Kinesin-like protein

Overview
NameKinesin-like protein
Smed IDSMED30011124
Length (bp)2774
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Kinesin-like protein (SMED30011124) t-SNE clustered cells

Violin plots show distribution of expression levels for Kinesin-like protein (SMED30011124) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011124

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30011124SMESG000030838.1 Contig4032_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Kinesin-like protein vs. Ensembl Human
Match: KIFC3 (kinesin family member C3 [Source:HGNC Symbol;Acc:HGNC:6326])

HSP 1 Score: 275.789 bits (704), Expect = 3.558e-80
Identity = 155/382 (40.58%), Postives = 230/382 (60.21%), Query Frame = 2
Query: 1415 QSVMAEV----KKVNDLKQEIVKLEKSKENIGVQLQQEVVLRKTYYNQIEDIKGKIRVFSRCRPISKSELDRGNVQCVKFPDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIK--KDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIK 2542
            +SV AE+    ++VN   QE+++          + ++E+ LRK  +N++  +KG IRV +R RP++K + +          D    ++  +   GKP  F+ D+VF P+  Q DVF++   L+ S  DG+NVCIFAYGQTG+GKT+T+ G  +N PGI  R+   LF  + E  + +  T+     E+YNE L DL+    E  +KLEI+   D  G + VPG      +S D++  +F  G+ NR    T +N  SSRSH ++ + +  V  ++G    GK++++DLAGSER  KSG +G    EA  IN SLSALGDVI+AL S Q  +P+RN+KLT L+QDSL G+SKTLM V +SPV+ N +ET  SL +A+RV+ ++
Sbjct:  262 RSVKAEIGQAIEEVNSNNQELLR----------KYRRELQLRKKCHNELVRLKGNIRVIARVRPVTKEDGEGPEATNAVTFDADDDSIIHLLHKGKPVSFELDKVFSPQASQQDVFQEVQALVTSCIDGFNVCIFAYGQTGAGKTYTMEGTAEN-PGINQRALQLLFSEVQEKASDWEYTITVSAAEIYNEVLRDLL--GKEPQEKLEIRLCPDGSGQLYVPGLTEFQVQSVDDINKVFEFGHTNRTTEFTNLNEHSSRSHALLIVTVRGVDCSTGLRTTGKLNLVDLAGSERVGKSGAEGSRLREAQHINKSLSALGDVIAALRSRQGHVPFRNSKLTYLLQDSLSGDSKTLMVVQVSPVEKNTSETLYSLKFAERVRSVE 630          
BLAST of Kinesin-like protein vs. Ensembl Human
Match: KIFC3 (kinesin family member C3 [Source:HGNC Symbol;Acc:HGNC:6326])

HSP 1 Score: 275.789 bits (704), Expect = 3.558e-80
Identity = 155/382 (40.58%), Postives = 230/382 (60.21%), Query Frame = 2
Query: 1415 QSVMAEV----KKVNDLKQEIVKLEKSKENIGVQLQQEVVLRKTYYNQIEDIKGKIRVFSRCRPISKSELDRGNVQCVKFPDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIK--KDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIK 2542
            +SV AE+    ++VN   QE+++          + ++E+ LRK  +N++  +KG IRV +R RP++K + +          D    ++  +   GKP  F+ D+VF P+  Q DVF++   L+ S  DG+NVCIFAYGQTG+GKT+T+ G  +N PGI  R+   LF  + E  + +  T+     E+YNE L DL+    E  +KLEI+   D  G + VPG      +S D++  +F  G+ NR    T +N  SSRSH ++ + +  V  ++G    GK++++DLAGSER  KSG +G    EA  IN SLSALGDVI+AL S Q  +P+RN+KLT L+QDSL G+SKTLM V +SPV+ N +ET  SL +A+RV+ ++
Sbjct:  262 RSVKAEIGQAIEEVNSNNQELLR----------KYRRELQLRKKCHNELVRLKGNIRVIARVRPVTKEDGEGPEATNAVTFDADDDSIIHLLHKGKPVSFELDKVFSPQASQQDVFQEVQALVTSCIDGFNVCIFAYGQTGAGKTYTMEGTAEN-PGINQRALQLLFSEVQEKASDWEYTITVSAAEIYNEVLRDLL--GKEPQEKLEIRLCPDGSGQLYVPGLTEFQVQSVDDINKVFEFGHTNRTTEFTNLNEHSSRSHALLIVTVRGVDCSTGLRTTGKLNLVDLAGSERVGKSGAEGSRLREAQHINKSLSALGDVIAALRSRQGHVPFRNSKLTYLLQDSLSGDSKTLMVVQVSPVEKNTSETLYSLKFAERVRSVE 630          
BLAST of Kinesin-like protein vs. Ensembl Human
Match: KIFC3 (kinesin family member C3 [Source:HGNC Symbol;Acc:HGNC:6326])

HSP 1 Score: 275.789 bits (704), Expect = 3.558e-80
Identity = 155/382 (40.58%), Postives = 230/382 (60.21%), Query Frame = 2
Query: 1415 QSVMAEV----KKVNDLKQEIVKLEKSKENIGVQLQQEVVLRKTYYNQIEDIKGKIRVFSRCRPISKSELDRGNVQCVKFPDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIK--KDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIK 2542
            +SV AE+    ++VN   QE+++          + ++E+ LRK  +N++  +KG IRV +R RP++K + +          D    ++  +   GKP  F+ D+VF P+  Q DVF++   L+ S  DG+NVCIFAYGQTG+GKT+T+ G  +N PGI  R+   LF  + E  + +  T+     E+YNE L DL+    E  +KLEI+   D  G + VPG      +S D++  +F  G+ NR    T +N  SSRSH ++ + +  V  ++G    GK++++DLAGSER  KSG +G    EA  IN SLSALGDVI+AL S Q  +P+RN+KLT L+QDSL G+SKTLM V +SPV+ N +ET  SL +A+RV+ ++
Sbjct:  262 RSVKAEIGQAIEEVNSNNQELLR----------KYRRELQLRKKCHNELVRLKGNIRVIARVRPVTKEDGEGPEATNAVTFDADDDSIIHLLHKGKPVSFELDKVFSPQASQQDVFQEVQALVTSCIDGFNVCIFAYGQTGAGKTYTMEGTAEN-PGINQRALQLLFSEVQEKASDWEYTITVSAAEIYNEVLRDLL--GKEPQEKLEIRLCPDGSGQLYVPGLTEFQVQSVDDINKVFEFGHTNRTTEFTNLNEHSSRSHALLIVTVRGVDCSTGLRTTGKLNLVDLAGSERVGKSGAEGSRLREAQHINKSLSALGDVIAALRSRQGHVPFRNSKLTYLLQDSLSGDSKTLMVVQVSPVEKNTSETLYSLKFAERVRSVE 630          
BLAST of Kinesin-like protein vs. Ensembl Human
Match: KIFC3 (kinesin family member C3 [Source:HGNC Symbol;Acc:HGNC:6326])

HSP 1 Score: 276.174 bits (705), Expect = 5.537e-80
Identity = 155/382 (40.58%), Postives = 230/382 (60.21%), Query Frame = 2
Query: 1415 QSVMAEV----KKVNDLKQEIVKLEKSKENIGVQLQQEVVLRKTYYNQIEDIKGKIRVFSRCRPISKSELDRGNVQCVKFPDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIK--KDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIK 2542
            +SV AE+    ++VN   QE+++          + ++E+ LRK  +N++  +KG IRV +R RP++K + +          D    ++  +   GKP  F+ D+VF P+  Q DVF++   L+ S  DG+NVCIFAYGQTG+GKT+T+ G  +N PGI  R+   LF  + E  + +  T+     E+YNE L DL+    E  +KLEI+   D  G + VPG      +S D++  +F  G+ NR    T +N  SSRSH ++ + +  V  ++G    GK++++DLAGSER  KSG +G    EA  IN SLSALGDVI+AL S Q  +P+RN+KLT L+QDSL G+SKTLM V +SPV+ N +ET  SL +A+RV+ ++
Sbjct:  299 RSVKAEIGQAIEEVNSNNQELLR----------KYRRELQLRKKCHNELVRLKGNIRVIARVRPVTKEDGEGPEATNAVTFDADDDSIIHLLHKGKPVSFELDKVFSPQASQQDVFQEVQALVTSCIDGFNVCIFAYGQTGAGKTYTMEGTAEN-PGINQRALQLLFSEVQEKASDWEYTITVSAAEIYNEVLRDLL--GKEPQEKLEIRLCPDGSGQLYVPGLTEFQVQSVDDINKVFEFGHTNRTTEFTNLNEHSSRSHALLIVTVRGVDCSTGLRTTGKLNLVDLAGSERVGKSGAEGSRLREAQHINKSLSALGDVIAALRSRQGHVPFRNSKLTYLLQDSLSGDSKTLMVVQVSPVEKNTSETLYSLKFAERVRSVE 667          
BLAST of Kinesin-like protein vs. Ensembl Human
Match: KIFC3 (kinesin family member C3 [Source:HGNC Symbol;Acc:HGNC:6326])

HSP 1 Score: 274.633 bits (701), Expect = 1.184e-78
Identity = 155/382 (40.58%), Postives = 230/382 (60.21%), Query Frame = 2
Query: 1415 QSVMAEV----KKVNDLKQEIVKLEKSKENIGVQLQQEVVLRKTYYNQIEDIKGKIRVFSRCRPISKSELDRGNVQCVKFPDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIK--KDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIK 2542
            +SV AE+    ++VN   QE+++          + ++E+ LRK  +N++  +KG IRV +R RP++K + +          D    ++  +   GKP  F+ D+VF P+  Q DVF++   L+ S  DG+NVCIFAYGQTG+GKT+T+ G  +N PGI  R+   LF  + E  + +  T+     E+YNE L DL+    E  +KLEI+   D  G + VPG      +S D++  +F  G+ NR    T +N  SSRSH ++ + +  V  ++G    GK++++DLAGSER  KSG +G    EA  IN SLSALGDVI+AL S Q  +P+RN+KLT L+QDSL G+SKTLM V +SPV+ N +ET  SL +A+RV+ ++
Sbjct:  401 RSVKAEIGQAIEEVNSNNQELLR----------KYRRELQLRKKCHNELVRLKGNIRVIARVRPVTKEDGEGPEATNAVTFDADDDSIIHLLHKGKPVSFELDKVFSPQASQQDVFQEVQALVTSCIDGFNVCIFAYGQTGAGKTYTMEGTAEN-PGINQRALQLLFSEVQEKASDWEYTITVSAAEIYNEVLRDLL--GKEPQEKLEIRLCPDGSGQLYVPGLTEFQVQSVDDINKVFEFGHTNRTTEFTNLNEHSSRSHALLIVTVRGVDCSTGLRTTGKLNLVDLAGSERVGKSGAEGSRLREAQHINKSLSALGDVIAALRSRQGHVPFRNSKLTYLLQDSLSGDSKTLMVVQVSPVEKNTSETLYSLKFAERVRSVE 769          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: klp-20 (Kinesin-like protein klp-20 [Source:UniProtKB/Swiss-Prot;Acc:Q965T6])

HSP 1 Score: 249.595 bits (636), Expect = 1.466e-71
Identity = 140/345 (40.58%), Postives = 211/345 (61.16%), Query Frame = 2
Query: 1565 KIRVFSRCRPISKSELDRGNVQCVKFPDK-YTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSR-LIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAP--GIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIKKDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQP-FIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIKNDATKVADTEEFPK 2584
            K++V  RCRPIS +E  +G+   V   D+   V +  +S++  P+ F FD VF P   Q  V+   +R ++++   GYN  IFAYGQTG+GKT T+ G+L+     GI P SF  +F+ + + +   +  ++   LE+YNE++ DL++ +  ++  LEIK+     V V        +++ +++ L   G+ NR + +T MN ESSRSH + ++ IE  +  +G + +GK+ ++DLAGSER +K+G +G    EA  IN+SLS LG+VIS+L  G+   IPYRN+KLT L+QDSLGGNSKT+M  N+ P  YN  ET ++L YA R K I+N    VA   E PK
Sbjct:    6 KVKVVVRCRPISTTEKLQGHKIAVTCNDEEKAVNIKSLSQEDPPRTFYFDAVFSPNTDQMTVYNVAARPIVENVLKGYNGTIFAYGQTGTGKTFTMAGDLEPVEMRGIIPNSFAHIFDHIAKCQHDTTFLVRVSYLEIYNEEIRDLLSKD--HNGNLEIKERPDVGVYVRNLSNPTVENASKMQALMEFGSKNRKVGATAMNLESSRSHAMFTVTIESCR--NGLVTQGKLQLVDLAGSERQSKTGAQGERLKEAAKINLSLSTLGNVISSLVDGKSTHIPYRNSKLTRLLQDSLGGNSKTVMIANVGPATYNYDETLSTLRYANRAKNIQN----VAKINEDPK 342          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: klp-20 (Kinesin-like protein klp-20 [Source:UniProtKB/Swiss-Prot;Acc:Q965T6])

HSP 1 Score: 249.595 bits (636), Expect = 1.466e-71
Identity = 140/345 (40.58%), Postives = 211/345 (61.16%), Query Frame = 2
Query: 1565 KIRVFSRCRPISKSELDRGNVQCVKFPDK-YTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSR-LIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAP--GIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIKKDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQP-FIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIKNDATKVADTEEFPK 2584
            K++V  RCRPIS +E  +G+   V   D+   V +  +S++  P+ F FD VF P   Q  V+   +R ++++   GYN  IFAYGQTG+GKT T+ G+L+     GI P SF  +F+ + + +   +  ++   LE+YNE++ DL++ +  ++  LEIK+     V V        +++ +++ L   G+ NR + +T MN ESSRSH + ++ IE  +  +G + +GK+ ++DLAGSER +K+G +G    EA  IN+SLS LG+VIS+L  G+   IPYRN+KLT L+QDSLGGNSKT+M  N+ P  YN  ET ++L YA R K I+N    VA   E PK
Sbjct:    6 KVKVVVRCRPISTTEKLQGHKIAVTCNDEEKAVNIKSLSQEDPPRTFYFDAVFSPNTDQMTVYNVAARPIVENVLKGYNGTIFAYGQTGTGKTFTMAGDLEPVEMRGIIPNSFAHIFDHIAKCQHDTTFLVRVSYLEIYNEEIRDLLSKD--HNGNLEIKERPDVGVYVRNLSNPTVENASKMQALMEFGSKNRKVGATAMNLESSRSHAMFTVTIESCR--NGLVTQGKLQLVDLAGSERQSKTGAQGERLKEAAKINLSLSTLGNVISSLVDGKSTHIPYRNSKLTRLLQDSLGGNSKTVMIANVGPATYNYDETLSTLRYANRAKNIQN----VAKINEDPK 342          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: klp-20 (Kinesin-like protein klp-20 [Source:UniProtKB/Swiss-Prot;Acc:Q965T6])

HSP 1 Score: 249.595 bits (636), Expect = 1.466e-71
Identity = 140/345 (40.58%), Postives = 211/345 (61.16%), Query Frame = 2
Query: 1565 KIRVFSRCRPISKSELDRGNVQCVKFPDK-YTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSR-LIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAP--GIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIKKDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQP-FIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIKNDATKVADTEEFPK 2584
            K++V  RCRPIS +E  +G+   V   D+   V +  +S++  P+ F FD VF P   Q  V+   +R ++++   GYN  IFAYGQTG+GKT T+ G+L+     GI P SF  +F+ + + +   +  ++   LE+YNE++ DL++ +  ++  LEIK+     V V        +++ +++ L   G+ NR + +T MN ESSRSH + ++ IE  +  +G + +GK+ ++DLAGSER +K+G +G    EA  IN+SLS LG+VIS+L  G+   IPYRN+KLT L+QDSLGGNSKT+M  N+ P  YN  ET ++L YA R K I+N    VA   E PK
Sbjct:    6 KVKVVVRCRPISTTEKLQGHKIAVTCNDEEKAVNIKSLSQEDPPRTFYFDAVFSPNTDQMTVYNVAARPIVENVLKGYNGTIFAYGQTGTGKTFTMAGDLEPVEMRGIIPNSFAHIFDHIAKCQHDTTFLVRVSYLEIYNEEIRDLLSKD--HNGNLEIKERPDVGVYVRNLSNPTVENASKMQALMEFGSKNRKVGATAMNLESSRSHAMFTVTIESCR--NGLVTQGKLQLVDLAGSERQSKTGAQGERLKEAAKINLSLSTLGNVISSLVDGKSTHIPYRNSKLTRLLQDSLGGNSKTVMIANVGPATYNYDETLSTLRYANRAKNIQN----VAKINEDPK 342          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: klp-3 (Kinesin-like protein klp-3 [Source:UniProtKB/Swiss-Prot;Acc:P45962])

HSP 1 Score: 240.736 bits (613), Expect = 9.902e-69
Identity = 132/338 (39.05%), Postives = 203/338 (60.06%), Query Frame = 2
Query: 1526 RKTYYNQIEDIKGKIRVFSRCRPISKSELDRGNVQCVKFPDKYTVAVYGVSKDGKPKEFQF--DRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLM-TANAEYSDKLEIKKDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRV 2530
            RK  +NQ+ ++ G IRVF R RP   SE D  N + V   D+    V  VS     ++     D+V P +  QD +F + S +I S  DGYNVCIFAYG TGSGKT+T+ G +   PGI  R+ ++LFE   E        +K  M+E+YNEK+ DL+ T+N      L I++ + G   +PG E +   S++E+ +   +G  N+ +A+T+ N ESSRSH+I+ +++      +     G+++++DLAGSER +++   G    EA AIN SLS LG+V+ AL   Q  IP+RN +LT +++DSL G+SKTL+ V+LSP   +  E+ +S+ +A+++
Sbjct:  232 RKQLHNQLVELNGNIRVFYRIRPQLASETD--NQKPVVVIDEMDNGVVHVSNTTGTRKTSAGADKVIPTDFSQDQIFNEVSPIITSCIDGYNVCIFAYGHTGSGKTYTMDGPV-TMPGINQRAIMQLFETAKERTGDIKYDIKVAMMEIYNEKIRDLLNTSNT----NLAIRQTEEGRSSIPGLEEVSVNSAEEVTETLARGRKNKAVAATEANIESSRSHVIVRVLVSATNLITKATTVGRLNLVDLAGSERVSQTNATGQLLKEAQAINKSLSELGNVVLALRQNQKHIPFRNCQLTRILEDSLNGDSKTLVIVHLSPDAKSLNESISSVNFAEKI 562          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: klp-11 (Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc:E5QCG4])

HSP 1 Score: 236.498 bits (602), Expect = 6.934e-66
Identity = 136/335 (40.60%), Postives = 194/335 (57.91%), Query Frame = 2
Query: 1568 IRVFSRCRPISKSELDRGNVQCVKF-PDKYTVAVYGVSKDGKP-KEFQFDRVFPPEIGQDDVFEDTSR-LIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAP--GIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIKKDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECV---QHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQ-PFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIKN 2545
            ++V  RCRP+S  E+     + V   P +  + +    +  +P K+F FD ++     Q D++E+T R L+ S  +GYN  IFAYGQTG+GKTHT+ G   +    G+  +    +FE M     +       Y LE+Y E+L DL+   AE + KLEIK+   G V V        ++  E+ ++ ++GNG+R +  T MN  SSRSH I  + +EC    +     I  G+++++DLAGSER +K+G  G    EAT IN+SLSALG+VISAL   +   IPYR++KLT L+QDSLGGNSKT+M   + P  YN  ET  +L YA R K IKN
Sbjct:   14 VKVIVRCRPLSSQEIANNYSKIVHMRPQRGQIELKNPKEQDEPSKDFTFDAIYDENSTQSDLYEETFRDLVDSVLNGYNATIFAYGQTGTGKTHTMEGKSSDPEQRGVIYKCIDHIFEHMAASHNQEYLVRASY-LEIYQEELRDLL--EAESNKKLEIKERPDGGVYVKDLTSKLTRTVGEIHEVMIRGNGHRSVGRTNMNEHSSRSHAIFIITVECSRIGEDGESHITVGRLNLVDLAGSERQSKTGATGERFKEATKINLSLSALGNVISALVDAKSAHIPYRDSKLTRLLQDSLGGNSKTVMVACIGPASYNFEETLGTLRYANRAKNIKN 345          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: Klp64D (gene:FBgn0004380 transcript:FBtr0077157)

