coiled-coil domain-containing protein 170

Overview
Namecoiled-coil domain-containing protein 170
Smed IDSMED30011111
Length (bp)2704
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of coiled-coil domain-containing protein 170 (SMED30011111) t-SNE clustered cells

Violin plots show distribution of expression levels for coiled-coil domain-containing protein 170 (SMED30011111) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of coiled-coil domain-containing protein 170 (SMED30011111) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for coiled-coil domain-containing protein 170 (SMED30011111) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011111

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30011111SMESG000051384.1 SmedASXL_015557SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30011111SMESG000051384.1 dd_Smed_v4_7992_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30011111SMESG000051384.1 dd_Smed_v4_7992_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011111SMESG000051384.1 dd_Smed_v4_7992_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30011111SMESG000051384.1 dd_Smed_v4_7992_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30011111SMESG000051384.1 dd_Smed_v6_7992_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30011111SMESG000051384.1 OX_Smed_1.0.10758ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30011111SMESG000051384.1 dd_Smed_v4_7992_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Human
Match: CCDC170 (coiled-coil domain containing 170 [Source:HGNC Symbol;Acc:HGNC:21177])

HSP 1 Score: 103.219 bits (256), Expect = 6.525e-22
Identity = 118/536 (22.01%), Postives = 263/536 (49.07%), Query Frame = 1
Query:  721 KYQEFLISISRLINFDNIADR---EGIINKLGSITDQNAFLNGKMHALEEKLQISESNAKEARETIVKLMNDF-------GGAGHDREELREAKNRFQTEKNDLKAQIDLLNNRLGSLQKLYDEAKNELESKTNNLLSLEVKVKEQQFSAQASETVFQSLLESLAAIIGTPFAPCASTEAAVKDRVKVLVKTVKDQSAAAEILDQRVLMLQKQFESQYETGRQLLDRTKDSDNMKQELVNKIKSLEDELSAQEIFRDNIRCEKDRIIRYVRKLADLLQMDYLPGDNDTVGLLDLLEGRCQELMIKLSGGSWKCPRCVSINNPNIDSQKQSKRIASLKEEIEAKDLQIQLLEKRMVEFGKSVHPSSCLMGDETNRDRVHXXXXXXXXXXXXXXXXXXALVRSQSSDFEIHKQIKHK-------------QQEELEQLSETVEKLDKVRQRQAKKIAGLKSQIEEKSQVLMQHGKR--------DMDYKQARQLLEEVRRREIKLNDFRSAIAQMIGVDVRCSPDPENEIKARIQKLM 2235
            K++EFL  +   ++ D   D+   E +I KL  +  +N F+ G++  LEE + + E  AK +RETI++L ++             ++E+L +        K  L+ ++ +   RL + Q+++D +K E+     +   LE  +K  Q +   S++ + S  E +AA++    +   STE  + ++++ +    + +      L+ ++  L +Q   +    ++ L R + ++NM + L  ++  LE EL +  + RDN+  EK + ++++ +L+  +++D +  +      LD++  R ++L ++L   +        I N  I    Q +++ + KE +E+K+L + LL +++ +  +     + L+     RD  H     L++           L +  ++  ++H ++K K             Q + +E L+++ ++L+K++++  KK+  +KS+++       ++ +R          + K  ++ LEE  +RE +L DFR  ++QM+G++V     P+ EI   +++L+
