P +  R E K +G K  +EG  EK  +  +IED+I+TG S ++ V+ L
Sbjct:   52 DVIAGVATGAIAIGILVAQELGVPFVYVRPEAKKHGRKNQIEGHLEKGQNVVVIEDLISTGKSSLQAVEAL 122          

HSP 2 Score: 26.9498 bits (58), Expect = 1.199e-8
Identity = 14/41 (34.15%), Postives = 21/41 (51.22%), Query Frame = 2
Query:   83 FKLKSGLVSPIYLDVREIIGYPKLINEISKAMFIKMTKKRG 205
            F   SG  SPIY D R  + +P + N + + +   + KK G
Sbjct:    9 FNWASGWKSPIYCDNRITLSFPSVRNFLKEEIAKLVEKKHG 49          
BLAST of Uridine 5'-monophosphate synthase vs. Ensembl Medaka
Match: umps (uridine monophosphate synthetase [Source:NCBI gene;Acc:101156482])

HSP 1 Score: 306.99 bits (785), Expect = 1.181e-98
Identity = 166/410 (40.49%), Postives = 242/410 (59.02%), Query Frame = 3
Query:  210 ICGVPYTALPIASCISINNNIPMIIKRKEMKDYGTKKLVEGVFEKNMSCCIIEDVITTGSSIIETVKELINVGLKVTEAIVLIDRGQGGKENINNLGITVKSLITLDEILKILLSADKISQTQYHICKEFAEISQVIISVPKKVTE-------INWKYRYEKSD-------NKITKKVFELINTKKTNLCVAADVNTMADLMNLARKIAPFICILKIHSDIIHDFDLSSMKELKSFSKIKNFLLMEDRKFGDIGNTVKLQLQNKHYDYLSWCDLITIHGLPGDGILEGIKSAAQDSGTDIGCLIVAEMSSKGSLCNAEYKINCAEMALRHSDIVAGFIAQSMVKDDLPGFIHCTPGVKLEKATDNLGQNYKSVSDLKELGFVDIFIVGRGITESKNPDQVASIYQKATFD 1397
            +CGVPYTALP+A+ I   + +PM+I+RKE KDYGTKKLVEG F    +C IIED +T+GSSI+ET   L   GLKVT+A+VL+DR QGG E + + GI +  +I++ ++L +LL+A +I        + F + +    S  +   E       ++ K     +D       + +  K+ +++  K++NLCV+ADV +  +L+ LA  + P IC+LK H DI+ DF      +L+  +   NFL+ EDRKF DIGNTVK Q +   Y   SW  ++  H +PG G++ G+ +  +  G   GCL++A+MSS GSL    Y     +MA  HSD V GFI  S V    P FIH TPGV+LE   D+LGQ Y +  ++      DI IVGRGI E+ +  + A  Y+++ +D
Sbjct:   69 VCGVPYTALPLATIICSTHELPMLIRRKEAKDYGTKKLVEGSFRGGDTCLIIEDTVTSGSSILETADVLCKEGLKVTDAVVLMDREQGGVEMLASRGIRLLPVISMFKLLDVLLAAGRIDGPTAQSVRRFIQDNNTFSSKKENGGEAATKKPCLDLKREQSYADRAQLPNVHPLASKLLQIMEEKQSNLCVSADVTSSEELLQLADLLGPKICVLKTHVDILKDFTQDFSLKLQVLADKHNFLIFEDRKFADIGNTVKHQYEGGVYQISSWSHIVNAHAVPGPGVVRGLCAVGKPLGR--GCLLLAQMSSSGSLATGGYTAAAVQMAEEHSDFVMGFICCSKVTQS-PQFIHMTPGVQLEAGGDSLGQQYATPEEVICRRGSDIIIVGRGILEAPDRLKAAESYRQSGWD 475          

HSP 2 Score: 68.5514 bits (166), Expect = 6.495e-12
Identity = 27/61 (44.26%), Postives = 49/61 (80.33%), Query Frame = 2
Query:   23 LRMDDLVLRLFDIKAIKFGEFKLKSGLVSPIYLDVREIIGYPKLINEISKAMFIKMTKKRG 205
            + +D L+L+L D+ A+KFGE+KLKSGL++PIY+D+R ++ +P+L+N++S  ++ +  K+ G
Sbjct:    4 VSVDGLILKLHDVNAVKFGEYKLKSGLMTPIYIDLRVLVSHPRLMNQVSSLIY-RCVKEEG 63          
BLAST of Uridine 5'-monophosphate synthase vs. Planmine SMEST
Match: SMESG000010153.1 (SMESG000010153.1)