HSP 1 Score: 237.654 bits (605), Expect = 7.711e-67
Identity = 142/345 (41.16%), Postives = 203/345 (58.84%), Query Frame = 2
Query: 1544 QIEDIKGKIRVFSRCRPISKSELDRGNVQCV---KFPDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSR-LIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAP---GIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIKKDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKI--VR-GKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQP-FIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIKN 2545
            Q++D    +RV  R RP+ K+EL  G +  +   K     TV     + +  PK + FD VF     Q D++ DT+R ++    +GYN  I AYGQTG+GKT+T+ GN  ++P   GI P +F  +F  + + K      ++   +E+YNE++ DL+  +   S  LE+K+     V V         ++D+L ++   GN NR + +TKMN ESSRSH I S+ +E  +   G +  VR GK+ ++DLAGSER +K+   G    EAT IN+SLS LG+VISAL  G+   IPYRN+KLT L+QDSLGGNSKT+M   +SP D N  ET ++L YA R K I+N
Sbjct:   13 QLDDEIENVRVVVRTRPMDKNELSAGALSAISVDKINRAITVMKPNATANEPPKTYYFDNVFDGGSNQMDLYVDTARPIVDKVLEGYNGTILAYGQTGTGKTYTMSGN-PDSPQTKGIIPNAFAHIFGHIAKAKENQKFLVRVSYMEIYNEEVRDLLGKDVGKS--LEVKERPDIGVFVKDLSGYVVHNADDLENIMRLGNKNRAVGATKMNQESSRSHAIFSITVERSELGEGDVQHVRMGKLQLVDLAGSERQSKTQASGQRLKEATKINLSLSVLGNVISALVDGKSTHIPYRNSKLTRLLQDSLGGNSKTVMCATISPADSNYMETISTLRYASRAKNIQN 354          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: Kif3C (gene:FBgn0039925 transcript:FBtr0089196)

HSP 1 Score: 228.024 bits (580), Expect = 1.046e-63
Identity = 138/339 (40.71%), Postives = 203/339 (59.88%), Query Frame = 2
Query: 1568 IRVFSRCRPISKSELDRGNVQCVKFPDKYTVAVYGVS-KDGKPKEFQFDRVFPPEIGQDDVFEDTS-RLIQSAFDGYNVCIFAYGQTGSGKTHTLIG--NLQNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIKKDQHGM-VVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIE-------CVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQP-FIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIKN 2545
            I+V  RCRP++++E +R N Q +   +++ V+V   S +  + K+F FD V+  +   + ++++    L++S  +GYN  IFAYGQTG GKTHT+ G  N  N+ GI P+ F  +FE ++         L  Y LE+YNE++ DL+  N   +      K+  G+ V VP     P  ++++  D    GN NR  A+T MN  SSRSH I ++ +E           A G I RGK+S++DLAGSER  K+G +G    EA+ IN+SLSALG+VIS+L  G+   +P+R++KLT L+QDSLGGN+KTLM   +SP D +  ET ++L YA R K I N
Sbjct:    5 IKVVVRCRPMNQTEKER-NCQNIVEINEFAVSVTNPSARISQQKKFIFDSVYNMKTDTEVIYDEMCYSLVESTIEGYNGTIFAYGQTGCGKTHTMQGDENFSNSTGIIPKCFDHIFERISMTTNVRYLALVTY-LEIYNERIRDLLNKNENTNVINHFLKELPGIGVSVPTLTTQPVVNANQCYDWLHFGNKNRVTAATLMNKNSSRSHTIFTITLEQSPFLNSIGSDAFGGICRGKLSLVDLAGSERQRKTGAQGDRLKEASQINLSLSALGNVISSLVDGKAKHVPFRDSKLTRLLQDSLGGNTKTLMISCISPTDIHYDETISTLRYASRAKNISN 341          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: Klp68D (gene:FBgn0004381 transcript:FBtr0332129)

HSP 1 Score: 229.565 bits (584), Expect = 2.406e-63
Identity = 136/356 (38.20%), Postives = 202/356 (56.74%), Query Frame = 2
Query: 1568 IRVFSRCRPISKSELDRGNVQCVK-FPDKYTVAVYGVSKDGKP--KEFQFDRVFPPEIGQDDVFEDTS-RLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAP--GIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIKKDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIKNDATKVADTEE--FPKLQAIIEKLQ 2611
            ++V  RCRP+S  E    + + V  +P++  V +  V    K   K F +D  +     Q  ++ +    L+ S  +G+N CIFAYGQTG+GKT T+ G   N    GI PR+F +++ +       F   +    LE+Y E+L DL+  N+++   LE+++   G V VP    +  KS +++  +   GN NR +  T MN  SSRSH I  + IE     +  I  GK+++IDLAGSER +K+G       EA+ IN++LS+LG+VISAL    P +PYR++KLT L+QDSLGGNSKT+M  N+ P +YN  ET  +L YA R K I+N   K  D ++    + Q  IE+L+
Sbjct:   20 VQVVVRCRPMSNRERSERSPEVVNVYPNRGVVELQNVVDGNKEQRKVFTYDAAYDASATQTTLYHEVVFPLVSSVLEGFNGCIFAYGQTGTGKTFTMEGVRGNDELMGIIPRTFEQIW-LHINRTENFQFLVDVSYLEIYMEELRDLLKPNSKH---LEVRERGSG-VYVPNLHAINCKSVEDMIKVMQVGNKNRTVGFTNMNEHSSRSHAIFMIKIEMCDTETNTIKVGKLNLIDLAGSERQSKTGASAERLKEASKINLALSSLGNVISALAESSPHVPYRDSKLTRLLQDSLGGNSKTIMIANIGPSNYNYNETLTTLRYASRAKSIQNQPIKNEDPQDAKLKEYQEEIERLK 370          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: Klp68D (gene:FBgn0004381 transcript:FBtr0076030)

HSP 1 Score: 229.565 bits (584), Expect = 2.406e-63
Identity = 136/356 (38.20%), Postives = 202/356 (56.74%), Query Frame = 2
Query: 1568 IRVFSRCRPISKSELDRGNVQCVK-FPDKYTVAVYGVSKDGKP--KEFQFDRVFPPEIGQDDVFEDTS-RLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAP--GIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIKKDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIKNDATKVADTEE--FPKLQAIIEKLQ 2611
            ++V  RCRP+S  E    + + V  +P++  V +  V    K   K F +D  +     Q  ++ +    L+ S  +G+N CIFAYGQTG+GKT T+ G   N    GI PR+F +++ +       F   +    LE+Y E+L DL+  N+++   LE+++   G V VP    +  KS +++  +   GN NR +  T MN  SSRSH I  + IE     +  I  GK+++IDLAGSER +K+G       EA+ IN++LS+LG+VISAL    P +PYR++KLT L+QDSLGGNSKT+M  N+ P +YN  ET  +L YA R K I+N   K  D ++    + Q  IE+L+
Sbjct:   20 VQVVVRCRPMSNRERSERSPEVVNVYPNRGVVELQNVVDGNKEQRKVFTYDAAYDASATQTTLYHEVVFPLVSSVLEGFNGCIFAYGQTGTGKTFTMEGVRGNDELMGIIPRTFEQIW-LHINRTENFQFLVDVSYLEIYMEELRDLLKPNSKH---LEVRERGSG-VYVPNLHAINCKSVEDMIKVMQVGNKNRTVGFTNMNEHSSRSHAIFMIKIEMCDTETNTIKVGKLNLIDLAGSERQSKTGASAERLKEASKINLALSSLGNVISALAESSPHVPYRDSKLTRLLQDSLGGNSKTIMIANIGPSNYNYNETLTTLRYASRAKSIQNQPIKNEDPQDAKLKEYQEEIERLK 370          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: ncd (gene:FBgn0002924 transcript:FBtr0344976)

HSP 1 Score: 224.557 bits (571), Expect = 4.700e-62
Identity = 161/441 (36.51%), Postives = 234/441 (53.06%), Query Frame = 2
Query: 1250 SLSETDSKSLIVGSQRKSLTVGMNEKINFFIFKSKEIDDEVVQIKKDMEKLAKEQQSVMAEVKKVNDLKQEIVKLEKSK----ENIGVQLQQEVVLRKTYYNQIEDIKGKIRVFSRCRPISKSELDRGNVQCV-KFPDKYTVAVYGVSKDGKPKE----FQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAPGIAPRSFVRLFEVMTEGKA-KFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIKKDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIK 2542
            SL  T S +  +  Q K  T  + E I   + ++KE   E+ +++   EK+  E  ++  EV  +    +E+++  + +    E    QL Q  + RK  +N + D++G IRVF R RP  +SE +R  + C   + D+ TV +  +    K K     F FD+VF P   Q D+FE  S LIQSA DGYN+CIFAYGQTGSGKT+T+ G +  + G+ PR+   LF+ +   +   +   +K   LE+YNE L DL+ +N +   ++ + K+    + V           + LR L      NR  AST  N  SSRSH +  + +        +I  G ++++DLAGSE S K+  +    TE   IN SLS L +VI AL   Q  IPYRN+KLT L+  SLGGNSKTLMF+N+SP      E+  SL +A  V   K
Sbjct:  243 SLKNTQSDNECLQRQVKQHTAKI-ETITSTLGRTKE---ELSELQAIHEKVKTEHAALSTEVVHLRQRTEELLRCNEQQAAELETCKEQLFQSNMERKELHNTVMDLRGNIRVFCRIRPPLESEENR--MCCTWTYHDESTVELQSIDAQAKSKMGQQIFSFDQVFHPLSSQSDIFEMVSPLIQSALDGYNICIFAYGQTGSGKTYTMDG-VPESVGVIPRTVDLLFDSIRGYRNLGWEYEIKATFLEIYNEVLYDLL-SNEQKDMEIRMAKNNKNDIYVSNITEETVLDPNHLRHLMHTAKMNRATASTAGNERSSRSHAVTKLELIGRHAEKQEISVGSINLVDLAGSE-SPKTSTR---MTETKNINRSLSELTNVILALLQKQDHIPYRNSKLTHLLMPSLGGNSKTLMFINVSPFQDCFQESVKSLRFAASVNSCK 671          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: si:dkey-96l17.6 (si:dkey-96l17.6 [Source:ZFIN;Acc:ZDB-GENE-060526-350])

HSP 1 Score: 389.037 bits (998), Expect = 5.779e-127
Identity = 195/372 (52.42%), Postives = 265/372 (71.24%), Query Frame = 2
Query: 1523 LRKTYYNQIEDIKGKIRVFSRCRPISKSELDRGNVQCVKFPDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNL-QNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAE-YSDKLEIKKDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIKNDATKVADTEEFPKLQAIIEKLQSGVKIDD 2632
            LRK YYN +ED+KGKIRVF R RP++++E  +     V   D Y+V +        P+EFQFD++F  E  Q++VF ++S LIQ A DG+NVCIFAYG TGSGKT T++G+  +  PG+ PR+F R+FE++ + ++KF   +  YMLELYN++L DL  + AE ++ ++EIK+D+ G+V   GAE   A S+ EL  LF +G+ NRHIA+TKMN ESSRSHLII +MIE     +G +  GK+S++DLAGSER+AK+G K     EA +IN SLSALGDVISAL+  QP +PYRNNKLT LMQDSLGGN+KTLM +N+SP D N  ET  SL+YA RVK I N+A +  D++E  +L+ +I KL+SG  +++
Sbjct:    1 LRKKYYNMVEDMKGKIRVFCRIRPLTRAEQAKKGHITVACLDDYSVIL---ETPRGPREFQFDKIFNTECTQEEVFIESSGLIQCAIDGFNVCIFAYGHTGSGKTFTMVGDRDRRNPGLIPRTFTRIFEIIQDNESKFEFKVSAYMLELYNDRLQDLFVSPAEAFNKRIEIKRDRKGLVFAQGAETKDAASAGELFALFEQGSANRHIAATKMNVESSRSHLIIGIMIESRNLTNGSVSFGKLSLVDLAGSERAAKTGAKDDQLKEANSINKSLSALGDVISALSMEQPHVPYRNNKLTQLMQDSLGGNAKTLMILNISPSDCNLDETLTSLIYATRVKAITNNAQRNVDSKEIAQLKEVILKLKSGQPVEE 369          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: si:dkey-96l17.6 (si:dkey-96l17.6 [Source:ZFIN;Acc:ZDB-GENE-060526-350])

HSP 1 Score: 365.155 bits (936), Expect = 7.103e-118
Identity = 185/360 (51.39%), Postives = 254/360 (70.56%), Query Frame = 2
Query: 1559 KGKIRVFSRCRPISKSELDRGNVQCVKFPDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNL-QNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAE-YSDKLEIKKDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIKNDATKVADTEEFPKLQAIIEKLQSGVKIDD 2632
            + KIRVF R RP++++E  +     V   D Y+V +        P+EFQFD++F  E  Q++VF ++S LIQ A DG+NVCIFAYG TGSGKT T++G+  +  PG+ PR+F R+FE++ + ++KF   +  YMLELYN++L DL  + AE ++ ++EIK+D+ G+V   GAE   A S+ EL  LF +G+ NRHIA+TKMN ESSRSHLII +MIE     +G +  GK+S++DLAGSER+AK+G K     EA +IN SLSALGDVISAL+  QP +PYRNNKLT LMQDSLGGN+KTLM +N+SP D N  ET  SL+YA RVK I N+A +  D++E  +L+ +I KL+SG  +++
Sbjct:   16 QSKIRVFCRIRPLTRAEQAKKGHITVACLDDYSVIL---ETPRGPREFQFDKIFNTECTQEEVFIESSGLIQCAIDGFNVCIFAYGHTGSGKTFTMVGDRDRRNPGLIPRTFTRIFEIIQDNESKFEFKVSAYMLELYNDRLQDLFVSPAEAFNKRIEIKRDRKGLVFAQGAETKDAASAGELFALFEQGSANRHIAATKMNVESSRSHLIIGIMIESRNLTNGSVSFGKLSLVDLAGSERAAKTGAKDDQLKEANSINKSLSALGDVISALSMEQPHVPYRNNKLTQLMQDSLGGNAKTLMILNISPSDCNLDETLTSLIYATRVKAITNNAQRNVDSKEIAQLKEVILKLKSGQPVEE 372          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: kifc3 (kinesin family member C3 [Source:ZFIN;Acc:ZDB-GENE-030131-3724])

HSP 1 Score: 272.707 bits (696), Expect = 2.465e-79
Identity = 149/375 (39.73%), Postives = 229/375 (61.07%), Query Frame = 2
Query: 1436 KKVNDLKQEIVKL----EKSKENIGVQLQQEVVLRKTYYNQIEDIKGKIRVFSRCRPISKSELDRGNVQCVKFPDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIK--KDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIK 2542
            K + + KQEI ++      + + +  + ++E+ LRK  +N++  +KG IRV  R RP+   E D  + + +   D    AV  +S  GK   F+ D+VF  +  Q++VF++   L+ S  DG+NVCIFAYGQTGSGKT+T+ G +   PGI  R+   LF  ++E K  +   +   M+E+YNE L +L+  N   ++KL+IK   D  G + VPG      +S +++  +F  G+ NR  A T +N  SSRSH ++ + +     ++G    GK++++DLAGSER AKSG +G    EA  IN SLSALGDVI++L S    +P+RN++LT L+QDSL G+SKTLM V +SP++ N +E+  SL +AQRV+ ++
Sbjct:  277 KAIAEAKQEICQVIGEVSSANQELLRKYKREMNLRKKCHNELVRLKGNIRVLCRVRPVCAGEADAADTKNLVTFDPEDDAVLYLSNKGKLMTFELDKVFTTQATQEEVFQEVQSLVTSCIDGFNVCIFAYGQTGSGKTYTMEG-IPEDPGINQRALRLLFSEVSEKKPDWDYKITVSMVEIYNETLRNLLGDNP--NEKLDIKMCPDGSGQLYVPGLSEFTVESVEDINKVFDLGHMNRATACTNLNEHSSRSHALLIITVAGFNSSTGHRTSGKLNLVDLAGSERIAKSGAEGSRLREAQCINKSLSALGDVINSLRSKHSHVPFRNSRLTYLLQDSLSGDSKTLMMVQVSPLESNISESVCSLKFAQRVRTVE 648          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: kifc3 (kinesin family member C3 [Source:ZFIN;Acc:ZDB-GENE-030131-3724])

HSP 1 Score: 272.707 bits (696), Expect = 1.168e-78
Identity = 149/375 (39.73%), Postives = 229/375 (61.07%), Query Frame = 2
Query: 1436 KKVNDLKQEIVKL----EKSKENIGVQLQQEVVLRKTYYNQIEDIKGKIRVFSRCRPISKSELDRGNVQCVKFPDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIK--KDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIK 2542
            K + + KQEI ++      + + +  + ++E+ LRK  +N++  +KG IRV  R RP+   E D  + + +   D    AV  +S  GK   F+ D+VF  +  Q++VF++   L+ S  DG+NVCIFAYGQTGSGKT+T+ G +   PGI  R+   LF  ++E K  +   +   M+E+YNE L +L+  N   ++KL+IK   D  G + VPG      +S +++  +F  G+ NR  A T +N  SSRSH ++ + +     ++G    GK++++DLAGSER AKSG +G    EA  IN SLSALGDVI++L S    +P+RN++LT L+QDSL G+SKTLM V +SP++ N +E+  SL +AQRV+ ++
Sbjct:  306 KAIAEAKQEICQVIGEVSSANQELLRKYKREMNLRKKCHNELVRLKGNIRVLCRVRPVCAGEADAADTKNLVTFDPEDDAVLYLSNKGKLMTFELDKVFTTQATQEEVFQEVQSLVTSCIDGFNVCIFAYGQTGSGKTYTMEG-IPEDPGINQRALRLLFSEVSEKKPDWDYKITVSMVEIYNETLRNLLGDNP--NEKLDIKMCPDGSGQLYVPGLSEFTVESVEDINKVFDLGHMNRATACTNLNEHSSRSHALLIITVAGFNSSTGHRTSGKLNLVDLAGSERIAKSGAEGSRLREAQCINKSLSALGDVINSLRSKHSHVPFRNSRLTYLLQDSLSGDSKTLMMVQVSPLESNISESVCSLKFAQRVRTVE 677          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: kifc3 (kinesin family member C3 [Source:ZFIN;Acc:ZDB-GENE-030131-3724])

HSP 1 Score: 272.707 bits (696), Expect = 1.933e-78
Identity = 149/375 (39.73%), Postives = 229/375 (61.07%), Query Frame = 2
Query: 1436 KKVNDLKQEIVKL----EKSKENIGVQLQQEVVLRKTYYNQIEDIKGKIRVFSRCRPISKSELDRGNVQCVKFPDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIK--KDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIK 2542
            K + + KQEI ++      + + +  + ++E+ LRK  +N++  +KG IRV  R RP+   E D  + + +   D    AV  +S  GK   F+ D+VF  +  Q++VF++   L+ S  DG+NVCIFAYGQTGSGKT+T+ G +   PGI  R+   LF  ++E K  +   +   M+E+YNE L +L+  N   ++KL+IK   D  G + VPG      +S +++  +F  G+ NR  A T +N  SSRSH ++ + +     ++G    GK++++DLAGSER AKSG +G    EA  IN SLSALGDVI++L S    +P+RN++LT L+QDSL G+SKTLM V +SP++ N +E+  SL +AQRV+ ++
Sbjct:  334 KAIAEAKQEICQVIGEVSSANQELLRKYKREMNLRKKCHNELVRLKGNIRVLCRVRPVCAGEADAADTKNLVTFDPEDDAVLYLSNKGKLMTFELDKVFTTQATQEEVFQEVQSLVTSCIDGFNVCIFAYGQTGSGKTYTMEG-IPEDPGINQRALRLLFSEVSEKKPDWDYKITVSMVEIYNETLRNLLGDNP--NEKLDIKMCPDGSGQLYVPGLSEFTVESVEDINKVFDLGHMNRATACTNLNEHSSRSHALLIITVAGFNSSTGHRTSGKLNLVDLAGSERIAKSGAEGSRLREAQCINKSLSALGDVINSLRSKHSHVPFRNSRLTYLLQDSLSGDSKTLMMVQVSPLESNISESVCSLKFAQRVRTVE 705          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: ENSXETT00000033878.1 (kinesin family member C2 [Source:NCBI gene;Acc:100485082])

HSP 1 Score: 259.996 bits (663), Expect = 8.084e-76
Identity = 148/360 (41.11%), Postives = 218/360 (60.56%), Query Frame = 2
Query: 1463 IVKLEKSKENIGVQLQQEVVLRKTYYNQIEDIKGKIRVFSRCRPISKSELDRGNVQ---CVKFPDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIKKDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGK-IVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRV 2530
            I  + +S +++  + Q+EV LRK Y+NQ+ ++KG IRV  R RP S +  + G++     +   D   ++V+     GK K F+ D+VF P+  Q++VF++   ++ S  +GYNVCIFAYGQTGSGKT+T+ G L+N PGI  R+   L++ M   K  +  T+   M+E+YNE + DL++ + +    +++  D  G + VPG       S   ++ L   G  NR    T MN  SSRSH ++++ I      SGK +  GK++++DLAGSER  KSG +G    EA  IN SL ALG+VI AL + Q  IP+RN+KLT L+QDSLG  +KT+M V +SP + N  ET  SL +AQRV
Sbjct:   83 ITDVSESNKDLLAKYQREVQLRKRYHNQLVELKGNIRVLCRVRPHSHNNEEEGSLTSPITIDMNDDTRLSVF---YKGKEKNFELDKVFVPQAKQEEVFQEIEPMVMSCINGYNVCIFAYGQTGSGKTYTMEGTLEN-PGINQRAMQALYKEMEARKGLWHYTVSLSMVEIYNEVIRDLLSKDPQEKLDIKLNPDGSGQLHVPGLTSTEVNSFRHIKKLLTLGKKNRATFCTNMNERSSRSHALLTINI------SGKDLTTGKLNLVDLAGSERVCKSGAEGERLKEAQNINKSLLALGEVIQALRAKQGHIPFRNSKLTYLLQDSLGKGNKTVMMVQVSPSEGNVGETVCSLKFAQRV 432          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: ENSXETT00000033874.1 (kinesin family member C2 [Source:NCBI gene;Acc:100485082])