Sbjct:  167 KHEEFLTQLRDCLDPDERNDKASDEDLILKLRDLRKENEFVKGQIVILEETINVHEMEAKASRETIMRLASEVNREQKKAASCTEEKEKLNQDLLSAVEAKEALEREVKIFQERLLAGQQVWDASKQEVSLLKKSSSELEKSLKASQDAVTTSQSQYFSFREKIAALLRGRLSMTGSTEDTILEKIREMDSREESRDRMVSQLEAQISELVEQLGKESGFHQKALQRAQKAENMLETLQGQLTHLEAELVSGGVLRDNLNFEKQKYLKFLDQLSQKMKLDQMAAELGFDMRLDVVLARTEQL-VRLESNAV-------IENKTIAHNLQ-RKLKTQKERLESKELHMSLLRQKIAQLEEEKQARTALV---VERDNAHLTIRNLQKKVER-------LQKELNTCRDLHTELKAKLADTNELKIKTLEQTKAIEDLNKSRDQLEKMKEKAEKKLMSVKSELDTTEHEAKENKERARNMIEVVTSEMKTLKKSLEEAEKREKQLADFREVVSQMLGLNVTSLALPDYEIIKCLERLV 683          
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Zebrafish
Match: ccdc170 (coiled-coil domain containing 170 [Source:ZFIN;Acc:ZDB-GENE-070112-162])

HSP 1 Score: 61.2326 bits (147), Expect = 4.059e-9
Identity = 125/576 (21.70%), Postives = 268/576 (46.53%), Query Frame = 1
Query:  598 IKLLQDQYRESQCKIADLEARIKNHLNDRERIDHMKSNVETKYQEFLISISRLINFDNIADREG-----IINKLGSITDQNAFLNGKMHALEEKLQISESNAKEARETIVKLMNDFGGAGHDREELREAKNRFQTEKNDLKAQIDLLNNRLGSLQKLYDEAKNELESKTNNLLS--------------LEVKVKEQQFSAQASETVFQSLLESLAAIIGTPFAPCASTEAAVKDRVKVLVKTVKDQSAAAEI---LDQRVLMLQKQFESQYETGRQLLDRTKDSDNMKQELVNKIKSLEDELSAQEIFRDNIRCEKDRIIRYVRKLADLLQMDYLPGDNDTVGLLDLLEGRCQELMIKLSGGSWKCPRCVSINNPNIDSQKQS----KRIASLKEEIEAKDLQIQLLEKRMVEFGKSVHPSSCLMGDETNRDRVHXXXXXXXXXXXXXXXXXXALVRSQSSDFEIHKQIKH---------KQQEELEQLSETVEKLDKVRQRQAKKIAGLKSQIEEKSQVL-----MQHGKRDMDYKQARQLLEEVRRREIKLNDFRSAIAQMIGVDVR-CSPDPE 2202
            I+ L  + +E + KI  LE   K ++ +  +     +  + K +EF+ +++  I+   IA  +      I++ + +       L   + ALEE +++ E   K +RET+ +L  D      DRE+   A      E N  + ++DL++ R  SL++    AK  L+     L S              L+ K++  Q  A+AS     + ++ +  ++     P   TE   +D +  L    K +++A +    ++ R+  + +Q  S       + +    S+  KQEL+++I+SLEDEL    + +D +  +K + +R+V +L+++L++D +  +      L+++  R Q+L  +  G +             ++++ Q+    +++   K   E+KDL ++LL +++ +  +     S L  ++ +           ++ Q  ++ L+  L   + S+ E+  Q+ H         +Q++ +E+ ++ + KL+K + +  +K+  + S++  KSQ L     +Q   R +D + +   + ++   E +L DF + ++QM+GV    C P+ E
Sbjct:  102 IQTLTKENQEIKEKIMQLEVESKQYVAECNKAKQEAAEAQRKCEEFISTLANKISV--IATGKADPMDYIVSVVDACFKDRERLKNCVCALEESVKLYEVECKASRETVKRLATDV-----DREQTLSASR--ANELNSSRQELDLISLRKVSLERENQSAKVSLQEAEAALASAQQLCRHYENLSQDLQNKLQISQNEAKASHRHHGAFMKKVETLLDDHSLPGQHTE---QDMLSALTDLCKRETSAQKSQMEMEVRLAEMVEQLSS-------IKEHQNTSEQKKQELLDRIQSLEDELINARVCKDGMNQDKQQYLRFVEQLSEMLKVDDVAAELGFDMRLEVILTRAQQLS-RHEGTAL------------LETKTQTYSLQRKLKEQKSRSESKDLYLELLRRKVQQLEEEKRSRSTLALEKDD------AALSCKKLQKRVDRLQAELSTLRFSNTELKAQLSHTNQLQITVMEQKQTIEEQNKNLGKLEKKKVKTEQKLTSVTSEL--KSQELKARDEIQQAHRLLDTQSS--AIADLTHTEKQLLDFYTVVSQMLGVHCTGCIPNYE 635          