HSP 1 Score: 818.535 bits (2113), Expect = 0.000e+0
Identity = 404/416 (97.12%), Postives = 407/416 (97.84%), Query Frame = 3
Query:  153 LLMKFPKPCLLK*QKNVDQICGVPYTALPIASCISINNNIPMIIKRKEMKDYGTKKLVEGVFEKNMSCCIIEDVITTGSSIIETVKELINVGLKVTEAIVLIDRGQGGKENINNLGITVKSLITLDEILKILLSADKISQTQYHICKEFAEISQVIISVPKKVTEINWKYRYEKSDNKITKKVFELINTKKTNLCVAADVNTMADLMNLARKIAPFICILKIHSDIIHDFDLSSMKELKSFSKIKNFLLMEDRKFGDIGNTVKLQLQNKHYDYLSWCDLITIHGLPGDGILEGIKSAAQDSGTDIGCLIVAEMSSKGSLCNAEYKINCAEMALRHSDIVAGFIAQSMVKDDLPGFIHCTPGVKLEKATDNLGQNYKSVSDLKELGFVDIFIVGRGITESKNPDQVASIYQKATFDY 1400
            L+ +  K   +K  KNVDQICGVPYTALPIASCISINNNIPMIIKRKEMKDYGTKKLVEGVFEKNMSCCIIEDVITTGSSIIETVKEL NVGLKVTEAIVLIDRGQGGKENINNLGITVKSLITLDEILKILLSADKISQTQYHICKEFAEISQVIISVPKKVTEINWKYRYEKSDNKITKKVFELINTKKTNLCVAADVNTMADLMNLARKIAPFICILKIHSDIIHDFDLSSMKELKSFSKIKNFLLMEDRKFGDIGNTVKLQLQNKHYDYLSWCDLITIHGLPGDGILEGIKSAAQDSGTDIGCLIVAEMSSKGSLCNAEYKINCAEMALRHSDIVAGFIAQSMVKDDLPGFIHCTPGVKLEKATDNLGQNYKSVSDLKELGFVDIFIVGRGITESKNPDQVASIYQKATFDY
Sbjct:   42 LINEISKAMFIKMTKNVDQICGVPYTALPIASCISINNNIPMIIKRKEMKDYGTKKLVEGVFEKNMSCCIIEDVITTGSSIIETVKELTNVGLKVTEAIVLIDRGQGGKENINNLGITVKSLITLDEILKILLSADKISQTQYHICKEFAEISQVIISVPKKVTEINWKYRYEKSDNKITKKVFELINTKKTNLCVAADVNTMADLMNLARKIAPFICILKIHSDIIHDFDLSSMKELKSFSKIKNFLLMEDRKFGDIGNTVKLQLQNKHYDYLSWCDLITIHGLPGDGILEGIKSAAQDSGTDIGCLIVAEMSSKGSLCNAEYKINCAEMALRHSDIVAGFIAQSMVKDDLPGFIHCTPGVKLEKATDNLGQNYKSVSDLKELGFVDIFIVGRGITESKNPDQVASIYQKATFDY 457          