HSP 1 Score: 264.233 bits (674), Expect = 1.132e-75
Identity = 147/361 (40.72%), Postives = 212/361 (58.73%), Query Frame = 2
Query: 1463 IVKLEKSKENIGVQLQQEVVLRKTYYNQIEDIKGKIRVFSRCRPISKSELDRGNVQCVKFPDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIKKDQHGMVVVPGAELLPAKS-----SDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRV 2530
            I  + +S +++  + Q+EV LRK Y+NQ+ ++KG IRV  R RP S +  + G++      D        V   GK K F+ D+VF P+  Q++VF++   ++ S  +GYNVCIFAYGQTGSGKT+T+ G L+N PGI  R+   L++ M   K  +  T+   M+E+YNE + DL++ + +    +++  D  G + VPG       S     S     L   G  NR    T MN  SSRSH ++++ I      +G +  GK++++DLAGSER  KSG +G    EA  IN SL ALG+VI AL + Q  IP+RN+KLT L+QDSLG  +KT+M V +SP + N  ET  SL +AQRV
Sbjct:  357 ITDVSESNKDLLAKYQREVQLRKRYHNQLVELKGNIRVLCRVRPHSHNNEEEGSLTSPITIDMNDDTRLSVFYKGKEKNFELDKVFVPQAKQEEVFQEIEPMVMSCINGYNVCIFAYGQTGSGKTYTMEGTLEN-PGINQRAMQALYKEMEARKGLWHYTVSLSMVEIYNEVIRDLLSKDPQEKLDIKLNPDGSGQLHVPGLTSTEVNSFRTFHSMSRNQLLTLGKKNRATFCTNMNERSSRSHALLTINISGKDLTTGTVTTGKLNLVDLAGSERVCKSGAEGERLKEAQNINKSLLALGEVIQALRAKQGHIPFRNSKLTYLLQDSLGKGNKTVMMVQVSPSEGNVGETVCSLKFAQRV 716          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: epha7 (EPH receptor A7 [Source:Xenbase;Acc:XB-GENE-488635])

HSP 1 Score: 245.358 bits (625), Expect = 8.315e-71
Identity = 145/352 (41.19%), Postives = 197/352 (55.97%), Query Frame = 2
Query: 1526 RKTYYNQIEDIKGKIRVFSRCRPI--SKSELDRGNVQCVKFPDKYTV-------AVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGN---LQNAPGIAPRSFVRLFEVMTEGKAK-FSATLKCYMLELYNEKLLDLMTANAEYSDKLEIKK--DQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKL 2536
            R+  +N ++++KG IRVF R RP    + EL  G++      DK  V        V    KD    +F FD VFPP   Q+ VFE+ S L+QSA DGY VCIFAYGQTGSGKT+T+ G      +  G+ PR+  ++F    E KAK +  T     LE+YNE L DL+    +   + EI+K    +  + V     +   S +E+ DL      NR +A T +N  SSRSH +  + IE             +S+IDLAGSER  +S   G    E   IN SLS LG VI++L +    IPYRN+KLT L+Q+SLGGN+K LMFVN+SP++ N  E+ NSL +A +V+L
Sbjct:  180 RRRLHNLVQELKGNIRVFCRVRPTLTQEKELPAGHISYPSNDDKAVVLSKMEESHVGREKKDAVKYDFNFDCVFPPSCSQESVFEEISLLVQSALDGYPVCIFAYGQTGSGKTYTMEGPEDITDDTIGMIPRAIGQIFSSAEELKAKGWQFTFTASFLEIYNETLRDLLINRPDKKLEYEIRKVNSSNSQLYVTNLRYVEVSSVEEVHDLLRIAKANRSVAKTAINDRSSRSHSVFQLRIEGENKQRDLKTSSVLSLIDLAGSERLDRSLSSGDRLKETQCINTSLSTLGMVITSLCNKDSHIPYRNSKLTYLLQNSLGGNAKVLMFVNISPLEENFAESLNSLRFASKVRL 531          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: cbll1 (Cbl proto-oncogene-like 1, E3 ubiquitin protein ligase [Source:Xenbase;Acc:XB-GENE-6458353])

HSP 1 Score: 248.44 bits (633), Expect = 2.364e-70
Identity = 146/338 (43.20%), Postives = 206/338 (60.95%), Query Frame = 2
Query: 1568 IRVFSRCRPISKSELDRGNVQCVKFPD-KYTVAVYGV-SKDGKPKEFQFDRVFPPEIGQDDVFEDTSR-LIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAP---GIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIKKDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQH-ASGKI-VR-GKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQP-FIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIKNDA 2551
            ++V  RCRP+++ E    +   V   + + T+ V+ V S +  PK F FD VF P+  Q DV+  T+R +I S  +GYN  IFAYGQTG+GKT T+ G ++  P   GI P SF  +F  + + +      ++   LE+YNE++ DL+    + S +LE+K+     V +         ++D++  +   G+ NR + +T MN  SSRSH I ++ IEC +  A G I VR GK+ ++DLAGSER AK+G  G    EAT IN+SLS LG+VISAL  G+   +PYRN+KLT L+QDSLGGNSKT+M  N+ P DYN  ET ++L YA R K IKN A
Sbjct:   17 VKVVVRCRPLNERERAMNSKMAVGVDEMRGTITVHKVDSMNEPPKTFTFDTVFGPDSNQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEG-VRAVPELRGIIPNSFAHVFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLL--GKDQSQRLEVKERPDVGVYIKDLSGYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGADGNIHVRMGKLHLVDLAGSERQAKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKA 351          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: cbll1 (Cbl proto-oncogene-like 1, E3 ubiquitin protein ligase [Source:Xenbase;Acc:XB-GENE-6458353])

HSP 1 Score: 248.44 bits (633), Expect = 2.886e-70
Identity = 146/338 (43.20%), Postives = 206/338 (60.95%), Query Frame = 2
Query: 1568 IRVFSRCRPISKSELDRGNVQCVKFPD-KYTVAVYGV-SKDGKPKEFQFDRVFPPEIGQDDVFEDTSR-LIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAP---GIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIKKDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQH-ASGKI-VR-GKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQP-FIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIKNDA 2551
            ++V  RCRP+++ E    +   V   + + T+ V+ V S +  PK F FD VF P+  Q DV+  T+R +I S  +GYN  IFAYGQTG+GKT T+ G ++  P   GI P SF  +F  + + +      ++   LE+YNE++ DL+  +   S +LE+K+     V +         ++D++  +   G+ NR + +T MN  SSRSH I ++ IEC +  A G I VR GK+ ++DLAGSER AK+G  G    EAT IN+SLS LG+VISAL  G+   +PYRN+KLT L+QDSLGGNSKT+M  N+ P DYN  ET ++L YA R K IKN A
Sbjct:   16 VKVVVRCRPLNERERAMNSKMAVGVDEMRGTITVHKVDSMNEPPKTFTFDTVFGPDSNQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEG-VRAVPELRGIIPNSFAHVFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQ--SQRLEVKERPDVGVYIKDLSGYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGADGNIHVRMGKLHLVDLAGSERQAKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKA 350          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Kifc3 (kinesin family member C3 [Source:MGI Symbol;Acc:MGI:109202])

HSP 1 Score: 271.937 bits (694), Expect = 5.110e-79
Identity = 159/384 (41.41%), Postives = 233/384 (60.68%), Query Frame = 2
Query: 1415 QSVMAEV----KKVNDLKQEIVKLEKSKENIGVQLQQEVVLRKTYYNQIEDIKGKIRVFSRCRPISKSELDRGN-VQCVKF-PDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIK--KDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIK 2542
            +SV AE+    ++VN   QE+++          + ++E+ LRK  +N++  +KG IRV +R RP++K + +       V F PD  ++ ++ + K GKP  F+ D+VF P   Q DVF++   LI S  DG+NVCIFAYGQTG+GKT+T+ G  +N PGI  R+   LF  + E  + +   +     E+YNE L DL+    E  +KLEI+   D  G + VPG      +S D++  +F  G  NR    T +N  SSRSH ++ + +  V  ++G    GK++++DLAGSER  KSG +G    EA  IN SLSALGDVI+AL S Q  +P+RN+KLT L+QDSL G+SKTLM V +SPV+ N +ET  SL +A+RV+ ++
Sbjct:  262 RSVKAEIGQAIEEVNSNNQELLR----------KYRRELQLRKKCHNELVRLKGNIRVIARVRPVTKEDGEGPEATNAVTFDPDDDSI-IHLLHK-GKPVSFELDKVFSPWASQQDVFQEVQALITSCIDGFNVCIFAYGQTGAGKTYTMEGTPEN-PGINQRALQLLFSEVQEKASDWQYNITVSAAEIYNEVLRDLL--GKEPQEKLEIRLCPDGSGQLYVPGLTEFQVQSVDDINKVFEFGYNNRTTEFTNLNEHSSRSHALLIVTVRGVDCSTGLRTTGKLNLVDLAGSERVGKSGAEGNRLREAQHINRSLSALGDVIAALRSRQGHVPFRNSKLTYLLQDSLSGDSKTLMVVQVSPVEKNTSETLYSLRFAERVRSVE 630          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Kifc3 (kinesin family member C3 [Source:MGI Symbol;Acc:MGI:109202])

HSP 1 Score: 271.937 bits (694), Expect = 8.508e-79
Identity = 159/384 (41.41%), Postives = 233/384 (60.68%), Query Frame = 2
Query: 1415 QSVMAEV----KKVNDLKQEIVKLEKSKENIGVQLQQEVVLRKTYYNQIEDIKGKIRVFSRCRPISKSELDRGN-VQCVKF-PDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIK--KDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIK 2542
            +SV AE+    ++VN   QE+++          + ++E+ LRK  +N++  +KG IRV +R RP++K + +       V F PD  ++ ++ + K GKP  F+ D+VF P   Q DVF++   LI S  DG+NVCIFAYGQTG+GKT+T+ G  +N PGI  R+   LF  + E  + +   +     E+YNE L DL+    E  +KLEI+   D  G + VPG      +S D++  +F  G  NR    T +N  SSRSH ++ + +  V  ++G    GK++++DLAGSER  KSG +G    EA  IN SLSALGDVI+AL S Q  +P+RN+KLT L+QDSL G+SKTLM V +SPV+ N +ET  SL +A+RV+ ++
Sbjct:  284 RSVKAEIGQAIEEVNSNNQELLR----------KYRRELQLRKKCHNELVRLKGNIRVIARVRPVTKEDGEGPEATNAVTFDPDDDSI-IHLLHK-GKPVSFELDKVFSPWASQQDVFQEVQALITSCIDGFNVCIFAYGQTGAGKTYTMEGTPEN-PGINQRALQLLFSEVQEKASDWQYNITVSAAEIYNEVLRDLL--GKEPQEKLEIRLCPDGSGQLYVPGLTEFQVQSVDDINKVFEFGYNNRTTEFTNLNEHSSRSHALLIVTVRGVDCSTGLRTTGKLNLVDLAGSERVGKSGAEGNRLREAQHINRSLSALGDVIAALRSRQGHVPFRNSKLTYLLQDSLSGDSKTLMVVQVSPVEKNTSETLYSLRFAERVRSVE 652          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Kifc3 (kinesin family member C3 [Source:MGI Symbol;Acc:MGI:109202])

HSP 1 Score: 271.166 bits (692), Expect = 1.276e-77
Identity = 159/384 (41.41%), Postives = 233/384 (60.68%), Query Frame = 2
Query: 1415 QSVMAEV----KKVNDLKQEIVKLEKSKENIGVQLQQEVVLRKTYYNQIEDIKGKIRVFSRCRPISKSELDRGN-VQCVKF-PDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIK--KDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIK 2542
            +SV AE+    ++VN   QE+++          + ++E+ LRK  +N++  +KG IRV +R RP++K + +       V F PD  ++ ++ + K GKP  F+ D+VF P   Q DVF++   LI S  DG+NVCIFAYGQTG+GKT+T+ G  +N PGI  R+   LF  + E  + +   +     E+YNE L DL+    E  +KLEI+   D  G + VPG      +S D++  +F  G  NR    T +N  SSRSH ++ + +  V  ++G    GK++++DLAGSER  KSG +G    EA  IN SLSALGDVI+AL S Q  +P+RN+KLT L+QDSL G+SKTLM V +SPV+ N +ET  SL +A+RV+ ++
Sbjct:  399 RSVKAEIGQAIEEVNSNNQELLR----------KYRRELQLRKKCHNELVRLKGNIRVIARVRPVTKEDGEGPEATNAVTFDPDDDSI-IHLLHK-GKPVSFELDKVFSPWASQQDVFQEVQALITSCIDGFNVCIFAYGQTGAGKTYTMEGTPEN-PGINQRALQLLFSEVQEKASDWQYNITVSAAEIYNEVLRDLL--GKEPQEKLEIRLCPDGSGQLYVPGLTEFQVQSVDDINKVFEFGYNNRTTEFTNLNEHSSRSHALLIVTVRGVDCSTGLRTTGKLNLVDLAGSERVGKSGAEGNRLREAQHINRSLSALGDVIAALRSRQGHVPFRNSKLTYLLQDSLSGDSKTLMVVQVSPVEKNTSETLYSLRFAERVRSVE 767          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Kifc3 (kinesin family member C3 [Source:MGI Symbol;Acc:MGI:109202])

HSP 1 Score: 253.447 bits (646), Expect = 1.325e-71
Identity = 154/384 (40.10%), Postives = 228/384 (59.38%), Query Frame = 2
Query: 1415 QSVMAEV----KKVNDLKQEIVKLEKSKENIGVQLQQEVVLRKTYYNQIEDIKGKIRVFSRCRPISKSELDRGN-VQCVKF-PDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIK--KDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIK 2542
            +SV AE+    ++VN   QE+++          + ++E+ LRK  +N++  +KG IRV +R RP++K + +       V F PD  ++ ++ + K GKP  F+ D+VF          ++   LI S  DG+NVCIFAYGQTG+GKT+T+ G  +N PGI  R+   LF  + E  + +   +     E+YNE L DL+    E  +KLEI+   D  G + VPG      +S D++  +F  G  NR    T +N  SSRSH ++ + +  V  ++G    GK++++DLAGSER  KSG +G    EA  IN SLSALGDVI+AL S Q  +P+RN+KLT L+QDSL G+SKTLM V +SPV+ N +ET  SL +A+RV+ ++
Sbjct:  363 RSVKAEIGQAIEEVNSNNQELLR----------KYRRELQLRKKCHNELVRLKGNIRVIARVRPVTKEDGEGPEATNAVTFDPDDDSI-IHLLHK-GKPVSFELDKVF----------QEVQALITSCIDGFNVCIFAYGQTGAGKTYTMEGTPEN-PGINQRALQLLFSEVQEKASDWQYNITVSAAEIYNEVLRDLL--GKEPQEKLEIRLCPDGSGQLYVPGLTEFQVQSVDDINKVFEFGYNNRTTEFTNLNEHSSRSHALLIVTVRGVDCSTGLRTTGKLNLVDLAGSERVGKSGAEGNRLREAQHINRSLSALGDVIAALRSRQGHVPFRNSKLTYLLQDSLSGDSKTLMVVQVSPVEKNTSETLYSLRFAERVRSVE 721          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Kif3a (kinesin family member 3A [Source:MGI Symbol;Acc:MGI:107689])

HSP 1 Score: 247.669 bits (631), Expect = 3.702e-70
Identity = 145/360 (40.28%), Postives = 212/360 (58.89%), Query Frame = 2
Query: 1568 IRVFSRCRPISKSELDRGNVQCVKFPD-KYTVAVYGV-SKDGKPKEFQFDRVFPPEIGQDDVFEDTSR-LIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAPG---IAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIKKDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHA---SGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQP-FIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIKNDATKVADTEE--FPKLQAIIEKLQ 2611
            ++V  RCRP+++ E      Q V   + + T+ V+   S +  PK F FD VF PE  Q DV+  T+R +I S  +GYN  IFAYGQTG+GKT T+ G ++  PG   + P SF  +F  + + +      ++   LE+YNE++ DL+    + + +LE+K+     V +         ++D++  +   G+ NR + +T MN  SSRSH I ++ IEC +     +  +  GK+ ++DLAGSER AK+G  G    EAT IN+SLS LG+VISAL  G+   +PYRN+KLT L+QDSLGGNSKT+M  N+ P DYN  ET ++L YA R K IKN A    D ++    + Q  IE+L+
Sbjct:   15 VKVVVRCRPLNEREKSMCYRQAVSVDEMRGTITVHKTDSSNEPPKTFTFDTVFGPESKQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEG-VRAVPGLRGVIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLL--GKDQTQRLEVKERPDVGVYIKDLSAYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGVDGNMHVRMGKLHLVDLAGSERQAKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQFQKEIEELK 371          
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Match: sp|Q9FHN8|KN14E_ARATH (Kinesin-like protein KIN-14E OS=Arabidopsis thaliana OX=3702 GN=KIN14E PE=1 SV=1)

HSP 1 Score: 373.629 bits (958), Expect = 6.168e-111
Identity = 201/416 (48.32%), Postives = 271/416 (65.14%), Query Frame = 2
Query: 1415 QSVMAEVKKVNDLKQEIVKLEKSKENI----GVQL-------QQEVVLRKTYYNQIEDIKGKIRVFSRCRPISKSELDRGNVQCVKFPDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIKKDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIKNDATKVADTEEFPKLQAII--EKLQSGVK 2623
            Q+ + E++++ ++K++I +  +    I    G QL       ++E VLRK YYN IED+KGKIRV+ R RP+++ E      Q +   D++TV      KD K K+  +DRVF     QDD+FEDT  L+QSA DGYNVCIFAYGQTGSGKT T+ G+  N PG+ PR+   LF ++     +FS +LK YM+ELY + L+DL+   +    KLEIKKD  GMV V     +P  + +ELR +  +G+  RH++ T MN ESSRSHLI+S++IE +   +    RGK+S +DLAGSER  KSG  G    EA +IN SLSALGDVI AL+SG   IPYRN+KLTMLM DSLGGN+KTLMFVN+SP + N  ET NSL+YA RV+ I ND +K   ++E  +L+ ++   K Q+G K
Sbjct:  827 QNNLKELEELREMKEDIDRKNEQTAAILKMQGAQLAELEILYKEEQVLRKRYYNTIEDMKGKIRVYCRIRPLNEKESSEREKQMLTTVDEFTVE--HPWKDDKRKQHIYDRVFDMRASQDDIFEDTKYLVQSAVDGYNVCIFAYGQTGSGKTFTIYGHESN-PGLTPRATKELFNILKRDSKRFSFSLKAYMVELYQDTLVDLLLPKSARRLKLEIKKDSKGMVFVENVTTIPISTLEELRMILERGSERRHVSGTNMNEESSRSHLILSVVIESIDLQTQSAARGKLSFVDLAGSERVKKSGSAGCQLKEAQSINKSLSALGDVIGALSSGNQHIPYRNHKLTMLMSDSLGGNAKTLMFVNVSPAESNLDETYNSLLYASRVRTIVNDPSKHISSKEMVRLKKLVAYWKEQAGKK 1239          
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Match: sp|Q7XPJ0|KN14I_ORYSJ (Kinesin-like protein KIN-14I OS=Oryza sativa subsp. japonica OX=39947 GN=KIN14I PE=2 SV=1)