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Xenopus
Match: c1qtnf4 (C1q and TNF related 4 [Source:Xenbase;Acc:XB-GENE-975450])

HSP 1 Score: 122.094 bits (305), Expect = 4.123e-28
Identity = 128/555 (23.06%), Postives = 285/555 (51.35%), Query Frame = 1
Query:  682 RERIDHMKSNVETKYQEFLISISRLINFDNIADREGIINKLGS---ITDQNAFLN----------GKMHALEEKLQISESNAKEARETIVKLMNDFGG----AGHDREELREAKNRFQTEKND---LKAQIDLLNNRLGSLQKLYDEAKNELESKTNNLLSLEVKVKEQQFSAQASETVFQSLLESLAAIIGTPFAPCASTEAAVKDRVKVLVKTVKDQSAAAEILDQRVLMLQKQFESQYETGRQLLDRTKDSDNMKQELVNKIKSLEDELSAQEIFRDNIRCEKDRIIRYVRKLADLLQMDYLPGDNDTVGL---LDLLEGRCQELMIKLSGGSWKCPRCVSINNPNIDSQKQSKRIASLKEEIEAKDLQIQLLEKRMVEFG--KSVHPSSCLMGDETNRD--RVHXXXXXXXXXXXXXXXXXXALVRSQSSDFEIHKQIKHKQQEELEQLSETVEKLDKVRQRQAKKIAGLKSQIE----------EKSQVLMQHGKRDMDYKQARQLLEEVRRREIKLNDFRSAIAQMIGVDVRCSPDPENEIKARIQKLM 2235
            RE+++H +   E    E     +  + F+++    GI + + S   I   NA++N          G + +LE+ + + E+ +K +RETI++L+++       A    ++L   +   ++  +D   L+ +I +L +RL + Q+ ++ +K EL     +   L++ +K  +  A+A+ ++ +S  E++AA +          E A+ ++++ +    +++      L++RV  L +Q ++Q E  ++ + R + ++    +L  ++K  E EL + ++ RDN+  EK + ++++ +L++ +++D +  D   VG    L+ + GR  +L +KL   +        I      +Q   +++ + KE I++K+L ++LL K++ +    K V  +  +  DE N    R+ +   +L++      +    L +++ SD    K    +Q + +E+L+++V++L+K + +  KK+  +KS++E          E+S  L++    ++  K  ++ LEEV +RE +L DFR  +++M+G++V     P+ EI  R++ L+
Sbjct:   32 REQMNHYRIIAENAQSEL---AALHVKFESVQTEVGIADLMISNCLIKKINAYINELYKDNTELKGSIASLEQTVNVHETESKGSRETIMRLVSEVSKEQKKASSFAKQLDSLQKNLESTSDDKESLEREIKILKDRLSASQRAWEASKQELGQVKKSSTELDLSLKSTRGEAKAAHSLHESFKETVAAALSHDSIAVKPKEEAILEKIRDMYHKAENRKTIISQLEERVFKLSEQLQTQTELHQESMSRARKAEQYLDDLGGRLKLAEGELVSGDVMRDNLSHEKQKYMKFLEQLSEKMKIDRVATD---VGFDMRLEAILGRADQL-VKLETNA--------IIENKTRAQGLQRKLKAQKETIDSKELHMELLRKKIAQLEEEKQVRTALAVERDEANLTVRRLQKKVDRLQKELNVALDSNTGL-KARLSDTNELKIKTIEQHKTIEELNKSVDQLEKEKGKTQKKLVSVKSELEFTERDAQEEKERSANLLEVVTSEL--KTLKKTLEEVVKREKQLVDFREVVSRMLGLNVNVLALPDYEIIKRLEGLI 568          
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Xenopus
Match: ENSXETT00000000426.1 (coiled-coil domain-containing protein 170-like [Source:NCBI gene;Acc:100488825])

HSP 1 Score: 107.842 bits (268), Expect = 2.352e-23
Identity = 140/607 (23.06%), Postives = 294/607 (48.43%), Query Frame = 1