HSP 2 Score: 114.005 bits (284), Expect = 4.652e-27
Identity = 56/56 (100.00%), Postives = 56/56 (100.00%), Query Frame = 2
Query:   29 MDDLVLRLFDIKAIKFGEFKLKSGLVSPIYLDVREIIGYPKLINEISKAMFIKMTK 196
            MDDLVLRLFDIKAIKFGEFKLKSGLVSPIYLDVREIIGYPKLINEISKAMFIKMTK
Sbjct:    1 MDDLVLRLFDIKAIKFGEFKLKSGLVSPIYLDVREIIGYPKLINEISKAMFIKMTK 56          
The following BLAST results are available for this feature:
BLAST of Uridine 5'-monophosphate synthase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
UMPS6.344e-11043.55uridine monophosphate synthetase [Source:HGNC Symb... [more]
UMPS7.435e-7045.25uridine monophosphate synthetase [Source:HGNC Symb... [more]
UMPS1.483e-2054.55uridine monophosphate synthetase [Source:HGNC Symb... [more]
UMPS3.697e-948.94uridine monophosphate synthetase [Source:HGNC Symb... [more]
UMPS3.697e-948.94uridine monophosphate synthetase [Source:HGNC Symb... [more]
back to top
BLAST of Uridine 5'-monophosphate synthase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
umps-14.126e-7333.49Uridine 5'-monophosphate synthase Orotate phosphor... [more]
umps-14.126e-7333.49Uridine 5'-monophosphate synthase Orotate phosphor... [more]
R12E2.112.989e-3240.94Orotate phosphoribosyltransferase [Source:UniProt... [more]
R12E2.112.989e-3240.94Orotate phosphoribosyltransferase [Source:UniProt... [more]
back to top
BLAST of Uridine 5'-monophosphate synthase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
r-l1.172e-10140.63gene:FBgn0003257 transcript:FBtr0084038[more]
back to top
BLAST of Uridine 5'-monophosphate synthase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
umps1.728e-10141.38uridine monophosphate synthetase [Source:ZFIN;Acc:... [more]
back to top
BLAST of Uridine 5'-monophosphate synthase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Uridine 5'-monophosphate synthase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Umps1.374e-10642.13uridine monophosphate synthetase [Source:MGI Symbo... [more]
Umps1.313e-948.94uridine monophosphate synthetase [Source:MGI Symbo... [more]
back to top
BLAST of Uridine 5'-monophosphate synthase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P11172|UMPS_HUMAN3.047e-10943.55Uridine 5'-monophosphate synthase OS=Homo sapiens ... [more]
sp|Q5R514|UMPS_PONAB7.139e-10943.55Uridine 5'-monophosphate synthase OS=Pongo abelii ... [more]
sp|P31754|UMPS_BOVIN2.631e-10843.31Uridine 5'-monophosphate synthase OS=Bos taurus OX... [more]
sp|Q42586|UMPS_ARATH3.410e-10743.07Uridine 5'-monophosphate synthase OS=Arabidopsis t... [more]
sp|P13439|UMPS_MOUSE9.614e-10642.13Uridine 5'-monophosphate synthase OS=Mus musculus ... [more]
back to top
BLAST of Uridine 5'-monophosphate synthase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A7RH789.574e-11945.02Predicted protein OS=Nematostella vectensis OX=453... [more]
A0A3M6TMT21.533e-11143.10OMPdecase domain-containing protein OS=Pocillopora... [more]
K7IX882.379e-11144.61OMPdecase domain-containing protein OS=Nasonia vit... [more]
A0A3Q7RK138.543e-11145.23uridine 5'-monophosphate synthase OS=Vulpes vulpes... [more]
A0A336KMV51.307e-11045.28CSON010207 protein OS=Culicoides sonorensis OX=179... [more]
back to top
BLAST of Uridine 5'-monophosphate synthase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
umps1.762e-9539.90uridine monophosphate synthetase [Source:ZFIN;Acc:... [more]
back to top
BLAST of Uridine 5'-monophosphate synthase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Uridine 5'-monophosphate synthase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
URA31.912e-5339.15Orotidine-5'-phosphate (OMP) decarboxylase; cataly... [more]
URA54.471e-723.65Major orotate phosphoribosyltransferase (OPRTase) ... [more]
back to top
BLAST of Uridine 5'-monophosphate synthase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO491751.324e-12245.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO266011.199e-835.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Uridine 5'-monophosphate synthase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
umps1.181e-9840.49uridine monophosphate synthetase [Source:NCBI gene... [more]
back to top
BLAST of Uridine 5'-monophosphate synthase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000010153.14.652e-2797.12SMESG000010153.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011127 ID=SMED30011127|Name=Uridine 5'-monophosphate synthase|organism=Schmidtea mediterranea sexual|type=transcript|length=1540bp
TTCTACAAGATCAAATTTTAAATTAAGAATGGACGATCTGGTTCTTCGAT
TGTTCGATATTAAGGCTATTAAATTTGGTGAATTTAAATTAAAATCAGGA
TTAGTTTCACCAATTTATCTGGATGTTCGAGAAATCATTGGTTATCCAAA
ACTTATTAATGAAATTTCCAAAGCCATGTTTATTAAAATGACAAAAAAAC
GTGGACCAAATTTGTGGAGTTCCTTATACTGCCTTACCTATTGCTTCTTG
TATTAGTATTAATAATAATATCCCTATGATCATTAAAAGAAAAGAAATGA
AAGATTACGGTACAAAAAAGTTAGTAGAAGGTGTATTTGAAAAAAATATG
AGTTGCTGTATAATTGAAGATGTAATTACAACAGGTTCGAGTATTATAGA
AACTGTAAAGGAGTTAATAAATGTCGGATTGAAAGTTACAGAAGCTATTG
TTTTGATTGATCGAGGTCAAGGAGGAAAAGAAAATATAAATAACTTAGGA
ATTACTGTGAAAAGTTTAATAACATTAGATGAAATATTAAAAATTTTACT
GTCTGCTGATAAAATTAGTCAAACTCAATATCACATTTGTAAGGAATTTG
CTGAAATATCTCAAGTTATTATTTCAGTTCCAAAAAAAGTAACCGAAATT
AATTGGAAATATCGATATGAGAAGTCGGATAATAAAATTACGAAAAAAGT
ATTTGAATTGATAAATACTAAGAAAACAAATTTATGCGTCGCGGCCGACG
TGAATACAATGGCGGACTTAATGAACCTTGCAAGAAAAATTGCACCATTT
ATTTGTATTCTGAAAATTCATTCTGACATTATTCATGATTTTGATTTAAG
CTCAATGAAAGAATTAAAAAGTTTTTCAAAAATCAAAAATTTTTTATTGA
TGGAAGACAGAAAATTTGGCGATATTGGAAATACAGTAAAGTTACAATTA
CAGAACAAGCATTATGATTATTTATCATGGTGTGATCTAATCACAATTCA
TGGCCTACCAGGCGATGGGATTTTGGAAGGGATTAAATCTGCTGCACAAG
ATTCAGGCACAGATATTGGATGTTTGATTGTGGCGGAAATGAGTTCTAAA
GGTTCTCTTTGTAACGCAGAATATAAAATTAATTGTGCTGAAATGGCATT
GCGTCATAGTGATATTGTTGCTGGATTTATTGCTCAGTCAATGGTTAAAG
ACGATTTACCTGGATTCATTCATTGCACTCCGGGAGTGAAATTAGAAAAA
GCCACCGATAATCTCGGACAAAATTATAAATCGGTATCTGATTTGAAGGA
ATTGGGTTTTGTAGATATTTTCATTGTCGGGCGTGGCATCACTGAAAGTA
AAAATCCTGATCAGGTAGCTAGTATTTATCAAAAAGCCACTTTTGATTAT
TAGGAACTTTGATGTATATTTTTATGTATATCCTGTTTATTGAATGTTTT
TGAATTATATATTAACTGTTTGAACACGAAAGTTGACTAATGTTGCATAG
AACCACTATTATTTTTTTGTTTAAGGCGATTAAAGGGTTT
back to top