HSP 1 Score: 369.392 bits (947), Expect = 1.967e-109
Identity = 207/408 (50.74%), Postives = 267/408 (65.44%), Query Frame = 2
Query: 1427 AEVKKVNDLKQEIVKLEKSK----ENIGVQLQQEVVLRKTYYNQIEDIKGKIRVFSRCRPISKSELDRGNVQCVKFPDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIKKDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIKNDATKVADTEEFPKLQAII--EKLQSGVKIDD 2632
            A+V + N    EI+K + ++    EN+    +QE VLRK YYN IED+KGKIRVF R RP++  EL   +   V  PD++TVA     KD K K+  +DRVF     Q++VFEDT  L+QSA DGYNVCIFAYGQTGSGKT T+ G+ +N PG+ PR+   LF V+     K+S +LK YM+ELY + L+DL+ A      KLEIKKD  G+V V    ++   S +ELR + L+G+  RH A T MN ESSRSHLI+S++IE     +    RGK+S +DLAGSER  KSG  G    EA +IN SLSAL DVI AL+S    IPYRN+KLTMLM DSLGGN+KTLMFVN+SP + N  ET NSL+YA RV+ I ND +K    +E  +L+ +I   K Q+G + +D
Sbjct:  825 ADVDRKNQQTAEILKRQGAQLIELENL---YKQEQVLRKRYYNTIEDMKGKIRVFCRLRPLNDKELIEKDKNIVCSPDEFTVA--HPWKDDKSKQHIYDRVFDANTTQEEVFEDTKYLVQSAVDGYNVCIFAYGQTGSGKTFTIYGS-ENNPGLTPRATSELFRVIKRDGHKYSFSLKAYMVELYQDNLVDLLLAKNATHQKLEIKKDSKGVVTVENVTVVNISSFEELRAIILRGSERRHTAGTNMNVESSRSHLILSIIIESTNLQTQSYARGKLSFVDLAGSERVKKSGSAGKQLKEAQSINKSLSALADVIGALSSDGQHIPYRNHKLTMLMSDSLGGNAKTLMFVNVSPAESNLEETYNSLMYASRVRCIVNDTSKHVAPKEIMRLKKLIAYWKEQAGKRSED 1226          
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Match: sp|F4IJK6|KN14R_ARATH (Kinesin-like protein KIN-14R OS=Arabidopsis thaliana OX=3702 GN=KIN14R PE=3 SV=1)

HSP 1 Score: 301.982 bits (772), Expect = 3.670e-86
Identity = 175/431 (40.60%), Postives = 252/431 (58.47%), Query Frame = 2
Query: 1316 MNEKINFFIFKSKEIDDEVVQIKKDMEKLAKEQQSVMAEVKKVNDLKQEIVKLEKSKENIGVQLQQEVVLRKTYYNQIEDIKGKIRVFSRCRPISKSELDRGNVQCVKFPDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIKKDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIK-NDATKVADTEEFPKLQAIIEK 2605
            + EKI     +  ++  E  +  + + +L K    V A V +  DLKQ              +  +E   RK  YN I++ KG IRVF RCRP++  E    +   V F       +  ++ +   K F+FDRV+ P+ GQ DVF D S ++ S  DGYNVCIFAYGQTG+GKT T+ G  QN  G+  R+  +LFEV  E +   S  +   +LE+YNE++ DL+ A +  S KLEIK+   G   VPG      ++ +E+ ++   G+  R + S  +N  SSRSH ++S+M++     +G   + K+ ++DLAGSER AK+ V+G    EA  IN SLSALGDVI AL +    IPYRN+KLT L+QDSLGG+SKTLMFV +SP +++ +ET +SL +A RV+ ++   A K  DT E  KL+A++EK
Sbjct:  348 LQEKIEIMKREQSQLSQEAHECVEGIPELYKMVGGVQALVSQCEDLKQ--------------KYSEEQAKRKELYNHIQETKGNIRVFCRCRPLNTEETSTKSATIVDFDGAKDGELGVITGNNSKKSFKFDRVYTPKDGQVDVFADASPMVVSVLDGYNVCIFAYGQTGTGKTFTMEGTPQNR-GVNYRTVEQLFEVARERRETISYNISVSVLEVYNEQIRDLL-ATSPGSKKLEIKQSSDGSHHVPGLVEANVENINEVWNVLQAGSNARSVGSNNVNEHSSRSHCMLSIMVKAKNLMNGDCTKSKLWLVDLAGSERLAKTDVQGERLKEAQNINRSLSALGDVIYALATKSSHIPYRNSKLTHLLQDSLGGDSKTLMFVQISPSEHDVSETLSSLNFATRVRGVELGPARKQVDTGEIQKLKAMVEK 762          
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Match: sp|B9FAF3|KN14E_ORYSJ (Kinesin-like protein KIN-14E OS=Oryza sativa subsp. japonica OX=39947 GN=KIN14E PE=2 SV=1)

HSP 1 Score: 297.36 bits (760), Expect = 2.072e-84
Identity = 162/383 (42.30%), Postives = 235/383 (61.36%), Query Frame = 2
Query: 1487 ENIGVQLQQEVVLRKTYYNQIEDIKGKIRVFSRCRPISKSELDRGNVQCVKFPDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIKKDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIK-NDATKVADTEEFPKLQAIIEKLQSGVKIDD 2632
            E++ ++  +E+  RK  +N +E+ KG IRVF RCRP+SK E   G    V F       +  V+     K F+FDRV+ P   Q DV+ D S L+ S  DGYNVCIFAYGQTG+GKT T+ G  +N  G+  R+   LF++  E K   + ++   +LE+YNE++ DL+ A++  S KLEIK+   G   VPG      ++  E+ D+   G+  R + S  +N  SSRSH ++ +M+      +G+  R K+ ++DLAGSER AK+ V+G    EA  IN SLSALGDVISAL +    IPYRN+KLT L+QDSLGG+SK LMFV +SP + + +ET +SL +A RV+ I+   A K  DT E  K++ ++E+ +  +++ D
Sbjct:  381 EDLKLKYYEEMAKRKKLHNIVEETKGNIRVFCRCRPLSKDETSSGYKCAVDFDGAKDGDIAIVNGGAAKKTFKFDRVYMPTDNQADVYADASPLVTSVLDGYNVCIFAYGQTGTGKTFTMEGTERNR-GVNYRTLEELFKIAEERKETVTYSISVSVLEVYNEQIRDLL-ASSPSSKKLEIKQASEGSHHVPGIVEAKVENIKEVWDVLQAGSNARAVGSNNVNEHSSRSHCMLCIMVRAENLMNGECTRSKLWLVDLAGSERLAKTDVQGERLKEAQNINRSLSALGDVISALATKNSHIPYRNSKLTHLLQDSLGGDSKALMFVQISPSNNDVSETLSSLNFASRVRRIELGPAKKQVDTAELQKVKQMLERAKQDIRLKD 761          
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Match: sp|F4K4C5|KN14S_ARATH (Kinesin-like protein KIN-14S OS=Arabidopsis thaliana OX=3702 GN=KIN14S PE=3 SV=1)

HSP 1 Score: 275.789 bits (704), Expect = 6.295e-79
Identity = 168/419 (40.10%), Postives = 239/419 (57.04%), Query Frame = 2
Query: 1373 VQIKKDMEKLAKEQQSVMAEVKKVNDLKQEIVK-LEKSKENIGV---QLQQEVVLRKTYYNQIEDIKGKIRVFSRCRPISKSELDRGNVQCVKFPDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANA-EYSDKLEIKKDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIKN-DATKVADTEEFPKLQAIIEKLQ 2611
            ++I KD   L   Q   + E+K  + ++ EI + L+     +G    Q  +E   RK  YN++ ++KG IRVF RCRP++++E+  G     +F       +  +S D   K F+FD VF P+ GQ+ VF  T  ++ S  DGYNVCIFAYGQTG+GKT T+ G  +N  G+  R+   LF             L   MLE+YNEK+ DL+  N+ +   KLE+K+   G   VPG       ++D + DL  KG   R + ST  N +SSRSH ++ + ++     +G+  R  + ++DLAGSER  K  V+G    E+  IN SLSALGDVISAL S    IPYRN+KLT ++Q+SLGG+ KTLMFV +SP   +  ET  SL +A RV+ I++  A K AD  E  K + + EKL+
Sbjct:   67 IKILKDEHALVSNQ---VQEIKNCSLVEPEISRALQLLTTKLGALEKQYLEESSERKRLYNEVIELKGNIRVFCRCRPLNQAEIANGCASVAEFDTTQENELQILSSDSSKKHFKFDHVFKPDDGQETVFAQTKPIVTSVLDGYNVCIFAYGQTGTGKTFTMEGTPENR-GVNYRTLEELFRCSESKSHLMKFELSVSMLEVYNEKIRDLLVDNSNQPPKKLEVKQSAEGTQEVPGLVEAQVYNTDGVWDLLKKGYAVRSVGSTAANEQSSRSHCLLRVTVKGENLINGQRTRSHLWLVDLAGSERVGKVEVEGERLKESQFINKSLSALGDVISALASKTSHIPYRNSKLTHMLQNSLGGDCKTLMFVQISPSSADLGETLCSLNFASRVRGIESGPARKQADVSELLKSKQMAEKLK 481          
BLAST of Kinesin-like protein vs. TrEMBL
Match: H2XNC3 (Kinesin-like protein OS=Ciona intestinalis OX=7719 PE=3 SV=1)

HSP 1 Score: 471.085 bits (1211), Expect = 1.517e-153
Identity = 237/431 (54.99%), Postives = 311/431 (72.16%), Query Frame = 2
Query: 1367 EVVQIKKDMEKLAKEQQSVMAE-------VKKVNDLKQEIVKLEKSKENIGVQLQQEVVLRKTYYNQIEDIKGKIRVFSRCRPISKSELDRGNVQCVKFPDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNL-QNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLM-TANAEYSDKLEIKKDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIKNDATKVADTEEFPKLQAIIEKLQSGVKIDD 2632
            EV ++KK +  L KE QS+          ++K+ +LK+EI  L    + +      E VLRK YYN +ED+KG+IRV+ R RP+SK+E    N   ++ PD YT+ V   +K G+ KEFQFD++F P+  Q DVFEDT+ L+QSA DGYNVCIFAYGQTGSGKT+T+IG+  Q  PGIAPR+F R+F ++ E   KFS ++ CYM+ELYN+KL+DL+ T+    S KL+IKKD+ GMV + GA +  A++  EL+ +F KG+ NRHIASTKMN+ESSRSHL+I ++IE     SG I RGK+S++DLAGSER  K+G       EA +IN SLSALGDVISAL+S Q FIPYRNNKLTM+MQDSLGGN+KTLMFVN+SP +YN+ E+  SL YA RVKLI NDA+K A+T+E  +L+ +I KL++G  IDD
Sbjct:   68 EVTELKKKITLLEKEYQSLHEAAGAGAIALQKLPELKEEIKSLSSQNQTLVDNYNTERVLRKKYYNMVEDMKGRIRVYCRVRPLSKTEKSNNNTNVIQSPDDYTIKV--AAKKGE-KEFQFDQIFTPDHSQADVFEDTNNLVQSAIDGYNVCIFAYGQTGSGKTYTMIGDSDQTQPGIAPRAFERIFSLIKENSQKFSFSVSCYMMELYNDKLIDLLVTSGGGDSAKLDIKKDKRGMVFIQGAVVNQAENPAELQTIFTKGSANRHIASTKMNAESSRSHLVIGVVIESTNLTSGAITRGKLSLVDLAGSERVGKTGATADQLKEANSINKSLSALGDVISALSSEQSFIPYRNNKLTMMMQDSLGGNAKTLMFVNISPANYNSEESVTSLTYAARVKLITNDASKNAETKEVARLKQVIAKLKAGEDIDD 495          
BLAST of Kinesin-like protein vs. TrEMBL
Match: A0A1W2W6K8 (Kinesin-like protein OS=Ciona intestinalis OX=7719 GN=LOC100187504 PE=3 SV=1)

HSP 1 Score: 469.544 bits (1207), Expect = 6.138e-147
Identity = 237/432 (54.86%), Postives = 311/432 (71.99%), Query Frame = 2
Query: 1367 EVVQIKKDMEKLAKEQQSVMAE-------VKKVNDLKQEIVKLEKSKENIGVQLQQEVVLRKTYYNQIEDIKGKIRVFSRCRPISKSELDRGNVQCVKFPDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNL-QNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLM-TANAEYSDKLEIKKDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIKNDATKVADTEEFPKLQAIIEKLQSGVKIDDF 2635
            EV ++KK +  L KE QS+          ++K+ +LK+EI  L    + +      E VLRK YYN +ED+KG+IRV+ R RP+SK+E    N   ++ PD YT+ V   +K G+ KEFQFD++F P+  Q DVFEDT+ L+QSA DGYNVCIFAYGQTGSGKT+T+IG+  Q  PGIAPR+F R+F ++ E   KFS ++ CYM+ELYN+KL+DL+ T+    S KL+IKKD+ GMV + GA +  A++  EL+ +F KG+ NRHIASTKMN+ESSRSHL+I ++IE     SG I RGK+S++DLAGSER  K+G       EA +IN SLSALGDVISAL+S Q FIPYRNNKLTM+MQDSLGGN+KTLMFVN+SP +YN+ E+  SL YA RVKLI NDA+K A+T+E  +L+ +I KL++G  IDD 
Sbjct:  538 EVTELKKKITLLEKEYQSLHEAAGAGAIALQKLPELKEEIKSLSSQNQTLVDNYNTERVLRKKYYNMVEDMKGRIRVYCRVRPLSKTEKSNNNTNVIQSPDDYTIKV--AAKKGE-KEFQFDQIFTPDHSQADVFEDTNNLVQSAIDGYNVCIFAYGQTGSGKTYTMIGDSDQTQPGIAPRAFERIFSLIKENSQKFSFSVSCYMMELYNDKLIDLLVTSGGGDSAKLDIKKDKRGMVFIQGAVVNQAENPAELQTIFTKGSANRHIASTKMNAESSRSHLVIGVVIESTNLTSGAITRGKLSLVDLAGSERVGKTGATADQLKEANSINKSLSALGDVISALSSEQSFIPYRNNKLTMMMQDSLGGNAKTLMFVNISPANYNSEESVTSLTYAARVKLITNDASKNAETKEVARLKQVIAKLKAGEDIDDL 966          
BLAST of Kinesin-like protein vs. TrEMBL
Match: R7UJM4 (Kinesin-like protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_167295 PE=3 SV=1)

HSP 1 Score: 444.891 bits (1143), Expect = 2.453e-145
Identity = 226/364 (62.09%), Postives = 276/364 (75.82%), Query Frame = 2
Query: 1547 IEDIKGKIRVFSRCRPISKSELDRGNVQCVKFPDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQ-NAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMT-ANAEYSDKLEIKKDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIKNDATKVADTEEFPKLQAIIEKLQSGVKIDD 2632
            +ED+KGKIRV+ R RP+SK+E   GN   VK PD+YTV V   S+ G  KEFQFD +F PE GQ+ VFEDTS LIQSA DGYNVCIFAYGQTGSGKT+T+IG+ Q N+PGIAPR+F  +F ++ E K KFS  + CYMLELYN+KLLDL + AN      L+IKKD+ GMVVV GAE+  A+ + EL  LF +G+  RH+ASTKMN ESSRSHL+I ++IE    A+G I +GK+S++DLAGSER+AK+        EA +IN SLSALGDVISAL+S Q FIPYRNNKLTMLMQDSLGGN+KTLMFVN+SPV+YNA E+  SL YA RVKLI NDA K AD +E  +L+ II+KL+ G   D+
Sbjct:    2 VEDMKGKIRVYCRVRPMSKTEAKNGNTLVVKSPDEYTVQVE--SQRG-LKEFQFDSIFMPESGQEKVFEDTSNLIQSAVDGYNVCIFAYGQTGSGKTYTIIGDSQGNSPGIAPRAFEGIFNLLEENKTKFSYKVSCYMLELYNDKLLDLFSKANHADDTHLDIKKDRKGMVVVQGAEVKAARHAKELYALFEEGSKTRHVASTKMNDESSRSHLVIGIVIESTNRATGNITKGKLSLVDLAGSERAAKTDSSAEQLKEAMSINKSLSALGDVISALSSEQQFIPYRNNKLTMLMQDSLGGNAKTLMFVNISPVNYNADESVISLTYASRVKLITNDAQKNADNKEISRLKGIIQKLKKGDNADE 362          
BLAST of Kinesin-like protein vs. TrEMBL
Match: A0A1S3H5Q9 (nuclear mitotic apparatus protein 1 OS=Lingula unguis OX=7574 GN=LOC106152323 PE=3 SV=1)

HSP 1 Score: 483.411 bits (1243), Expect = 3.774e-145
Identity = 237/424 (55.90%), Postives = 311/424 (73.35%), Query Frame = 2
Query: 1364 DEVVQIKKDMEKLAKEQQSVMAEVKKVNDLKQEIVKLEKSKENIGVQLQQEVVLRKTYYNQIEDIKGKIRVFSRCRPISKSELDRGNVQCVKFPDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNL-QNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIKKDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIKNDATKVADTEEFPKLQAIIEKLQSGVKIDD 2632
            +E+ +++ +ME+L       +  + +V +L++E+ +L++    +      E VLRK YYN +ED+KGKIRV++R RP+SKSELDRGNV  +K PD+YTV V   SK G  KEFQFD++F PE  Q+ VFEDT  L+QSA DGYNVCIFAYGQTGSGKT+T+IG+  Q +PGIAPR+F R+FE++ E K+KF   +  YMLELYN++LLDL    +E   K+EIKKD+ GMV V GAE+  A ++ EL  LF  G+ +RH+AST MN+ESSRSHL++ ++IE     SG + RGK+S++DLAGSER AK+        EA +IN SLSALGDVISAL+S Q FIPYRNNKLTMLMQDSLGGN+KTLMFVN+SP DYN  ET  SL YA RVKLI N A+K AD +E  +L+ +I KL++G ++D+
Sbjct: 1456 NEIKKLQAEMEQLGVAASDGIKALARVEELEKEVKRLQEENHVLTENFNSERVLRKKYYNMVEDMKGKIRVYARARPMSKSELDRGNVLVLKSPDEYTVQVD--SKRG-LKEFQFDQIFMPEHSQEKVFEDTHNLVQSAADGYNVCIFAYGQTGSGKTYTMIGDSEQKSPGIAPRAFERIFELLEENKSKFLFKVSVYMLELYNDQLLDLFGKKSEADVKMEIKKDKKGMVFVQGAEVKDAHNAKELMALFDAGSKSRHVASTSMNAESSRSHLVVGVIIESTNRTSGTVTRGKLSLVDLAGSERVAKTNASAEQLKEANSINKSLSALGDVISALSSEQSFIPYRNNKLTMLMQDSLGGNAKTLMFVNVSPADYNVDETVISLTYASRVKLITNSASKNADNKEINRLKQVIAKLKAGEEVDE 1876          
BLAST of Kinesin-like protein vs. TrEMBL
Match: A0A3M6TV89 (Kinesin motor domain-containing protein OS=Pocillopora damicornis OX=46731 GN=pdam_00000809 PE=3 SV=1)

HSP 1 Score: 475.322 bits (1222), Expect = 2.630e-143
Identity = 236/439 (53.76%), Postives = 312/439 (71.07%), Query Frame = 2
Query: 1334 FFIFKSKEIDDEVVQIKKDMEKLAKEQ---QSVMAEVKKVNDLKQEIVKLEKSKENIGVQLQQEVVLRKTYYNQIEDIKGKIRVFSRCRPISKSELDRGNVQCVKFPDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQ-NAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIKKDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIKNDATKVADTEEFPKLQAIIEKLQSGVKIDDFQ 2638
            F + K KE D  +   KKD + L+K +   Q  +A  +KV+DL +E+  L +  +N+      E +LRK YYN IED+KGKIRV+ R RP+S+SEL+RGN   +K PD+YT+ V     +  PK+FQ+D VF PE GQ+ VFEDT+ LIQSA DGYNVCIFAYGQTGSGKT+T+IG+ +  +PGIAPR+   ++++M E K+KFS  + CYMLELYN+KL+DL+  +            + G+V V G+ +L A + DEL  +F +G+ NRH++STKMN+ESSRSHLI+ ++IE     SG +++GK+S++DLAGSER+AK+G       EA +IN SLSALGDVISAL+S Q FIPYRNNKLT+LMQDSLGGN+KTLMFVN+SP DYN  ET  SL YA RVKLI NDA K AD +E  +L+ II KL+ G  +DD +
Sbjct: 1217 FKVLK-KEHDALLADSKKDKDTLSKLEVAAQEGLAAQEKVDDLTKEVKALREENKNLSDNYNSERILRKKYYNMIEDMKGKIRVYCRARPLSRSELERGNHSVIKSPDEYTLIV---ETNRGPKDFQYDAVFTPEHGQEKVFEDTNNLIQSAVDGYNVCIFAYGQTGSGKTYTMIGDKELKSPGIAPRAMDAIYKLMDEQKSKFSFKVTCYMLELYNDKLIDLLAPHG-----------KEGLVFVHGSMMLEAATKDELWTIFERGSENRHVSSTKMNAESSRSHLILGIIIESTNLTSGAVLKGKISLVDLAGSERAAKTGASAEQLKEAQSINKSLSALGDVISALSSEQQFIPYRNNKLTLLMQDSLGGNAKTLMFVNISPADYNTDETITSLTYASRVKLITNDAQKNADNKEINRLKGIIAKLKKGETVDDAE 1640          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:103041085])