Query:  637 KIADLEARIKNHLNDRERIDHMKSNVETKYQEFLISISRLINFDNIADREGIIN----KLGSITDQNAFLNGKMHALEEKLQISESNAKEARETIVKLMNDF-------GGAGHDREELREAKNRFQTEKNDLKAQIDLLNNRLGSLQKLYDEAKNELESKTNNLLSLEVKVKEQQFSAQASETVFQSLLESLAAIIGTPFAPCASTEAAVKDRVKVLVKTVKDQSAAAEILDQRVLMLQKQFESQYETGRQLLDRTKDSDNMKQELVNKIKSLEDELSAQEIFRDNIRCEKDRIIRYVRKLADLLQMDYLPGDNDTVGLLDLLEGRCQELMIKLSGGSWKCPRCVSINNPNIDSQKQSKRIASLKEEIEAKDLQIQLLEKRMVEFGK--------SVHPSSCLMGDETNRDRVHXXXXXXXXXXXXXXXXXXALVRSQSSDFEIHKQIKHKQQEELEQLSETVEKLDKVRQRQAKKIAGLKSQIE----------EKSQVLMQHGKRDMDYKQARQLLEEVRRREIKLNDFRSAIAQMIGVDVRCSPDPENEIKARIQKLMAMARNAVNTPFTPYYLSQ-EMPSAFQQG-----YSNPSLGGYTNT 2352
            ++ +LE RI+ HL +RE+ +   + +E K +E +  +   +N D + ++E  +N    K+  +  ++     K+ +LEE L   +   K +RETIV+L+++         G     + ++  ++     K   + + +LL  ++    K +   + EL  K   L  L+  ++   + A+AS ++ QS +  LA ++   F     TE A+K+R++ +    ++     + L ++VL L KQ + Q +   + + +   ++ + QE    +K L+ +L+++E+ +D    E+ ++ +++ ++A+ L +             ++L  R +E+  +   G  K  + +  N          K+I S  E+IE K  +I+ LEK++ +  K        S   S  L   +  + +V RLQ QL E ++  + L   LV     D    K+   +Q++ +E+LS  +EKL+K++++ AKK+  LK++++          E+ Q +++    ++    A++ LEEV +RE +L  FR AI +M+G ++     P++EI  ++++++       + P  P    + ++P  F+ G     Y+   +  + N 
Sbjct:  193 RVQELENRIRMHLIEREKTEQKFNGLEKKMKESIGKLCSCLNMD-VEEQEDPLNILLTKVEKLIKEHFVQKSKLSSLEEVLAGRQVEYKASRETIVQLVSEIDKHKKTVAGLEAQLKSIKRERDETLLAKQSAEQEKELLLGKIKDNHKEWSSFQQELVRKEKKLNELDRTLRTSDYEAKASHSLHQSFIIQLATVLSNGFITVPRTEEAIKERIQEICSREQEWKVTTDELQEKVLKLTKQLDQQRDLYHEAVTKAYKAEEILQENQESLKHLKGKLTSEEMIKDGFNSERKKLKKFLLQMAEKLNVVQDISSGSLTSQYEVLLNRAEEVTER-DKGFLKDSKTLIYN--------LQKKITSQAEKIELKSTKIEQLEKKIKQLEKEKEQQLLLSAENSGSLTAQKLQK-KVERLQGQLSEMKITTQTLTAQLV-----DMSDLKERNMQQKKTIEELSRALEKLEKIKEKAAKKVVSLKTELDYSEHEFRGDKERCQHMVEAVTNELH--TAKRALEEVAKREKQLVYFREAITRMMGFNLNTLAVPDHEIFDQLKRVL-----RTHGPTDPGRADRSKLPYGFRTGDGEQEYTVQHISAFQNA 776          
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Mouse
Match: Ccdc170 (coiled-coil domain containing 170 [Source:MGI Symbol;Acc:MGI:2685067])

HSP 1 Score: 118.242 bits (295), Expect = 9.437e-27
Identity = 135/604 (22.35%), Postives = 289/604 (47.85%), Query Frame = 1
Query:  577 KHRSEYTIKLLQDQYRESQCKIADLEARIKNHLNDRERIDHMKSNVETKYQEFLISISRLINFDNI---ADREGIINKLGSITDQNAFLNGKMHALEEKLQISESNAKEARETIVKLMNDFGGAGHDREELREAKNRFQTE-------KNDLKAQIDLLNNRLGSLQKLYDEAKNELESKTNNLLSLEVKVKEQQFSAQASETVFQSLLESLAAIIGTPFAPCASTEAAVKDRVKVLVKTVKDQSAAAEILDQRVLMLQKQFESQYETGRQLLDRTKDSDNMKQELVNKIKSLEDELSAQEIFRDNIRCEKDRIIRYVRKLADLLQMDYLPGDNDTVGLLDLLEGRCQELMIKLSGGSWKCPRCVSINNPNIDSQKQSKRIASLKEEIEAKDLQIQLLEKRMVEFGKSVHPSSCLMGDETNRDRVHXXXXXXXXXXXXXXXXXXAL------VRSQSSDFEIHKQIKHKQQEELEQLSETVEKLDKVRQRQAKKIAGLKSQIEEKSQVLMQHGKRD--------MDYKQARQLLEEVRRREIKLNDFRSAIAQMIGVDVRCSPDPENEIKARIQKLMAMARNAVNTPFTPYYLSQEMPSAFQQG 2316