protein sequence of SMED30011127-orf-1

>SMED30011127-orf-1 ID=SMED30011127-orf-1|Name=SMED30011127-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=376bp
MIIKRKEMKDYGTKKLVEGVFEKNMSCCIIEDVITTGSSIIETVKELINV
GLKVTEAIVLIDRGQGGKENINNLGITVKSLITLDEILKILLSADKISQT
QYHICKEFAEISQVIISVPKKVTEINWKYRYEKSDNKITKKVFELINTKK
TNLCVAADVNTMADLMNLARKIAPFICILKIHSDIIHDFDLSSMKELKSF
SKIKNFLLMEDRKFGDIGNTVKLQLQNKHYDYLSWCDLITIHGLPGDGIL
EGIKSAAQDSGTDIGCLIVAEMSSKGSLCNAEYKINCAEMALRHSDIVAG
FIAQSMVKDDLPGFIHCTPGVKLEKATDNLGQNYKSVSDLKELGFVDIFI
VGRGITESKNPDQVASIYQKATFDY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR001754OMPdeCOase_dom
IPR029057PRTase-like
IPR000836PRibTrfase_dom
IPR013785Aldolase_TIM
IPR018089OMPdecase_AS
IPR011060RibuloseP-bd_barrel
Vocabulary: biological process
TermDefinition
GO:0006207'de novo' pyrimidine nucleobase biosynthetic process
GO:0009116nucleoside metabolic process
GO:0008152metabolic process
GO:0006221pyrimidine nucleotide biosynthetic process
GO:0006222UMP biosynthetic process
GO:0007565female pregnancy
GO:0007595lactation
GO:0035690cellular response to drug
GO:0044205'de novo' UMP biosynthetic process
GO:0046134pyrimidine nucleoside biosynthetic process
Vocabulary: molecular function
TermDefinition
GO:0004590orotidine-5'-phosphate decarboxylase activity
GO:0003824catalytic activity
GO:0004588orotate phosphoribosyltransferase activity
GO:0016740transferase activity
GO:0016757transferase activity, transferring glycosyl groups
GO:0016829lyase activity
GO:0016831carboxy-lyase activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005829cytosol
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR029057Phosphoribosyltransferase-likeGENE3DG3DSA:3.40.50.2020coord: 1..84
e-value: 9.6E-21
score: 76.1
IPR029057Phosphoribosyltransferase-likeSUPERFAMILYSSF53271PRTase-likecoord: 8..83
NoneNo IPR availablePANTHERPTHR19278FAMILY NOT NAMEDcoord: 10..84
NoneNo IPR availablePANTHERPTHR19278:SF42coord: 10..84