HSP 1 Score: 288.886 bits (738), Expect = 1.529e-83
Identity = 157/375 (41.87%), Postives = 234/375 (62.40%), Query Frame = 2
Query: 1436 KKVNDLKQEIVKL----EKSKENIGVQLQQEVVLRKTYYNQIEDIKGKIRVFSRCRPISKSELDRGNVQCVKFPDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIK--KDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIK 2542
            K + + KQEI ++      + + +  + ++E+ LRK  +N++  +KG IRVF R RP+ + E +  +   V F D    AV  +S  GK   F+ D+VFPP+I QD+VF++   L+ S  DG+NVCIFAYGQTGSGKT+T+ G +   PGI  R+   LF  ++E K  +   +   M+E+YNE L +L+  N   S+KL+IK   D  G + VPG      +S +++  +F  G+ NR  A T +N  SSRSH ++ + +     ++G    GK++++DLAGSER AKSG +G    EA  IN SLSALGDVI+AL S    +P+RN++LT L+QDSL G+SKTLM V +SP++ N +E+  SL +AQRV+ ++
Sbjct:  452 KAIAEAKQEICQVIGEVSSANQELLRKYKREMNLRKKCHNELVRLKGNIRVFCRVRPVCQDEAESDSKTMVSF-DSDDDAVLYLSNKGKLMTFELDKVFPPQITQDEVFQEVQSLVTSCIDGFNVCIFAYGQTGSGKTYTMEG-VPEDPGINQRALRLLFSEVSEKKPDWDYNITVSMVEIYNETLRNLLGDNP--SEKLDIKMCPDGSGQLYVPGLTEFSVESVEDINRVFELGHMNRATACTNLNEHSSRSHALLIITVAGFNSSTGHRTSGKLNLVDLAGSERIAKSGAEGSRLREAQCINKSLSALGDVINALRSRHSHVPFRNSRLTYLLQDSLSGDSKTLMVVQVSPLESNISESVCSLKFAQRVRTVE 822          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:103041085])

HSP 1 Score: 287.345 bits (734), Expect = 1.792e-83
Identity = 157/375 (41.87%), Postives = 234/375 (62.40%), Query Frame = 2
Query: 1436 KKVNDLKQEIVKL----EKSKENIGVQLQQEVVLRKTYYNQIEDIKGKIRVFSRCRPISKSELDRGNVQCVKFPDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIK--KDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIK 2542
            K + + KQEI ++      + + +  + ++E+ LRK  +N++  +KG IRVF R RP+ + E +  +   V F D    AV  +S  GK   F+ D+VFPP+I QD+VF++   L+ S  DG+NVCIFAYGQTGSGKT+T+ G +   PGI  R+   LF  ++E K  +   +   M+E+YNE L +L+  N   S+KL+IK   D  G + VPG      +S +++  +F  G+ NR  A T +N  SSRSH ++ + +     ++G    GK++++DLAGSER AKSG +G    EA  IN SLSALGDVI+AL S    +P+RN++LT L+QDSL G+SKTLM V +SP++ N +E+  SL +AQRV+ ++
Sbjct:  392 KAIAEAKQEICQVIGEVSSANQELLRKYKREMNLRKKCHNELVRLKGNIRVFCRVRPVCQDEAESDSKTMVSF-DSDDDAVLYLSNKGKLMTFELDKVFPPQITQDEVFQEVQSLVTSCIDGFNVCIFAYGQTGSGKTYTMEG-VPEDPGINQRALRLLFSEVSEKKPDWDYNITVSMVEIYNETLRNLLGDNP--SEKLDIKMCPDGSGQLYVPGLTEFSVESVEDINRVFELGHMNRATACTNLNEHSSRSHALLIITVAGFNSSTGHRTSGKLNLVDLAGSERIAKSGAEGSRLREAQCINKSLSALGDVINALRSRHSHVPFRNSRLTYLLQDSLSGDSKTLMVVQVSPLESNISESVCSLKFAQRVRTVE 762          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:103041085])

HSP 1 Score: 288.115 bits (736), Expect = 4.183e-82
Identity = 157/375 (41.87%), Postives = 234/375 (62.40%), Query Frame = 2
Query: 1436 KKVNDLKQEIVKL----EKSKENIGVQLQQEVVLRKTYYNQIEDIKGKIRVFSRCRPISKSELDRGNVQCVKFPDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIK--KDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIK 2542
            K + + KQEI ++      + + +  + ++E+ LRK  +N++  +KG IRVF R RP+ + E +  +   V F D    AV  +S  GK   F+ D+VFPP+I QD+VF++   L+ S  DG+NVCIFAYGQTGSGKT+T+ G +   PGI  R+   LF  ++E K  +   +   M+E+YNE L +L+  N   S+KL+IK   D  G + VPG      +S +++  +F  G+ NR  A T +N  SSRSH ++ + +     ++G    GK++++DLAGSER AKSG +G    EA  IN SLSALGDVI+AL S    +P+RN++LT L+QDSL G+SKTLM V +SP++ N +E+  SL +AQRV+ ++
Sbjct:  637 KAIAEAKQEICQVIGEVSSANQELLRKYKREMNLRKKCHNELVRLKGNIRVFCRVRPVCQDEAESDSKTMVSF-DSDDDAVLYLSNKGKLMTFELDKVFPPQITQDEVFQEVQSLVTSCIDGFNVCIFAYGQTGSGKTYTMEG-VPEDPGINQRALRLLFSEVSEKKPDWDYNITVSMVEIYNETLRNLLGDNP--SEKLDIKMCPDGSGQLYVPGLTEFSVESVEDINRVFELGHMNRATACTNLNEHSSRSHALLIITVAGFNSSTGHRTSGKLNLVDLAGSERIAKSGAEGSRLREAQCINKSLSALGDVINALRSRHSHVPFRNSRLTYLLQDSLSGDSKTLMVVQVSPLESNISESVCSLKFAQRVRTVE 1007          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:103041085])

HSP 1 Score: 287.73 bits (735), Expect = 5.968e-82
Identity = 157/375 (41.87%), Postives = 234/375 (62.40%), Query Frame = 2
Query: 1436 KKVNDLKQEIVKL----EKSKENIGVQLQQEVVLRKTYYNQIEDIKGKIRVFSRCRPISKSELDRGNVQCVKFPDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIK--KDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIK 2542
            K + + KQEI ++      + + +  + ++E+ LRK  +N++  +KG IRVF R RP+ + E +  +   V F D    AV  +S  GK   F+ D+VFPP+I QD+VF++   L+ S  DG+NVCIFAYGQTGSGKT+T+ G +   PGI  R+   LF  ++E K  +   +   M+E+YNE L +L+  N   S+KL+IK   D  G + VPG      +S +++  +F  G+ NR  A T +N  SSRSH ++ + +     ++G    GK++++DLAGSER AKSG +G    EA  IN SLSALGDVI+AL S    +P+RN++LT L+QDSL G+SKTLM V +SP++ N +E+  SL +AQRV+ ++
Sbjct:  637 KAIAEAKQEICQVIGEVSSANQELLRKYKREMNLRKKCHNELVRLKGNIRVFCRVRPVCQDEAESDSKTMVSF-DSDDDAVLYLSNKGKLMTFELDKVFPPQITQDEVFQEVQSLVTSCIDGFNVCIFAYGQTGSGKTYTMEG-VPEDPGINQRALRLLFSEVSEKKPDWDYNITVSMVEIYNETLRNLLGDNP--SEKLDIKMCPDGSGQLYVPGLTEFSVESVEDINRVFELGHMNRATACTNLNEHSSRSHALLIITVAGFNSSTGHRTSGKLNLVDLAGSERIAKSGAEGSRLREAQCINKSLSALGDVINALRSRHSHVPFRNSRLTYLLQDSLSGDSKTLMVVQVSPLESNISESVCSLKFAQRVRTVE 1007          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:103041085])

HSP 1 Score: 287.345 bits (734), Expect = 7.580e-82
Identity = 157/375 (41.87%), Postives = 234/375 (62.40%), Query Frame = 2
Query: 1436 KKVNDLKQEIVKL----EKSKENIGVQLQQEVVLRKTYYNQIEDIKGKIRVFSRCRPISKSELDRGNVQCVKFPDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIK--KDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIK 2542
            K + + KQEI ++      + + +  + ++E+ LRK  +N++  +KG IRVF R RP+ + E +  +   V F D    AV  +S  GK   F+ D+VFPP+I QD+VF++   L+ S  DG+NVCIFAYGQTGSGKT+T+ G +   PGI  R+   LF  ++E K  +   +   M+E+YNE L +L+  N   S+KL+IK   D  G + VPG      +S +++  +F  G+ NR  A T +N  SSRSH ++ + +     ++G    GK++++DLAGSER AKSG +G    EA  IN SLSALGDVI+AL S    +P+RN++LT L+QDSL G+SKTLM V +SP++ N +E+  SL +AQRV+ ++
Sbjct:  625 KAIAEAKQEICQVIGEVSSANQELLRKYKREMNLRKKCHNELVRLKGNIRVFCRVRPVCQDEAESDSKTMVSF-DSDDDAVLYLSNKGKLMTFELDKVFPPQITQDEVFQEVQSLVTSCIDGFNVCIFAYGQTGSGKTYTMEG-VPEDPGINQRALRLLFSEVSEKKPDWDYNITVSMVEIYNETLRNLLGDNP--SEKLDIKMCPDGSGQLYVPGLTEFSVESVEDINRVFELGHMNRATACTNLNEHSSRSHALLIITVAGFNSSTGHRTSGKLNLVDLAGSERIAKSGAEGSRLREAQCINKSLSALGDVINALRSRHSHVPFRNSRLTYLLQDSLSGDSKTLMVVQVSPLESNISESVCSLKFAQRVRTVE 995          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: kifc3 (kinesin family member C3 [Source:ZFIN;Acc:ZDB-GENE-030131-3724])

HSP 1 Score: 276.559 bits (706), Expect = 1.747e-84
Identity = 147/366 (40.16%), Postives = 212/366 (57.92%), Query Frame = 2
Query: 1451 LKQEIVKLEKSKENIGVQLQQEVVLRKTYYNQIEDIKGKIRVFSRCRPISKSELDRGNVQCVKFPDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTL--IGNLQNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIKKDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIK 2542
            L + + ++ K  + +  + Q+E+VLRK Y+NQ+ +++G IRV  R RP  + + +      V   D        V++ G+   FQ DRVFPP   Q++VF +   L+ S  DGYN+CIFAYGQTGSGKT+T+        APGI  R+   LF+ M E + ++  TL   MLE+YNE L DL+ +       + +  D  G + VPG    P  S  ++  L   G+ NR    T MN  SSRSH +I + +      +G   RG+++++DLAGSER AKS  +G    EA  IN SL+ALGDVI AL + Q  +P+RN+KLT L+QDSL   SKTLM + ++P   +A ET  SL +AQR + ++
Sbjct:   44 LARAVEEMSKRCDEMERRYQREMVLRKKYHNQLVELRGNIRVLCRVRPAIEEDGEGTLAHSVVQVDTEDDGAVHVAQRGRQHSFQLDRVFPPHASQEEVFREVQDLVTSCVDGYNICIFAYGQTGSGKTYTMERAQGTAKAPGINQRALQHLFQEMEERQDEWRYTLSLSMLEIYNETLRDLLGSEGHGRLDIRLCPDGSGELCVPGLRQEPVTSLGDVHRLVSLGHSNRATHCTNMNEHSSRSHALILVTVSATNSITGTSTRGRLNLVDLAGSERLAKSRAEGDRLREAQNINRSLAALGDVIQALRAKQAHVPFRNSKLTYLLQDSLARESKTLMVIQVAPAARHAAETICSLHFAQRARAVE 409          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010492.1 (pep scaffold:Pmarinus_7.0:GL478879:14589:34633:-1 gene:ENSPMAG00000009502.1 transcript:ENSPMAT00000010492.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 247.284 bits (630), Expect = 4.864e-74
Identity = 148/387 (38.24%), Postives = 220/387 (56.85%), Query Frame = 2
Query: 1382 KKDMEKLAKEQQSVMAEVKKVNDLKQEIVKLEKSKENIGVQLQQEVVLRKTYYNQIEDIKGKIRVFSRCRPISKSELDRGNVQCVKF-PDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIKKDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLI 2539
            ++D+ +L +  QS+ + V+++  L            ++    ++E + R+  ++Q+ +++G IRVF R RP +      G V  ++F P    V V  +  +GK   F FD+VFPP   Q+ VF DT  LI S  DGYNVCI AYGQTGSGKTHT++G   NAPG+  RS   L  +  E +     TLK  MLE+YNE + DL+      S  LE++  Q   V VPG       S +++  +    + +R +ASTKMN  SSRSHL+ ++ +E +   SG    G + + DLAGSER +++   G    EA AIN SL++LG V  AL +G   +PYRN+KLT L+Q +LGGN+K  +FV +S  D N  ET ++L +   ++ +
Sbjct:    4 RRDLGELGRLIQSLTSAVRRMAGLAAASAGSLDEARSL---YRREALQRRLLHDQLTELRGNIRVFCRGRPGAPD----GGVPGLEFSPSAGEVLV--MQSEGKTTSFAFDQVFPPNATQEQVFADTLPLITSCVDGYNVCILAYGQTGSGKTHTMMGT-SNAPGVNVRSVKELLNICKE-RHNVKYTLKISMLEIYNETVRDLL--GKPGSGPLEVR-GQARSVTVPGLTTTIVTSEEDIVRVMETAHKHRTVASTKMNIHSSRSHLLTTLSLEGLDVVSGSASHGSLILGDLAGSERISRTEATGQRLVEAAAINKSLTSLGQVFLALRNGSLHVPYRNSKLTHLLQPALGGNAKACVFVTVSADDANRGETLSTLQFGSSIRQV 376          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: kif3a (kinesin family member 3A [Source:ZFIN;Acc:ZDB-GENE-050417-71])

HSP 1 Score: 241.891 bits (616), Expect = 8.930e-69
Identity = 141/338 (41.72%), Postives = 198/338 (58.58%), Query Frame = 2
Query: 1568 IRVFSRCRPISKSELDRGNVQCVKFPD-KYTVAVYGVS-KDGKPKEFQFDRVFPPEIGQDDVFEDTSR-LIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAP---GIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIKKDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHA---SGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQP-FIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIKNDA 2551
            ++V  RCRPI+  E   G+   V   + +  +AV      D  PK F FD VF  E  Q DV+  T+R ++ S  +GYN  IFAYGQTG+GKT T+ G ++  P   GI P SF  +F  + + +      ++   LE+YNE++ DL+    + + +LE+K+     V V         ++D++  +   G+ NR + ST MN  SSRSH I ++ IEC +     +  +  GK+ ++DLAGSER  K+G  G    EAT IN+SLS LG+VISAL  G+   +PYRN+KLT L+QDSLGGNSKT+M  N+ P DYN  ET ++L YA R K IKN A
Sbjct:   16 VKVVVRCRPINGKETGAGHRMAVLVDEMRGQIAVQRPDCNDEPPKTFTFDTVFGTESKQVDVYNLTARPIVDSVLEGYNGTIFAYGQTGTGKTFTMEG-IRAVPELRGIIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVKDLL--GKDQTQRLEVKERPDVGVYVKDLSAFVVNNADDMDRIMTLGHKNRSVGSTNMNEHSSRSHAIFTITIECSEKGVDGNMHVRMGKLHLVDLAGSERQTKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKA 350          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: kif3ca (kinesin family member 3Ca [Source:ZFIN;Acc:ZDB-GENE-111214-2])

HSP 1 Score: 224.172 bits (570), Expect = 1.709e-63
Identity = 128/336 (38.10%), Postives = 197/336 (58.63%), Query Frame = 2
Query: 1568 IRVFSRCRPISKSELDRGNVQCVKFPDKY-TVAVYGVSKDGKP-KEFQFDRVFPPEIGQDDVFEDTSR-LIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAP---GIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIKKDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQ---HASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQP-FIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIKN 2545
            +RV  RCRP++  E        +    +   VA+     +  P + F FD V+  +  Q D++E++ R L+ S   G+N  IFAYGQTG+GKT+T+ G +++ P   G+ P SF  +F  ++  + +    ++   LE+Y E++ DL++ +   S +LE+++     + V        KS+ E+  +   GN NR + +T MN  SSRSH I  + +EC +        I  GK++++DLAGSER AK+G +G    EAT IN+SLSALG+VISAL  G+   +PYR++KLT L+QDSLGGN++T+M  N+ P  YN  E+  +L YA R K I+N
Sbjct:   20 VRVVVRCRPMNPRESAASYESVITIDVRAGQVAIRNPRANADPARTFTFDAVYGGDAKQLDIYEESFRPLVDSVLCGFNGTIFAYGQTGTGKTYTMEG-VRSDPERRGVIPNSFEHIFTHISRSQNQPVPEVRASYLEIYQEEIRDLLSRDQ--SRRLELRERPDTGIHVKDLSSFVTKSAREIEHVMGIGNQNRSVGATNMNEHSSRSHAIFVITVECSELGADGESHIRVGKLNLVDLAGSERQAKTGAQGERLKEATKINLSLSALGNVISALVDGKSTHVPYRDSKLTRLLQDSLGGNARTVMVANVGPASYNYDESLTTLRYANRAKNIRN 352          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001102.1 (pep scaffold:Pmarinus_7.0:GL476652:232474:299869:1 gene:ENSPMAG00000000949.1 transcript:ENSPMAT00000001102.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 218.009 bits (554), Expect = 3.317e-59
Identity = 130/336 (38.69%), Postives = 193/336 (57.44%), Query Frame = 2
Query: 1568 IRVFSRCRPISKSELDRGNVQCVKFPDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSR-LIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAP--GIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIKKDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSG-QPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRV---KLIKNDAT 2554
            I+V  R RP+S +E  RG+    KF  +  V V G    GKP  + FDRVFP    Q+ V+   +R +++   +GYN  IFAYGQT SGKTHT+ G L ++   GI PR    +F  +          +K    E+Y +K+ DL+  +      L + +D++ +  V G       S DE+ D+  +G  NRH+A T MN  SSRSH I  + ++     + + + GK+ ++DLAGSE+ +K+G +G    EA  IN SLSALG+VISAL  G +  +PYR++K+T ++QDSLGGN +T + +  SP  YN  E+ ++L++ QR+   K IKN  T
Sbjct:    9 IKVMCRFRPLSDAEQGRGDKFLPKFSGEDNV-VMG----GKP--YIFDRVFPTNTTQEQVYNCCARQIVKDVLEGYNGTIFAYGQTASGKTHTMEGKLHDSEYMGIIPRIIQDIFNYIYSMDENLEFHIKVSYFEIYLDKIRDLLDIS---KTNLAVHEDKNKVPYVKGCTERFVSSPDEVMDVIDEGKSNRHVAVTNMNEHSSRSHSIFLINVKQENVETEQKLSGKLYLVDLAGSEKVSKTGAEGSVLDEAKNINKSLSALGNVISALAEGTKSHVPYRDSKMTRILQDSLGGNCRTTIVICCSPSSYNEAESKSTLMFGQRIDRAKTIKNTVT 334          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: KAR3 (Minus-end-directed microtubule motor; functions in mitosis and meiosis, localizes to the spindle pole body and localization is dependent on functional Cik1p, required for nuclear fusion during mating; potential Cdc28p substrate [Source:SGD;Acc:S000006345])

HSP 1 Score: 233.802 bits (595), Expect = 5.162e-66
Identity = 147/397 (37.03%), Postives = 222/397 (55.92%), Query Frame = 2
Query: 1394 EKLAKEQQSVMAEVKKVNDLKQEIVKLEKSKENIGVQLQQEVVLRKTYYNQIEDIKGKIRVFSRCRPISKS--ELDRGNVQCVKFPDKYTVAVYGVSK---DGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAPGIAPRSFVRLFEVMTEGKAK-FSATLKCYMLELYNEKLLDLMTANAEYSD------KLEIKKDQHGMVVVPGAELLPAKSSDELRDLFL-KGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQP-----FIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRV 2530
            +++A +Q++ +  ++K+ +L++ I   E   + +   L +E  +R+T +N++++++G IRV+ R RP  K+    D   +   +F D   V    V+K     +  EF+FD++F  +    DVF++  +L+QS+ DGYNVCIFAYGQTGSGKT T+   L    GI P +   +F  + + K K +   + C  +E+YNE ++DL+ ++    +      K EI+ DQ                S+E+ ++ L K N  R  AST  N  SSRSH I  + +      +G    G ++++DLAGSER   S V G    E   IN SLS LGDVI AL  GQP      IP+RN+KLT L+Q SL G+SKTLMFVN+SP   +  ET NSL +A +V
Sbjct:  329 DEVALKQKTNLETLEKIKELEEYIKDTELGMKELNEILIKEETVRRTLHNELQELRGNIRVYCRIRPALKNLENSDTSLINVNEFDDNSGVQSMEVTKIQNTAQVHEFKFDKIFDQQDTNVDVFKEVGQLVQSSLDGYNVCIFAYGQTGSGKTFTM---LNPGDGIIPSTISHIFNWINKLKTKGWDYKVNCEFIEIYNENIVDLLRSDNNNKEDTSIGLKHEIRHDQETKTTTITNVTSCKLESEEMVEIILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNAKTGAHSYGTLNLVDLAGSERINVSQVVGDRLRETQNINKSLSCLGDVIHAL--GQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLMFVNISPSSSHINETLNSLRFASKV 720          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: KIP1 (Kinesin-related motor protein; required for mitotic spindle assembly, chromosome segregation, and 2 micron plasmid partitioning; functionally redundant with Cin8p for chromosomal but not plasmid functions [Source:SGD;Acc:S000000159])