            K R+E ++  +  + +E   K+ +L+ +++N   + E      S    +++EF   +   ++ D     A  E +I KL  +  +  FL G++  LEE + + E  AK  RETI +L  +            E K++   +       +  L+ ++ L   RL + Q+ +D +K EL         L+V +K  + +  AS++      E L A++ + F    STE A+ +R++ L    + Q   A  L+ ++     +  ++ E+ ++ L R   ++   + L +++  LE EL + ++ RDN+  EK + ++++ +L + +++ ++  D      LD++  R ++L ++L   +        I N  +    Q +++ + KE +E+K++ + LL +++ +  +     S L      RD  H    +LE+    +++   A       ++++ +D    K    +Q + +E L+++ ++L+K+++   KK+  + S++E   Q    H +R         ++ K  R+ L+E  RR ++L DFR  ++ M+G+++     P+ EI   +++L+   R+  +  F P    Q+M  A +QG
Sbjct:  122 KSRAEASVHAMMKENQELMKKVLELDEKLQNCSKENEESKKQGSEHLRRHEEFRAQLHDCLSLDKKHEEASDEDLILKLRELYKEPTFLKGQLATLEETVTVHEMEAKANRETIRRLAAEVSREQTKAASWAEEKDKLNQDLLSAVEGRTALEREVKLYQERLLASQRAWDASKQELTQLRKRCQELDVSLKASREATTASQSRNSCFREKLTALLCSRFDTAESTEDAILERIRELGIEEESQRRMASQLEAQISEFVGKLGNESESHQKALQRAHVAEKKLEALQSQLSHLEGELLSGDVVRDNLFLEKQKYLKFLDQLTEKMKLGHVAADLGFDVCLDVVLARIEQL-VRLESNA-------VIENKTMAHNLQ-RKLKTQKERLESKEVHMNLLRQKIAQLQQEKEARSALA---VERDEAHLAMRKLEKKLERMQKELSACQEHNTELKAKLADTNELKIKTLEQTKAIEDLNQSRDELEKMKENAEKKLMLVMSELENTEQEARAHQERSRAMIELASLELKTLRKSLDEAERRGMQLADFREVVSSMLGLNMTSHDPPDYEIIKCLERLLHSHRHHHHHHFVPCACLQDM--AAEQG 711          
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Mouse
Match: Ccdc170 (coiled-coil domain containing 170 [Source:MGI Symbol;Acc:MGI:2685067])

HSP 1 Score: 117.087 bits (292), Expect = 2.068e-26
Identity = 135/604 (22.35%), Postives = 289/604 (47.85%), Query Frame = 1
Query:  577 KHRSEYTIKLLQDQYRESQCKIADLEARIKNHLNDRERIDHMKSNVETKYQEFLISISRLINFDNI---ADREGIINKLGSITDQNAFLNGKMHALEEKLQISESNAKEARETIVKLMNDFGGAGHDREELREAKNRFQTE-------KNDLKAQIDLLNNRLGSLQKLYDEAKNELESKTNNLLSLEVKVKEQQFSAQASETVFQSLLESLAAIIGTPFAPCASTEAAVKDRVKVLVKTVKDQSAAAEILDQRVLMLQKQFESQYETGRQLLDRTKDSDNMKQELVNKIKSLEDELSAQEIFRDNIRCEKDRIIRYVRKLADLLQMDYLPGDNDTVGLLDLLEGRCQELMIKLSGGSWKCPRCVSINNPNIDSQKQSKRIASLKEEIEAKDLQIQLLEKRMVEFGKSVHPSSCLMGDETNRDRVHXXXXXXXXXXXXXXXXXXAL------VRSQSSDFEIHKQIKHKQQEELEQLSETVEKLDKVRQRQAKKIAGLKSQIEEKSQVLMQHGKRD--------MDYKQARQLLEEVRRREIKLNDFRSAIAQMIGVDVRCSPDPENEIKARIQKLMAMARNAVNTPFTPYYLSQEMPSAFQQG 2316