HSP 1 Score: 182.956 bits (463), Expect = 1.007e-47
Identity = 129/374 (34.49%), Postives = 191/374 (51.07%), Query Frame = 2
Query: 1562 GKIRVFSRCRPISKSELDRGNVQCVKFPDKYTVAVYGVSKDGK---------------PKEFQFDRVFPPEIGQDDVFEDTSR-LIQSAFDGYNVCIFAYGQTGSGKTHTL------IGNLQNA--------PGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKL-----LDLMTANAEYSDKLEIK----KDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQ-----HASGK--IVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIKN 2545
              I V+ RCR  +K E++          +K +V +  +   GK                K +QFD+VF  E  Q+ VF  T++  I+    GYN  IFAYGQTG+GKT+T+      +G++Q+          GI PR  V LF+ ++    ++S  +K   LELYNE L            A    K +I+     + +  ++V G + +   S+ E  +L ++G+  R +A+TK N  SSRSH + ++    V+     H   K  +  GK++++DLAGSE   +SG +   A EA  IN SL  LG VI+AL      IPYR +KLT L+QDSLGG +KT +   +SP   +  ET ++L YA R K IKN
Sbjct:   51 SNIHVYVRCRSRNKREIE----------EKSSVVISTLGPQGKEIILSNGSHQSYSSSKKTYQFDQVFGAESDQETVFNATAKNYIKEMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDNLLLGEHAGIIPRVLVDLFKELSSLNKEYS--VKISFLELYNENLKDLLSDSEDDDPAVNDPKRQIRIFDNNNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKN 412          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: KIP3 (Kinesin-related antiparallel sliding motor protein; involved in mitotic spindle positioning; sliding activity promotes bipolar spindle assembly and maintenance of genome stability; inhibits spindle elongation, destabilizing late anaphase spindle microtubules that polymerize beyond the midzone [Source:SGD;Acc:S000003184])

HSP 1 Score: 174.481 bits (441), Expect = 1.757e-45
Identity = 114/300 (38.00%), Postives = 166/300 (55.33%), Query Frame = 2
Query: 1679 KDGKPKEFQFDRVFPPEIGQDDVF-EDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIKKDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVR-------GKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALT----SGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIK 2542
            + G   +F FD++F     Q  V+ E TS L+ S  DG+N  +FAYG TG GKT+T+ G   + PGI   +   LF  +T+ K +    +    LE+YNE++ DL+      S +L I++D    + V         + +++ DL ++GN NR  + T+ N  SSRSH ++ + I      + K+V          +SIIDLAGSER+A +  +G+   E   IN SL ALG+ I+AL     S    IPYR++KLT L++ SLGGN KT+M V +SP   +  ET N+L YA R K IK
Sbjct:  146 RHGGEIKFVFDKLFDETSSQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT-PSQPGIIFLAMEELFNKITDLKDEKDFEISLSYLEIYNERIRDLLKPETP-SKRLVIREDTQNHIKVANLSYHHPNTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHI----MQTNKLVDLTSQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGSRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIK 439          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: KIP2 (Kinesin-related motor protein involved in mitotic spindle positioning; stabilizes microtubules by targeting Bik1p to the plus end; functions as a microtubule polymerase and catastrophe inhibitor in vitro; Kip2p levels are controlled during the cell cycle [Source:SGD;Acc:S000006076])

HSP 1 Score: 134.42 bits (337), Expect = 7.598e-33
Identity = 109/336 (32.44%), Postives = 150/336 (44.64%), Query Frame = 2
Query: 1697 EFQFDRVFPPEIGQDDVFEDTSR-LIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAPGIAPRS----FVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSD---------------------KLEIKKDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISAL-------------------------------TSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVK 2533
            EF+FD VF       +V+E TS+ +I     G+N  IFAYG TGSGKT T+ GN Q   G+ P S    F  + E    G  KF   +    LE+YNE++ DL+ +  E S                      +L+I+ D    V V G      +SS+EL      G+ +R I  T  N+ SSRSH I+ + +      +G      +S+ DLAGSER+     +     E + IN SL ALG VIS L                               TS    IPYR++KLT L+Q +L G+S       +   +  A ET N+L +A R K
Sbjct:  162 EFKFDHVFASHCTNLEVYERTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQEL-GLIPLSVSYLFTNIMEQSMNGDKKFDVIIS--YLEIYNERIYDLLESGLEESGSRISTPSRLYMSKSNSNGLGVELKIRDDSQYGVKVIGLTERRCESSEELLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTSTNVKNGTSRSSTLSLCDLAGSERATGQQER---RKEGSFINKSLLALGTVISKLSADKMNSVGSNIPSPSASGSSSSSGNATNNGTSPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRNDAAAETMNTLRFASRAK 491          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: CIN8 (Kinesin motor protein; involved in mitotic spindle assembly and chromosome segregation [Source:SGD;Acc:S000000787])

HSP 1 Score: 122.865 bits (307), Expect = 5.813e-29
Identity = 71/170 (41.76%), Postives = 99/170 (58.24%), Query Frame = 2
Query: 2036 DQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIKN 2545
            DQ   + +   +     ++ E  +L  KG  +R +ASTKMN  SSRSH I ++ +   +H        KM+++DLAGSE   +SG     A EA +IN SL  LG VI+AL      IP+R +KLT L+QDSLGGN+KT +   +SP    + ETC++L YA + K IKN
Sbjct:  311 DQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITL-YKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 479          

HSP 2 Score: 87.8113 bits (216), Expect = 4.176e-18
Identity = 52/165 (31.52%), Postives = 82/165 (49.70%), Query Frame = 2
Query: 1568 IRVFSRCRPISKSELDRGNVQCVKFPDKY--------TVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTS-RLIQSAFDGYNVCIFAYGQTGSGKTHTLIGN-------LQNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYS 2014
            I V  RCR  ++ E+   +   V  PD          T    G++     K +  D+VF P   QD +F++ +  L Q    GYN  +  YG T +GKT+T+ G+       L +A GI PR  ++LF+ +   +  +   +KC  +ELYNE+L DL+ +N+  S
Sbjct:   37 ITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDY--VVKCSFIELYNEELKDLLDSNSNGS 199          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO37229 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGE0])

HSP 1 Score: 357.451 bits (916), Expect = 1.350e-116
Identity = 174/289 (60.21%), Postives = 220/289 (76.12%), Query Frame = 2
Query: 1766 LIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQ-NAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIKKDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIKNDATKVADTEEFPKLQAIIEKLQSGVKID 2629
            LIQSA DGYNVCIFAYGQTGSGKT T+IG+   N PGIAPR+   ++ ++ E K KFS  +  YM+ELYN+KL+DL+T + + S +L+IKKD+ GMV V G+ +L + S +EL  +F +G+ NRH+ASTKMN+ESSRSHLI+ ++IE     SG +++GK+S++DLAGSER+AK+G       EA +IN SLSALGDVISAL+S Q FIPYRNNKLTMLMQDSLGGN+KTLMFVN+SP DYN  ET  SL YA RVKLI NDA K  D +E  +L+ II KL+ G  +D
Sbjct:    1 LIQSAVDGYNVCIFAYGQTGSGKTFTMIGDRDGNFPGIAPRAMDNIYSLIEENKKKFSFKIYVYMMELYNDKLIDLLTTSHQDSARLDIKKDKKGMVFVQGSVMLESHSKEELWSIFERGSENRHVASTKMNAESSRSHLILGIIIESTNLVSGAVIKGKLSLVDLAGSERAAKTGATAEQLKEAQSINKSLSALGDVISALSSDQQFIPYRNNKLTMLMQDSLGGNAKTLMFVNVSPADYNTDETVTSLTYASRVKLITNDAQKNQDNKEISRLKGIIAKLKKGEAVD 289          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO45950 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRH2])

HSP 1 Score: 271.166 bits (692), Expect = 8.321e-82
Identity = 168/432 (38.89%), Postives = 254/432 (58.80%), Query Frame = 2
Query: 1316 MNEKINFFIFKSKEIDDEVVQIKKDMEKLAKEQQSVMAEVKK-VNDLKQEIVKLEK---SKENIGV-QLQQEVVLRKTYYNQIEDIKGKIRVFSRCRPISKSELDRGNVQCVKFPDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIKKDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIK-NDATKVADTEEFPKLQA 2593
            M  K+     ++K +   V Q+K+  + L  E   +   VK  + D++++++K  +   S+  I V + ++E+ LRK Y N++ ++KG IRV+ R RP+ + +      + V   D    A+  V   G  K F+ DRVF P+  Q +VFE+   L+ S  DGYNVCIFAYGQTGSGKT T+ G + N PGI  R+   LF    +    +   +   ++E+YNE L DL++++   S KL+IK+ + G+ V PG   +   + DE+ ++F  G  NR  A T MN  SSRSH ++   +  V   +G    GK++++DLAGSER +KSG +G    EA  IN SLS+LGDVI  L +    +PYRN+KLT L+Q+SLGG+SKTLM V ++PV+ N  ET  SL +AQRV+ ++   AT+  D  +  +L+A
Sbjct:    1 MKTKLESTRLQAKVLMKAVEQVKRQYKDLKIESLKMGTAVKPAIKDIEKQLLKRVEGIDSRNKILVDKYKKEMALRKKYLNELIELKGNIRVYCRVRPVIREDGAGKPAENVISFDDDDDAILNVFSRGALKPFEMDRVFQPQSTQVEVFEEVKPLVISCVDGYNVCIFAYGQTGSGKTFTMEGPVSN-PGINQRALQHLFTETADRGVDWDYQVTVSVMEIYNEMLRDLLSSDP--SAKLDIKQGKEGLYV-PGLSEVEVTNLDEVNEIFQLGKQNRATAFTDMNEHSSRSHALLCATVIGVNRTTGARTIGKLNLVDLAGSERVSKSGSEGARMKEAQNINKSLSSLGDVIHNLKNKSAHVPYRNSKLTYLLQESLGGDSKTLMVVQVAPVEKNVGETVCSLNFAQRVRAVELGQATRKTDNADGGQLKA 428          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO31606 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXF7])

HSP 1 Score: 265.774 bits (678), Expect = 3.560e-76
Identity = 154/374 (41.18%), Postives = 215/374 (57.49%), Query Frame = 2
Query: 1436 KKVNDLKQEIVKLEKSKENIGVQLQQEVVLRKTYYNQIEDIKGKIRVFSRCRPISKSELDRGNVQCVKFPDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLM-----TANAEYSDKLEIKKDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIK 2542
            K +N L+      +   E +     +E + RK  YN++++++G IRVF RCR     E+       V FP    +   G S  G+ K F FDRVF P+  Q+ VFEDT  LI S  DGYNVCI AYGQTG+GKT T++G   N PG+  RS + L  V  E +     TL   MLE+YNE L DL+      A  + S +L+ K+     VVVP    +   S+  +R +  KG+ NR + +TKMN+ SSRSHL++ + I  V   S  I    ++++DLAGSER +K+   G    EA AIN SLSALG V +AL +    +PYRN+KLT L+Q SLGG+ K  MFVN+SP ++N +ET ++L +    K ++
Sbjct:  446 KAINSLQLNNKSHDSEIEELKALYHKEALHRKLLYNKLQELRGNIRVFCRCRRDPTVEV------AVTFPSDQEIQAVGPS--GR-KTFMFDRVFTPDSTQEQVFEDTLPLIASCVDGYNVCIMAYGQTGAGKTFTMMGPEDN-PGVNVRSILELLRVCNE-RPNVDYTLSLAMLEVYNETLKDLLEEFGSCAGTQLSIQLKGKQ-----VVVPHLTEIQVNSAKAIRTIMAKGDANRSVGATKMNTSSSRSHLVLILHINGVDKISHAITHSTLTLVDLAGSERISKTEATGQRLVEAAAINKSLSALGQVFTALRTNAMHVPYRNSKLTQLLQGSLGGDGKACMFVNVSPAEWNLSETISTLQFGAGAKQVQ 803          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO34961 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMV5])

HSP 1 Score: 223.016 bits (567), Expect = 6.631e-65
Identity = 140/366 (38.25%), Postives = 202/366 (55.19%), Query Frame = 2
Query: 1502 QLQQEVVLRKTYYNQIEDIKGKIRVFSRCRPISKSELDRGNVQCV-------------KFPDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAP--GIAPRSFVRLF---EVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIK-----KDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRV 2530
            +L+QE + R+T +N I+++KG IRVF R RP   +E+++  V                  P+       GVSK     EF FD+VF     Q  VFE+ S+L+QSA DGYNVCIFAYGQTGSGKT+T+ G+  N    G+ PRS  ++F     + E   K+   +    LE+YNE + DL+ +  E + K EIK        +  V+V   +    +   ++  L    + NR + +T  N  SSRSH +  M +      + +   G ++++DLAGSER  +S   G    E   IN SLS L  VI AL + +  +PYRN+KLT L+++SLGGNSK+LMFVN+SP + +  ET  SL +A +V
Sbjct:   17 KLRQEEMTRRTLHNTIQELKGNIRVFCRVRPPLPNEMNKDLVNVSLQDEGRGIAITPSNLPEDVMATKKGVSK----YEFSFDKVFQHTSKQAQVFEEISQLVQSALDGYNVCIFAYGQTGSGKTYTMEGDHNNLEHRGMIPRSMEQVFLNTHKLQEKGWKYK--MDVSFLEIYNETIRDLLGSGDE-TIKHEIKMVNGSNSTNSQVMVTNLKTFEVEDESQVYSLLKTASQNRAVGATACNERSSRSHSVFIMKLTGENSITEESCSGTLNLVDLAGSERLGQSCASGDRLKETKNINKSLSTLSSVIIALANKEGHVPYRNSKLTYLLKNSLGGNSKSLMFVNISPREESLQETLCSLRFATKV 375          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO47075 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN53])

HSP 1 Score: 227.254 bits (578), Expect = 7.760e-64
Identity = 133/315 (42.22%), Postives = 185/315 (58.73%), Query Frame = 2
Query: 1550 EDIKGKIRVFSRCRPISKSELDRGNVQCVKFPDKYTVAVYGVSKDGK----PKEFQFDRVFPPEIGQDDVFEDTSR-LIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAP---GIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIKKDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHA---SGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQP-FIPYRNNKLTMLMQDSLGGNSKTLM 2458
            ED    +RV  RCRP+++ E   G   CV   D+ T ++      G+    PK+F FDRVF  +  Q DV+ D +R +++S  +GYN  IFAYGQTG+GKT T+ G +++ P   GI P SF  +F  + +        ++   LE+YNE + DL+    + + KLE+K+     V V         ++D+L      GN NR + +T MN  SSRSH I S+ +EC +        +  GK+ ++DLAGSER AK+G  GV   EAT IN+SLS LG+VISAL  G+   IPYRN+KLT L+QDSLGGNSKT+M
Sbjct:    5 EDSGDNVRVVVRCRPLNEKEKGSGCKMCVNV-DEGTGSIAVTPPGGRSSEPPKKFTFDRVFNVDCKQTDVYTDAARGIVESVLEGYNGTIFAYGQTGTGKTFTMEG-VRSVPELRGIVPNSFAHIFGHIAKVDGHVRFLVRVSYLEIYNENVRDLL--GKDQNAKLEVKERPDIGVYVKDLSSYVMNNADDLDRTMTLGNKNRSVGATNMNERSSRSHAIFSITVECSEKGLDGQQHVRMGKLHLVDLAGSERQAKTGATGVRLKEATQINLSLSTLGNVISALVDGKSTHIPYRNSKLTRLLQDSLGGNSKTIM 315          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: si:dkey-96l17.6 (kinesin-like protein KIN-14E [Source:NCBI gene;Acc:105354761])

HSP 1 Score: 392.889 bits (1008), Expect = 7.138e-125
Identity = 199/384 (51.82%), Postives = 264/384 (68.75%), Query Frame = 2
Query: 1514 EVVLRKTYYNQIEDIKGKIRVFSRCRPISKSELDRGNVQCVKFPDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNL-QNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTAN----------AEYSDKLEIKKDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIKNDATKVADTEEFPKLQAIIEKLQSGVKIDD 2632
            E  LRK YYN +ED+KGKIRVF R RP++++E  +G    V+  D Y+V+V         +EFQFD+VF  E  QD+VF+DTSRLIQS  DGYNVCIFAYGQTGSGKT T++G+  Q  PGI PRSF  +F++  E  +KF   +  YMLELYN++L DL  +           +  + ++EIK+ + G+V   GAE   A S+ EL  LF +   NRHIA+TKMN ESSRSHLI+ +M+E     +G I  GK+S++DLAGSER+AK+G K     EA +IN SLSALGDVISAL++  P +PYRN+KLT +MQDSLGGN+KTLM VN+SP + N  ET  SL+YA RVK I N+A +  +++E  +L+ +I KL+SG+ +DD
Sbjct:  257 ERTLRKKYYNMVEDMKGKIRVFCRLRPMNRNEAGQGGTAFVEKIDDYSVSV---ETPRGLREFQFDKVFGAEASQDEVFQDTSRLIQSVIDGYNVCIFAYGQTGSGKTFTMVGDKDQRNPGIMPRSFNAIFDITRENSSKFEFKVSAYMLELYNDRLQDLFISQAAEAQAQTQPSSQTRRVEIKRTRKGVVFAQGAETKEASSAQELYALFQQACANRHIAATKMNVESSRSHLIVVIMVESRNLTNGSISTGKLSLVDLAGSERAAKTGAKDHQLKEANSINKSLSALGDVISALSADLPHVPYRNSKLTQVMQDSLGGNAKTLMIVNISPSESNLDETLTSLIYATRVKAITNNAQRNVESKEIAQLKEVIMKLKSGLTVDD 637          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: si:dkey-96l17.6 (kinesin-like protein KIN-14E [Source:NCBI gene;Acc:105354761])

HSP 1 Score: 289.271 bits (739), Expect = 1.387e-89
Identity = 165/371 (44.47%), Postives = 225/371 (60.65%), Query Frame = 2
Query: 1556 IKGKIRVFSRCRPISKSELDRGNVQCVKFPDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNL-QNAPGIAPRSFVRLFEVMTEGKAKFS-ATLKCYMLELYNEKLLDLMTAN----------AEYSDKLEIKKDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIKNDATKVADTEEFPKLQAIIEKLQSGVKIDD 2632
            ++ KIRVF R RP++++E  +G    V+  D Y+V+V         +EFQFD+VF  E  QD+VF+DTS LIQS  DGYNVCIFAYGQTGSGKT T++G+  Q  PGI PRSF  +F++  E  +KF    +  YMLELYN++L DL  +           +  + ++EIK+ + G+V   GAE   A S+ EL  LF +   NRHIA+T MN ESSRSHLI+ +M+E     +G I  GK+S++DLAGSER+AK+G K     EA +IN SLSALGDVISAL++  P +PYRN+KLT                                  YA RVK I N+A +  +++E  +L+ +I KL+SG+ +DD
Sbjct:    7 LQHKIRVFCRLRPMNRNEAGQGGTAFVEKIDDYSVSV---ETPRGLREFQFDKVFGAEASQDEVFQDTS-LIQSVIDGYNVCIFAYGQTGSGKTFTMVGDKDQRNPGIMPRSFNAIFDITRENSSKFEFKQVSAYMLELYNDRLQDLFISQAAEAQAQTQPSSQTRRVEIKRTRKGVVFAQGAETKEASSAQELYALFQQACANRHIAAT-MNVESSRSHLIVVIMVESRNLTNGSISTGKLSLVDLAGSERAAKTGAKDHQLKEANSINKSLSALGDVISALSADLPHVPYRNSKLTQ---------------------------------YATRVKAITNNAQRNVESKEIAQLKEVIMKLKSGLTVDD 339          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:101166854])

HSP 1 Score: 288.5 bits (737), Expect = 1.139e-83
Identity = 152/371 (40.97%), Postives = 230/371 (61.99%), Query Frame = 2
Query: 1436 KKVNDLKQEIVKL----EKSKENIGVQLQQEVVLRKTYYNQIEDIKGKIRVFSRCRPISKSELDRGNVQCVKFPDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIK--KDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRV 2530
            + + + KQEI ++      + + +  + ++E+ LRK  +N++  +KG IRVF R RP+S+ E D  + + +   D    AV  +S  GK   F+ D++FPP+  Q++VF++   L+ S  DG+NVCIFAYGQTGSGKT+T+ G ++  PGI  R+   LF+ +TE    +   +   ++E+YNE L DL+  N   +DKL+IK   D  G + VPG      +S +++  +F  G+ NR  A T +N  SSRSH ++ + +     A+G   +G+++++DLAGSER  KSG +G    EA  IN SLSALGDVISAL      +P+RN++LT L+QDSL G+SKTLM V +SP+  N +E+  SL +AQRV
Sbjct:  410 RAITEAKQEICQVIGEVSSANQELLRKYRREMNLRKKCHNELVRLKGNIRVFCRVRPVSQEEQDSADAKTLLSFDSEDDAVLYLSNKGKTMTFELDKIFPPQATQEEVFQEVQSLVTSCIDGFNVCIFAYGQTGSGKTYTMEG-VEGDPGINQRALRLLFDEVTEKAPDWDYRITVSLVEIYNETLRDLLRENP--TDKLDIKMNPDGSGQLYVPGLTERTVQSPEDINRVFELGHANRATACTNLNEHSSRSHALLIITVSGFNGATGTRTQGRLNLVDLAGSERIGKSGAEGSRLREAQCINKSLSALGDVISALRGKHAHVPFRNSRLTYLLQDSLSGDSKTLMMVQVSPLPGNMSESVCSLKFAQRV 777          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:101166854])

HSP 1 Score: 287.345 bits (734), Expect = 1.622e-82
Identity = 152/371 (40.97%), Postives = 230/371 (61.99%), Query Frame = 2
Query: 1436 KKVNDLKQEIVKL----EKSKENIGVQLQQEVVLRKTYYNQIEDIKGKIRVFSRCRPISKSELDRGNVQCVKFPDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIK--KDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRV 2530
            + + + KQEI ++      + + +  + ++E+ LRK  +N++  +KG IRVF R RP+S+ E D  + + +   D    AV  +S  GK   F+ D++FPP+  Q++VF++   L+ S  DG+NVCIFAYGQTGSGKT+T+ G ++  PGI  R+   LF+ +TE    +   +   ++E+YNE L DL+  N   +DKL+IK   D  G + VPG      +S +++  +F  G+ NR  A T +N  SSRSH ++ + +     A+G   +G+++++DLAGSER  KSG +G    EA  IN SLSALGDVISAL      +P+RN++LT L+QDSL G+SKTLM V +SP+  N +E+  SL +AQRV
Sbjct:  516 RAITEAKQEICQVIGEVSSANQELLRKYRREMNLRKKCHNELVRLKGNIRVFCRVRPVSQEEQDSADAKTLLSFDSEDDAVLYLSNKGKTMTFELDKIFPPQATQEEVFQEVQSLVTSCIDGFNVCIFAYGQTGSGKTYTMEG-VEGDPGINQRALRLLFDEVTEKAPDWDYRITVSLVEIYNETLRDLLRENP--TDKLDIKMNPDGSGQLYVPGLTERTVQSPEDINRVFELGHANRATACTNLNEHSSRSHALLIITVSGFNGATGTRTQGRLNLVDLAGSERIGKSGAEGSRLREAQCINKSLSALGDVISALRGKHAHVPFRNSRLTYLLQDSLSGDSKTLMMVQVSPLPGNMSESVCSLKFAQRV 883          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: si:ch211-257p13.3 (kinesin-like protein KIFC3 [Source:NCBI gene;Acc:101163027])

HSP 1 Score: 268.085 bits (684), Expect = 5.804e-76
Identity = 143/367 (38.96%), Postives = 221/367 (60.22%), Query Frame = 2
Query: 1442 VNDLKQEIV----KLEKSKENIGVQLQQEVVLRKTYYNQIEDIKGKIRVFSRCRPISKSELDRGNVQCVKFPDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIKKDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRV 2530
            +N+ K++I     ++ ++ +++  + ++EV LR+ Y+ Q+ ++KG IRV  R +P+ K +        V   D    +   V   GK + F+ D+VF P+  Q+++F++   L+ S+ DGY+VCIFAYGQTGSGKTHT+ G ++N PGI  R+   LF  + E K  +S  +    +E+YNE L DL++ + E  D ++I  D  G + VPG  ++   S   ++ +      NR    T+MN  SSRSH ++ + ++    A+G    GK++++DLAGSER  KSG +G    EA  IN SL ALGDVI AL + Q  +P+RN++LT L+QDSLG  SKT+M V +S ++ N  ET  SL +AQRV
Sbjct:  534 INEAKKQIAAAINQMSEANKDLLEKYRKEVALRRKYHEQLVELKGNIRVLCRVKPVLKEDQHEEGQSVVVAIDPNNESSLTVLTKGKGRVFELDKVFQPQATQEEIFQEIEPLVTSSIDGYHVCIFAYGQTGSGKTHTMEGTVEN-PGINQRALKHLFHEIEERKDMWSYNVSVSSVEIYNEVLRDLLSKDGEKLD-IKINPDGTGQLHVPGLRVIEVNSFQHIKKILATARRNRITFGTQMNQHSSRSHALLCITVQGTDLATGSKTTGKLNLVDLAGSERVWKSGAEGERLKEAQNINRSLLALGDVIQALRARQTHVPFRNSRLTYLLQDSLGKGSKTVMVVQVSALESNVGETLCSLKFAQRV 898          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000030838.1 (SMESG000030838.1)

HSP 1 Score: 1536.16 bits (3976), Expect = 0.000e+0
Identity = 767/767 (100.00%), Postives = 767/767 (100.00%), Query Frame = 2
Query:  347 GPPEKVKGNEVERLRKSQYIREEKLKVLRAENATPEELYTEMFAEDHDEKIEALEDEIKKLKRTLEKQTNRKKNQTLPEAKLQMENDWLEVQVREWQFKIESMESKFELVKRAHKNTIDALQQAQLRVTDKKELEEMRQLLSNKKNDLYEATQLIYELQKVAFTMLPPKIAKHCEEVEETMTTAKKRLDIISYEAYRMKMEKVSCKKEISALNLAVEGENELEKIMQKKKSQKQEELDKVAKRRNDLEALIANSYSILEAAGIAYEDALAKAALMPPIELLIDXXXXXXXXXXXXXXXXXXSLSETDSKSLIVGSQRKSLTVGMNEKINFFIFKSKEIDDEVVQIKKDMEKLAKEQQSVMAEVKKVNDLKQEIVKLEKSKENIGVQLQQEVVLRKTYYNQIEDIKGKIRVFSRCRPISKSELDRGNVQCVKFPDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIKKDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIKNDATKVADTEEFPKLQAIIEKLQSGVKIDDFQNIE 2647
            GPPEKVKGNEVERLRKSQYIREEKLKVLRAENATPEELYTEMFAEDHDEKIEALEDEIKKLKRTLEKQTNRKKNQTLPEAKLQMENDWLEVQVREWQFKIESMESKFELVKRAHKNTIDALQQAQLRVTDKKELEEMRQLLSNKKNDLYEATQLIYELQKVAFTMLPPKIAKHCEEVEETMTTAKKRLDIISYEAYRMKMEKVSCKKEISALNLAVEGENELEKIMQKKKSQKQEELDKVAKRRNDLEALIANSYSILEAAGIAYEDALAKAALMPPIELLIDKPKEVKETGKKKKKEKVESLSETDSKSLIVGSQRKSLTVGMNEKINFFIFKSKEIDDEVVQIKKDMEKLAKEQQSVMAEVKKVNDLKQEIVKLEKSKENIGVQLQQEVVLRKTYYNQIEDIKGKIRVFSRCRPISKSELDRGNVQCVKFPDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIKKDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIKNDATKVADTEEFPKLQAIIEKLQSGVKIDDFQNIE
Sbjct:   89 GPPEKVKGNEVERLRKSQYIREEKLKVLRAENATPEELYTEMFAEDHDEKIEALEDEIKKLKRTLEKQTNRKKNQTLPEAKLQMENDWLEVQVREWQFKIESMESKFELVKRAHKNTIDALQQAQLRVTDKKELEEMRQLLSNKKNDLYEATQLIYELQKVAFTMLPPKIAKHCEEVEETMTTAKKRLDIISYEAYRMKMEKVSCKKEISALNLAVEGENELEKIMQKKKSQKQEELDKVAKRRNDLEALIANSYSILEAAGIAYEDALAKAALMPPIELLIDKPKEVKETGKKKKKEKVESLSETDSKSLIVGSQRKSLTVGMNEKINFFIFKSKEIDDEVVQIKKDMEKLAKEQQSVMAEVKKVNDLKQEIVKLEKSKENIGVQLQQEVVLRKTYYNQIEDIKGKIRVFSRCRPISKSELDRGNVQCVKFPDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIKKDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIKNDATKVADTEEFPKLQAIIEKLQSGVKIDDFQNIE 855          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000026762.1 (SMESG000026762.1)

HSP 1 Score: 694.886 bits (1792), Expect = 0.000e+0
Identity = 379/760 (49.87%), Postives = 497/760 (65.39%), Query Frame = 2
Query:  365 KGNEVERLRKSQYIREEKLKVLRAENATPEELYTEMFAEDHDEKIEALEDEIKKLKRTLEKQTNRKKNQTLPEA-------KLQMENDWLEVQVREWQFKIESMESKFELVKRAHKNTIDALQQAQLRVTDKKELEEMRQLLSNKKNDLYEATQLIYELQKVAFTMLPPKIAKHCEEVEETMTTAKKRLDIISYEAYRMKMEKVSCKKEISALNLAVEGENELEKIMQKKKSQKQEELDKVAKRRNDLEALIANSYSILEAAG-IAYED-ALAKAALMPPIELLIDXXXXXXXXXXXXXXXXXXSLSETDSKSLIVGSQRKSLTVGMNEKINFFIFKSKEIDDEVVQIKKDMEKLAKEQQSVMAEVKKVNDLKQEIVKLEKSKENIGVQLQQEVVLRKTYYNQIEDIKGKIRVFSRCRPISKSELDRGNVQCVKFPDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIKKDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIKNDATKVADTEEFPKLQAIIEKLQSG 2617
            K  +++ LRK +  R+  +K+ R E  + E   T  + ++ D KI        KL R +E+     +N   P+        +L  +ND LE+ +R   +KIE +ES+F+ +K++HK+ +++L Q  L+   +  ++ MR+ L N  ND  EA  L+ ELQK+A+ MLPPK+AK CEE+E  M   K + + I +  Y+ +ME     KEI AL+ A +GE  ++++ +KK          V  R+N  E L + +  I       +Y++  L K+ L  P++  I                   S+   DS   I     K      +EK+ F   K++E+D E+  I+K++E   +    V        +L+ E+ +  + K+ +  +LQQE++LRKTYYNQIED+KG+IRVF RCRPIS  E+ RGN QCV FPD Y+V V    ++   KEFQFDRVFPP   Q+DVF+DTS+L+QSAFDG+NVCIFAYGQTGSGKT TLIGN++  PGI PR+F R+FE+  EG  KF   L CYMLELYNEKLLDLMT +A Y+DKLEIKKD HGMV VPGA L  A + D+L+DLFLKGN NRHIAST+MNSESSRSHLIIS+MI C    S  I+RGK+SIIDLAGSER +KSGV+GVGA EA +INMSLSALGDVISALT+GQPF+PYRNNKLTMLMQDSLGGN+KTLMFVN+SPVDYNA ET +SL Y  RVKLIKN++ KVAD EE P+L  IIE LQ G
Sbjct:   36 KLTDLDELRKLELERD--MKIRRLEQYSSE---TSTWQDEEDIKI-------TKLIRQVEEHVLAIRNLKPPQGSKNREYIELLFQNDCLEIDIRHLNWKIEYLESRFDALKKSHKHIVESLSQVHLKNEYQDIIDAMREDLRNNNNDYNEARSLLKELQKIAWAMLPPKLAKSCEEIETKMENIKFKWEEIQFVIYKRQMELSKMHKEIVALSSAFKGEYRIKELYEKKIESS------VVCRKNLAEKLESQNIKINSLQKRFSYQNKVLDKSTLAKPVKPTISHSIVPV------------SIVSRDSDKSI-----KPQVHVKDEKLEFLQEKNEELDQEIKIIRKEIEAQERNNAQVKVGEPDTAELRAEVKRGLQVKKLMATRLQQEIILRKTYYNQIEDLKGRIRVFCRCRPISHEEVSRGNKQCVSFPDIYSVIVRIPQREKCGKEFQFDRVFPPYSIQEDVFKDTSKLLQSAFDGFNVCIFAYGQTGSGKTFTLIGNIETNPGIVPRAFKRIFEIAHEGNVKFRTKLHCYMLELYNEKLLDLMTPDAVYTDKLEIKKDSHGMVFVPGAALSSATNPDQLKDLFLKGNSNRHIASTRMNSESSRSHLIISIMITCYMKTSDNIIRGKISIIDLAGSERMSKSGVQGVGAQEAMSINMSLSALGDVISALTTGQPFVPYRNNKLTMLMQDSLGGNAKTLMFVNISPVDYNAIETASSLTYGARVKLIKNESLKVADAEEVPRLMKIIEHLQKG 760          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000026762.1 (SMESG000026762.1)

HSP 1 Score: 638.262 bits (1645), Expect = 0.000e+0
Identity = 357/760 (46.97%), Postives = 473/760 (62.24%), Query Frame = 2
Query:  365 KGNEVERLRKSQYIREEKLKVLRAENATPEELYTEMFAEDHDEKIEALEDEIKKLKRTLEKQTNRKKNQTLPEA-------KLQMENDWLEVQVREWQFKIESMESKFELVKRAHKNTIDALQQAQLRVTDKKELEEMRQLLSNKKNDLYEATQLIYELQKVAFTMLPPKIAKHCEEVEETMTTAKKRLDIISYEAYRMKMEKVSCKKEISALNLAVEGENELEKIMQKKKSQKQEELDKVAKRRNDLEALIANSYSI--LEAAGIAYEDALAKAALMPPIELLIDXXXXXXXXXXXXXXXXXXSLSETDSKSLIVGSQRKSLTVGMNEKINFFIFKSKEIDDEVVQIKKDMEKLAKEQQSVMAEVKKVNDLKQEIVKLEKSKENIGVQLQQEVVLRKTYYNQIEDIKGKIRVFSRCRPISKSELDRGNVQCVKFPDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIKKDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIKNDATKVADTEEFPKLQAIIEKLQSG 2617
            K  +++ LRK +  R+  +K+ R E  + E   T  + ++ D KI        KL R +E+     +N   P+        +L  +ND LE+ +R   +KIE +ES+F+ +K++HK+ +++L Q  L+   +  ++ MR+ L N  ND  EA  L+ ELQK+A+ MLPPK+AK CEE+E  M   K + + I +  Y+ +ME     KEI AL+ A +GE  ++++ +KK          V  R+N  E L + +  I  L+         L K+ L  P++  I                   S+   DS   I     K      +EK+ F   K++E+D E+  I+K++E   +    V        +L+ E+ +  + K+ +  +LQQE++LRKTYYNQIED+KG+IRVF RCRPIS  E+ RGN QCV FPD Y+V V    ++   KEFQFDRVFPP   Q+DVF+DTS+L+QSAFDG+NVCIFAYGQTGSGKT TLIGN++  PGI PR+F R+FE+  EG  KF   L CYMLELYNEKLLDLMT +A Y+DKLEIKKD HGMV VPGA L  A + D+L+DLFLKGN NRHIAST+MNSESSRSHLIIS+MI C    S  I+RGK+SIIDLAGSER +KSGV+G                   I +  +  PF+PYRNNKLTMLMQDSLGGN+KTLMFVN+SPVDYNA ET +SL Y  RVKLIKN++ KVAD EE P+L  IIE LQ G
Sbjct:  206 KLTDLDELRKLELERD--MKIRRLEQYSSE---TSTWQDEEDIKI-------TKLIRQVEEHVLAIRNLKPPQGSKNREYIELLFQNDCLEIDIRHLNWKIEYLESRFDALKKSHKHIVESLSQVHLKNEYQDIIDAMREDLRNNNNDYNEARSLLKELQKIAWAMLPPKLAKSCEEIETKMENIKFKWEEIQFVIYKRQMELSKMHKEIVALSSAFKGEYRIKELYEKKIE------SSVVCRKNLAEKLESQNIKINSLQKRFSYQNKVLDKSTLAKPVKPTISHSIVPV------------SIVSRDSDKSI-----KPQVHVKDEKLEFLQEKNEELDQEIKIIRKEIEAQERNNAQVKVGEPDTAELRAEVKRGLQVKKLMATRLQQEIILRKTYYNQIEDLKGRIRVFCRCRPISHEEVSRGNKQCVSFPDIYSVIVRIPQREKCGKEFQFDRVFPPYSIQEDVFKDTSKLLQSAFDGFNVCIFAYGQTGSGKTFTLIGNIETNPGIVPRAFKRIFEIAHEGNVKFRTKLHCYMLELYNEKLLDLMTPDAVYTDKLEIKKDSHGMVFVPGAALSSATNPDQLKDLFLKGNSNRHIASTRMNSESSRSHLIISIMITCYMKTSDNIIRGKISIIDLAGSERMSKSGVQGKTP----------------IGSDVNKHPFVPYRNNKLTMLMQDSLGGNAKTLMFVNISPVDYNAIETASSLTYGARVKLIKNESLKVADAEEVPRLMKIIEHLQKG 914          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000026762.1 (SMESG000026762.1)

HSP 1 Score: 637.876 bits (1644), Expect = 0.000e+0
Identity = 357/760 (46.97%), Postives = 473/760 (62.24%), Query Frame = 2
Query:  365 KGNEVERLRKSQYIREEKLKVLRAENATPEELYTEMFAEDHDEKIEALEDEIKKLKRTLEKQTNRKKNQTLPEA-------KLQMENDWLEVQVREWQFKIESMESKFELVKRAHKNTIDALQQAQLRVTDKKELEEMRQLLSNKKNDLYEATQLIYELQKVAFTMLPPKIAKHCEEVEETMTTAKKRLDIISYEAYRMKMEKVSCKKEISALNLAVEGENELEKIMQKKKSQKQEELDKVAKRRNDLEALIANSYSI--LEAAGIAYEDALAKAALMPPIELLIDXXXXXXXXXXXXXXXXXXSLSETDSKSLIVGSQRKSLTVGMNEKINFFIFKSKEIDDEVVQIKKDMEKLAKEQQSVMAEVKKVNDLKQEIVKLEKSKENIGVQLQQEVVLRKTYYNQIEDIKGKIRVFSRCRPISKSELDRGNVQCVKFPDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIKKDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINMSLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVDYNATETCNSLVYAQRVKLIKNDATKVADTEEFPKLQAIIEKLQSG 2617
            K  +++ LRK +  R+  +K+ R E  + E   T  + ++ D KI        KL R +E+     +N   P+        +L  +ND LE+ +R   +KIE +ES+F+ +K++HK+ +++L Q  L+   +  ++ MR+ L N  ND  EA  L+ ELQK+A+ MLPPK+AK CEE+E  M   K + + I +  Y+ +ME     KEI AL+ A +GE  ++++ +KK          V  R+N  E L + +  I  L+         L K+ L  P++  I                   S+   DS   I     K      +EK+ F   K++E+D E+  I+K++E   +    V        +L+ E+ +  + K+ +  +LQQE++LRKTYYNQIED+KG+IRVF RCRPIS  E+ RGN QCV FPD Y+V V    ++   KEFQFDRVFPP   Q+DVF+DTS+L+QSAFDG+NVCIFAYGQTGSGKT TLIGN++  PGI PR+F R+FE+  EG  KF   L CYMLELYNEKLLDLMT +A Y+DKLEIKKD HGMV VPGA L  A + D+L+DLFLKGN NRHIAST+MNSESSRSHLIIS+MI C    S  I+RGK+SIIDLAGSER +KSGV+G                   I +  +  PF+PYRNNKLTMLMQDSLGGN+KTLMFVN+SPVDYNA ET +SL Y  RVKLIKN++ KVAD EE P+L  IIE LQ G
Sbjct:  198 KLTDLDELRKLELERD--MKIRRLEQYSSE---TSTWQDEEDIKI-------TKLIRQVEEHVLAIRNLKPPQGSKNREYIELLFQNDCLEIDIRHLNWKIEYLESRFDALKKSHKHIVESLSQVHLKNEYQDIIDAMREDLRNNNNDYNEARSLLKELQKIAWAMLPPKLAKSCEEIETKMENIKFKWEEIQFVIYKRQMELSKMHKEIVALSSAFKGEYRIKELYEKKIE------SSVVCRKNLAEKLESQNIKINSLQKRFSYQNKVLDKSTLAKPVKPTISHSIVPV------------SIVSRDSDKSI-----KPQVHVKDEKLEFLQEKNEELDQEIKIIRKEIEAQERNNAQVKVGEPDTAELRAEVKRGLQVKKLMATRLQQEIILRKTYYNQIEDLKGRIRVFCRCRPISHEEVSRGNKQCVSFPDIYSVIVRIPQREKCGKEFQFDRVFPPYSIQEDVFKDTSKLLQSAFDGFNVCIFAYGQTGSGKTFTLIGNIETNPGIVPRAFKRIFEIAHEGNVKFRTKLHCYMLELYNEKLLDLMTPDAVYTDKLEIKKDSHGMVFVPGAALSSATNPDQLKDLFLKGNSNRHIASTRMNSESSRSHLIISIMITCYMKTSDNIIRGKISIIDLAGSERMSKSGVQGKTP----------------IGSDVNKHPFVPYRNNKLTMLMQDSLGGNAKTLMFVNISPVDYNAIETASSLTYGARVKLIKNESLKVADAEEVPRLMKIIEHLQKG 906          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000026762.1 (SMESG000026762.1)

HSP 1 Score: 518.85 bits (1335), Expect = 1.735e-172
Identity = 296/654 (45.26%), Postives = 402/654 (61.47%), Query Frame = 2
Query:  365 KGNEVERLRKSQYIREEKLKVLRAENATPEELYTEMFAEDHDEKIEALEDEIKKLKRTLEKQTNRKKNQTLPEA-------KLQMENDWLEVQVREWQFKIESMESKFELVKRAHKNTIDALQQAQLRVTDKKELEEMRQLLSNKKNDLYEATQLIYELQKVAFTMLPPKIAKHCEEVEETMTTAKKRLDIISYEAYRMKMEKVSCKKEISALNLAVEGENELEKIMQKKKSQKQEELDKVAKRRNDLEALIANSYSI--LEAAGIAYEDALAKAALMPPIELLIDXXXXXXXXXXXXXXXXXXSLSETDSKSLIVGSQRKSLTVGMNEKINFFIFKSKEIDDEVVQIKKDMEKLAKEQQSVMAEVKKVNDLKQEIVKLEKSKENIGVQLQQEVVLRKTYYNQIEDIKGKIRVFSRCRPISKSELDRGNVQCVKFPDKYTVAVYGVSKDGKPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAPGIAPRSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIKKDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHLIISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKG 2299
            K  +++ LRK +   E  +K+ R E  + E   T  + ++ D KI        KL R +E+     +N   P+        +L  +ND LE+ +R   +KIE +ES+F+ +K++HK+ +++L Q  L+   +  ++ MR+ L N  ND  EA  L+ ELQK+A+ MLPPK+AK CEE+E  M   K + + I +  Y+ +ME     KEI AL+ A +GE  ++++ +KK          V  R+N  E L + +  I  L+         L K+ L  P++  I                   S+   DS   I     K      +EK+ F   K++E+D E+  I+K++E   +    V        +L+ E+ +  + K+ +  +LQQE++LRKTYYNQIED+KG+IRVF RCRPIS  E+ RGN QCV FPD Y+V V    ++   KEFQFDRVFPP   Q+DVF+DTS+L+QSAFDG+NVCIFAYGQTGSGKT TLIGN++  PGI PR+F R+FE+  EG  KF   L CYMLELYNEKLLDLMT +A Y+DKLEIKKD HGMV VPGA L  A + D+L+DLFLKGN NRHIAST+MNSESSRSHLIIS+MI C    S  I+RGK+SIIDLAGSER +KSGV+G
Sbjct:   36 KLTDLDELRKLEL--ERDMKIRRLEQYSSE---TSTWQDEEDIKI-------TKLIRQVEEHVLAIRNLKPPQGSKNREYIELLFQNDCLEIDIRHLNWKIEYLESRFDALKKSHKHIVESLSQVHLKNEYQDIIDAMREDLRNNNNDYNEARSLLKELQKIAWAMLPPKLAKSCEEIETKMENIKFKWEEIQFVIYKRQMELSKMHKEIVALSSAFKGEYRIKELYEKKIE------SSVVCRKNLAEKLESQNIKINSLQKRFSYQNKVLDKSTLAKPVKPTISHSIVPV------------SIVSRDSDKSI-----KPQVHVKDEKLEFLQEKNEELDQEIKIIRKEIEAQERNNAQVKVGEPDTAELRAEVKRGLQVKKLMATRLQQEIILRKTYYNQIEDLKGRIRVFCRCRPISHEEVSRGNKQCVSFPDIYSVIVRIPQREKCGKEFQFDRVFPPYSIQEDVFKDTSKLLQSAFDGFNVCIFAYGQTGSGKTFTLIGNIETNPGIVPRAFKRIFEIAHEGNVKFRTKLHCYMLELYNEKLLDLMTPDAVYTDKLEIKKDSHGMVFVPGAALSSATNPDQLKDLFLKGNSNRHIASTRMNSESSRSHLIISIMITCYMKTSDNIIRGKISIIDLAGSERMSKSGVQG 654          
The following BLAST results are available for this feature:
BLAST of Kinesin-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIFC33.558e-8040.58kinesin family member C3 [Source:HGNC Symbol;Acc:H... [more]
KIFC33.558e-8040.58kinesin family member C3 [Source:HGNC Symbol;Acc:H... [more]
KIFC33.558e-8040.58kinesin family member C3 [Source:HGNC Symbol;Acc:H... [more]
KIFC35.537e-8040.58kinesin family member C3 [Source:HGNC Symbol;Acc:H... [more]
KIFC31.184e-7840.58kinesin family member C3 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
klp-201.466e-7140.58Kinesin-like protein klp-20 [Source:UniProtKB/Swi... [more]
klp-201.466e-7140.58Kinesin-like protein klp-20 [Source:UniProtKB/Swi... [more]
klp-201.466e-7140.58Kinesin-like protein klp-20 [Source:UniProtKB/Swi... [more]
klp-39.902e-6939.05Kinesin-like protein klp-3 [Source:UniProtKB/Swis... [more]
klp-116.934e-6640.60Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Klp64D7.711e-6741.16gene:FBgn0004380 transcript:FBtr0077157[more]
Kif3C1.046e-6340.71gene:FBgn0039925 transcript:FBtr0089196[more]
Klp68D2.406e-6338.20gene:FBgn0004381 transcript:FBtr0332129[more]
Klp68D2.406e-6338.20gene:FBgn0004381 transcript:FBtr0076030[more]
ncd4.700e-6236.51gene:FBgn0002924 transcript:FBtr0344976[more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-96l17.65.779e-12752.42si:dkey-96l17.6 [Source:ZFIN;Acc:ZDB-GENE-060526-3... [more]
si:dkey-96l17.67.103e-11851.39si:dkey-96l17.6 [Source:ZFIN;Acc:ZDB-GENE-060526-3... [more]
kifc32.465e-7939.73kinesin family member C3 [Source:ZFIN;Acc:ZDB-GENE... [more]
kifc31.168e-7839.73kinesin family member C3 [Source:ZFIN;Acc:ZDB-GENE... [more]
kifc31.933e-7839.73kinesin family member C3 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000033878.18.084e-7641.11kinesin family member C2 [Source:NCBI gene;Acc:100... [more]
ENSXETT00000033874.11.132e-7540.72kinesin family member C2 [Source:NCBI gene;Acc:100... [more]
epha78.315e-7141.19EPH receptor A7 [Source:Xenbase;Acc:XB-GENE-488635... [more]
cbll12.364e-7043.20Cbl proto-oncogene-like 1, E3 ubiquitin protein li... [more]
cbll12.886e-7043.20Cbl proto-oncogene-like 1, E3 ubiquitin protein li... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kifc35.110e-7941.41kinesin family member C3 [Source:MGI Symbol;Acc:MG... [more]
Kifc38.508e-7941.41kinesin family member C3 [Source:MGI Symbol;Acc:MG... [more]
Kifc31.276e-7741.41kinesin family member C3 [Source:MGI Symbol;Acc:MG... [more]
Kifc31.325e-7140.10kinesin family member C3 [Source:MGI Symbol;Acc:MG... [more]
Kif3a3.702e-7040.28kinesin family member 3A [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9FHN8|KN14E_ARATH6.168e-11148.32Kinesin-like protein KIN-14E OS=Arabidopsis thalia... [more]
sp|Q7XPJ0|KN14I_ORYSJ1.967e-10950.74Kinesin-like protein KIN-14I OS=Oryza sativa subsp... [more]
sp|F4IJK6|KN14R_ARATH3.670e-8640.60Kinesin-like protein KIN-14R OS=Arabidopsis thalia... [more]
sp|B9FAF3|KN14E_ORYSJ2.072e-8442.30Kinesin-like protein KIN-14E OS=Oryza sativa subsp... [more]
sp|F4K4C5|KN14S_ARATH6.295e-7940.10Kinesin-like protein KIN-14S OS=Arabidopsis thalia... [more]
back to top
BLAST of Kinesin-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H2XNC31.517e-15354.99Kinesin-like protein OS=Ciona intestinalis OX=7719... [more]
A0A1W2W6K86.138e-14754.86Kinesin-like protein OS=Ciona intestinalis OX=7719... [more]
R7UJM42.453e-14562.09Kinesin-like protein OS=Capitella teleta OX=283909... [more]
A0A1S3H5Q93.774e-14555.90nuclear mitotic apparatus protein 1 OS=Lingula ung... [more]
A0A3M6TV892.630e-14353.76Kinesin motor domain-containing protein OS=Pocillo... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kifc31.529e-8341.87kinesin family member C3 [Source:NCBI gene;Acc:103... [more]
kifc31.792e-8341.87kinesin family member C3 [Source:NCBI gene;Acc:103... [more]
kifc34.183e-8241.87kinesin family member C3 [Source:NCBI gene;Acc:103... [more]
kifc35.968e-8241.87kinesin family member C3 [Source:NCBI gene;Acc:103... [more]
kifc37.580e-8241.87kinesin family member C3 [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kifc31.747e-8440.16kinesin family member C3 [Source:ZFIN;Acc:ZDB-GENE... [more]
ENSPMAT00000010492.14.864e-7438.24pep scaffold:Pmarinus_7.0:GL478879:14589:34633:-1 ... [more]
kif3a8.930e-6941.72kinesin family member 3A [Source:ZFIN;Acc:ZDB-GENE... [more]
kif3ca1.709e-6338.10kinesin family member 3Ca [Source:ZFIN;Acc:ZDB-GEN... [more]
ENSPMAT00000001102.13.317e-5938.69pep scaffold:Pmarinus_7.0:GL476652:232474:299869:1... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
KAR35.162e-6637.03Minus-end-directed microtubule motor; functions in... [more]
KIP11.007e-4734.49Kinesin-related motor protein; required for mitoti... [more]
KIP31.757e-4538.00Kinesin-related antiparallel sliding motor protein... [more]
KIP27.598e-3332.44Kinesin-related motor protein involved in mitotic ... [more]
CIN85.813e-2941.76Kinesin motor protein; involved in mitotic spindle... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO372291.350e-11660.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO459508.321e-8238.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO316063.560e-7641.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349616.631e-6538.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470757.760e-6442.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-96l17.67.138e-12551.82kinesin-like protein KIN-14E [Source:NCBI gene;Acc... [more]
si:dkey-96l17.61.387e-8944.47kinesin-like protein KIN-14E [Source:NCBI gene;Acc... [more]
kifc31.139e-8340.97kinesin family member C3 [Source:NCBI gene;Acc:101... [more]
kifc31.622e-8240.97kinesin family member C3 [Source:NCBI gene;Acc:101... [more]
si:ch211-257p13.35.804e-7638.96kinesin-like protein KIFC3 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Kinesin-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000030838.10.000e+0100.00SMESG000030838.1[more]
SMESG000026762.10.000e+049.87SMESG000026762.1[more]
SMESG000026762.10.000e+046.97SMESG000026762.1[more]
SMESG000026762.10.000e+046.97SMESG000026762.1[more]
SMESG000026762.11.735e-17245.26SMESG000026762.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011124 ID=SMED30011124|Name=Kinesin-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2774bp
AATCGATATAAAAATTATTACTAGTTACAATTATGAAATGTTTTGCTAAC
AATTCAGTTTAAATTAAATGGAATAAACATCAATGTCGGAAAAAGAAAGC
AAAAAGTCAAAGAAAAAAAAGAAAGACAAAGATGATCGGTCGGATAGATC
AGATACTGGAAAAAAGAAAAGTAAAAAAGATAAAGATGATCACTCAGACA
AATCAGACACTGGAAAAAAGAAAAACAAAAAAGATAATTCTGAAGCTGAA
GAAAGTAAAAAAAAGAAAAAGAATAAAGAAGAAAATGAGGGAAATGAAAG
TAAAAAGAAGAAAGACAAGAAAAAGTCGGTTGTTAATTCTACTGATGGGC
CGCCTGAAAAGGTAAAAGGCAACGAAGTAGAAAGATTGAGAAAATCACAA
TATATTCGCGAAGAAAAACTGAAAGTTCTTAGAGCAGAAAATGCAACTCC
CGAGGAACTTTATACAGAGATGTTTGCTGAAGATCACGATGAGAAAATAG
AGGCTCTAGAAGACGAAATTAAAAAGCTGAAAAGGACTTTAGAAAAACAA
ACAAATCGAAAGAAAAACCAAACGCTGCCAGAAGCAAAATTACAAATGGA
AAATGACTGGCTAGAAGTTCAAGTAAGAGAATGGCAGTTCAAAATTGAAA
GCATGGAGAGTAAATTCGAACTTGTGAAGCGAGCCCATAAAAACACAATT
GATGCGTTGCAGCAGGCTCAGCTGCGAGTTACGGATAAGAAAGAGTTGGA
GGAAATGAGACAACTGCTGTCGAATAAAAAGAATGATCTCTATGAAGCAA
CACAATTGATTTATGAGTTACAGAAGGTTGCGTTTACCATGTTACCCCCA
AAAATAGCAAAACATTGTGAAGAAGTCGAAGAAACAATGACAACTGCAAA
AAAGCGGCTTGACATTATTAGTTATGAAGCATATAGAATGAAAATGGAAA
AAGTAAGTTGTAAAAAAGAGATATCTGCACTAAATTTGGCTGTTGAAGGT
GAAAATGAATTGGAGAAAATTATGCAAAAAAAAAAATCTCAAAAACAAGA
AGAGTTAGACAAAGTAGCAAAACGAAGAAATGATTTGGAAGCTCTTATTG
CAAATAGCTATTCCATATTGGAAGCTGCTGGAATTGCCTACGAAGACGCT
CTAGCTAAGGCAGCTTTAATGCCACCAATAGAATTATTGATTGATAAACC
GAAAGAAGTAAAAGAGACAGGAAAAAAGAAAAAAAAGGAAAAAGTCGAAT
CGCTTTCAGAAACCGACTCTAAATCATTGATAGTCGGTAGTCAAAGAAAA
TCATTAACAGTCGGAATGAATGAAAAGATCAATTTTTTTATTTTTAAATC
AAAAGAAATTGATGATGAAGTTGTACAAATAAAAAAGGACATGGAAAAGC
TGGCTAAAGAACAGCAATCTGTGATGGCCGAAGTTAAAAAAGTGAATGAT
TTGAAGCAAGAAATTGTCAAGCTTGAAAAGTCAAAAGAAAATATTGGCGT
TCAACTACAACAGGAAGTTGTATTGAGGAAAACATACTACAATCAAATCG
AAGACATCAAAGGAAAGATTCGAGTGTTCAGTCGATGTAGACCAATAAGT
AAGTCAGAACTGGATCGAGGAAATGTTCAATGTGTGAAATTTCCTGACAA
GTATACCGTAGCGGTTTATGGGGTATCCAAAGACGGTAAACCAAAGGAAT
TTCAGTTTGATAGAGTGTTTCCTCCAGAAATTGGACAAGATGATGTTTTT
GAGGATACTTCTAGACTAATCCAATCAGCATTCGATGGATATAATGTCTG
TATATTTGCCTATGGTCAAACCGGAAGTGGCAAAACTCACACTTTGATTG
GAAATTTACAAAACGCCCCTGGAATTGCTCCACGGTCATTTGTACGATTG
TTTGAAGTTATGACCGAGGGAAAAGCCAAGTTTTCGGCCACCTTGAAATG
CTACATGTTGGAGCTGTACAATGAGAAATTATTGGACTTGATGACAGCAA
ATGCAGAATATTCGGACAAATTGGAAATCAAAAAGGATCAGCATGGAATG
GTCGTAGTTCCAGGAGCTGAATTGCTTCCAGCAAAATCTTCAGATGAGTT
AAGAGATTTGTTTTTGAAAGGAAATGGTAACAGGCATATTGCATCAACAA
AGATGAACTCCGAAAGTTCTCGGTCTCATTTAATTATCAGTATGATGATT
GAATGCGTTCAGCACGCAAGTGGGAAAATTGTCAGAGGGAAAATGTCAAT
TATAGATTTAGCAGGAAGTGAAAGGTCAGCAAAAAGCGGCGTCAAAGGTG
TTGGAGCAACCGAGGCAACGGCTATTAACATGTCTTTGTCTGCTCTTGGA
GATGTAATTTCGGCGTTAACCTCTGGTCAACCGTTTATTCCTTATCGAAA
TAATAAGTTGACAATGTTAATGCAAGACTCATTGGGAGGAAATTCCAAAA
CTTTGATGTTTGTTAACCTCTCTCCAGTTGACTACAATGCAACAGAAACT
TGTAATTCGCTGGTCTATGCCCAAAGAGTAAAGTTAATCAAAAACGACGC
AACTAAAGTCGCCGACACGGAAGAATTTCCGAAATTGCAAGCGATCATAG
AAAAGCTTCAATCCGGTGTAAAAATTGACGATTTTCAAAACATAGAATAG
TGCTCTTTCGGTTTTCATTATTTTCCCCGTGAAAAAAAGTGAGAAATATG
ATGAAATTGACATTGACAACAATGGGAAATTGTAATTATTATGAATATTA
GATCACTAATTTGTCTAATCTTTT
back to top

protein sequence of SMED30011124-orf-1

>SMED30011124-orf-1 ID=SMED30011124-orf-1|Name=SMED30011124-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=856bp
MSEKESKKSKKKKKDKDDRSDRSDTGKKKSKKDKDDHSDKSDTGKKKNKK
DNSEAEESKKKKKNKEENEGNESKKKKDKKKSVVNSTDGPPEKVKGNEVE
RLRKSQYIREEKLKVLRAENATPEELYTEMFAEDHDEKIEALEDEIKKLK
RTLEKQTNRKKNQTLPEAKLQMENDWLEVQVREWQFKIESMESKFELVKR
AHKNTIDALQQAQLRVTDKKELEEMRQLLSNKKNDLYEATQLIYELQKVA
FTMLPPKIAKHCEEVEETMTTAKKRLDIISYEAYRMKMEKVSCKKEISAL
NLAVEGENELEKIMQKKKSQKQEELDKVAKRRNDLEALIANSYSILEAAG
IAYEDALAKAALMPPIELLIDKPKEVKETGKKKKKEKVESLSETDSKSLI
VGSQRKSLTVGMNEKINFFIFKSKEIDDEVVQIKKDMEKLAKEQQSVMAE
VKKVNDLKQEIVKLEKSKENIGVQLQQEVVLRKTYYNQIEDIKGKIRVFS
RCRPISKSELDRGNVQCVKFPDKYTVAVYGVSKDGKPKEFQFDRVFPPEI
GQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAPGIAP
RSFVRLFEVMTEGKAKFSATLKCYMLELYNEKLLDLMTANAEYSDKLEIK
KDQHGMVVVPGAELLPAKSSDELRDLFLKGNGNRHIASTKMNSESSRSHL
IISMMIECVQHASGKIVRGKMSIIDLAGSERSAKSGVKGVGATEATAINM
SLSALGDVISALTSGQPFIPYRNNKLTMLMQDSLGGNSKTLMFVNLSPVD
YNATETCNSLVYAQRVKLIKNDATKVADTEEFPKLQAIIEKLQSGVKIDD
FQNIE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR036961Kinesin_motor_dom_sf
IPR027640Kinesin-like_fam
IPR001752Kinesin_motor_dom
IPR019821Kinesin_motor_CS
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0003777microtubule motor activity
GO:0005524ATP binding
GO:0008017microtubule binding
GO:0000166nucleotide binding
GO:0003774motor activity
GO:0016887ATPase activity
Vocabulary: biological process
TermDefinition
GO:0007018microtubule-based movement
Vocabulary: cellular component
TermDefinition
GO:0005871kinesin complex
GO:0005874microtubule
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 303..338
NoneNo IPR availableCOILSCoilCoilcoord: 219..239
NoneNo IPR availableCOILSCoilCoilcoord: 423..474
NoneNo IPR availableCOILSCoilCoilcoord: 132..159
NoneNo IPR availableCOILSCoilCoilcoord: 45..72
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..86
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..108
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 93..108
NoneNo IPR availablePANTHERPTHR24115:SF818coord: 359..825
IPR001752Kinesin motor domainPRINTSPR00380KINESINHEAVYcoord: 720..738
score: 49.52
coord: 689..706
score: 49.35
coord: 769..790
score: 62.23
coord: 569..590
score: 71.59
IPR001752Kinesin motor domainSMARTSM00129kinesin_4coord: 493..827
e-value: 1.2E-139
score: 479.9
IPR001752Kinesin motor domainPFAMPF00225Kinesincoord: 501..819
e-value: 9.2E-98
score: 327.2
IPR001752Kinesin motor domainPROSITEPS50067KINESIN_MOTOR_2coord: 495..819
score: 106.371
IPR036961Kinesin motor domain superfamilyGENE3DG3DSA:3.40.850.10coord: 490..854
e-value: 1.2E-124
score: 417.8
IPR027640Kinesin-like proteinPANTHERPTHR24115FAMILY NOT NAMEDcoord: 359..825
IPR019821Kinesin motor domain, conserved sitePROSITEPS00411KINESIN_MOTOR_1coord: 719..730
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 495..846