            K R+E ++  +  + +E   K+ +L+ +++N   + E      S    +++EF   +   ++ D     A  E +I KL  +  +  FL G++  LEE + + E  AK  RETI +L  +            E K++   +       +  L+ ++ L   RL + Q+ +D +K EL         L+V +K  + +  AS++      E L A++ + F    STE A+ +R++ L    + Q   A  L+ ++     +  ++ E+ ++ L R   ++   + L +++  LE EL + ++ RDN+  EK + ++++ +L + +++ ++  D      LD++  R ++L ++L   +        I N  +    Q +++ + KE +E+K++ + LL +++ +  +     S L      RD  H    +LE+    +++   A       ++++ +D    K    +Q + +E L+++ ++L+K+++   KK+  + S++E   Q    H +R         ++ K  R+ L+E  RR ++L DFR  ++ M+G+++     P+ EI   +++L+   R+  +  F P    Q+M  A +QG
Sbjct:  116 KSRAEASVHAMMKENQELMKKVLELDEKLQNCSKENEESKKQGSEHLRRHEEFRAQLHDCLSLDKKHEEASDEDLILKLRELYKEPTFLKGQLATLEETVTVHEMEAKANRETIRRLAAEVSREQTKAASWAEEKDKLNQDLLSAVEGRTALEREVKLYQERLLASQRAWDASKQELTQLRKRCQELDVSLKASREATTASQSRNSCFREKLTALLCSRFDTAESTEDAILERIRELGIEEESQRRMASQLEAQISEFVGKLGNESESHQKALQRAHVAEKKLEALQSQLSHLEGELLSGDVVRDNLFLEKQKYLKFLDQLTEKMKLGHVAADLGFDVCLDVVLARIEQL-VRLESNA-------VIENKTMAHNLQ-RKLKTQKERLESKEVHMNLLRQKIAQLQQEKEARSALA---VERDEAHLAMRKLEKKLERMQKELSACQEHNTELKAKLADTNELKIKTLEQTKAIEDLNQSRDELEKMKENAEKKLMLVMSELENTEQEARAHQERSRAMIELASLELKTLRKSLDEAERRGMQLADFREVVSSMLGLNMTSHDPPDYEIIKCLERLLHSHRHHHHHHFVPCACLQDM--AAEQG 705          
BLAST of coiled-coil domain-containing protein 170 vs. UniProt/SwissProt
Match: sp|Q8IYT3|CC170_HUMAN (Coiled-coil domain-containing protein 170 OS=Homo sapiens OX=9606 GN=CCDC170 PE=1 SV=3)

HSP 1 Score: 103.219 bits (256), Expect = 3.133e-21
Identity = 118/536 (22.01%), Postives = 263/536 (49.07%), Query Frame = 1
Query:  721 KYQEFLISISRLINFDNIADR---EGIINKLGSITDQNAFLNGKMHALEEKLQISESNAKEARETIVKLMNDF-------GGAGHDREELREAKNRFQTEKNDLKAQIDLLNNRLGSLQKLYDEAKNELESKTNNLLSLEVKVKEQQFSAQASETVFQSLLESLAAIIGTPFAPCASTEAAVKDRVKVLVKTVKDQSAAAEILDQRVLMLQKQFESQYETGRQLLDRTKDSDNMKQELVNKIKSLEDELSAQEIFRDNIRCEKDRIIRYVRKLADLLQMDYLPGDNDTVGLLDLLEGRCQELMIKLSGGSWKCPRCVSINNPNIDSQKQSKRIASLKEEIEAKDLQIQLLEKRMVEFGKSVHPSSCLMGDETNRDRVHXXXXXXXXXXXXXXXXXXALVRSQSSDFEIHKQIKHK-------------QQEELEQLSETVEKLDKVRQRQAKKIAGLKSQIEEKSQVLMQHGKR--------DMDYKQARQLLEEVRRREIKLNDFRSAIAQMIGVDVRCSPDPENEIKARIQKLM 2235
            K++EFL  +   ++ D   D+   E +I KL  +  +N F+ G++  LEE + + E  AK +RETI++L ++             ++E+L +        K  L+ ++ +   RL + Q+++D +K E+     +   LE  +K  Q +   S++ + S  E +AA++    +   STE  + ++++ +    + +      L+ ++  L +Q   +    ++ L R + ++NM + L  ++  LE EL +  + RDN+  EK + ++++ +L+  +++D +  +      LD++  R ++L ++L   +        I N  I    Q +++ + KE +E+K+L + LL +++ +  +     + L+     RD  H     L++           L +  ++  ++H ++K K             Q + +E L+++ ++L+K++++  KK+  +KS+++       ++ +R          + K  ++ LEE  +RE +L DFR  ++QM+G++V     P+ EI   +++L+
Sbjct:  167 KHEEFLTQLRDCLDPDERNDKASDEDLILKLRDLRKENEFVKGQIVILEETINVHEMEAKASRETIMRLASEVNREQKKAASCTEEKEKLNQDLLSAVEAKEALEREVKIFQERLLAGQQVWDASKQEVSLLKKSSSELEKSLKASQDAVTTSQSQYFSFREKIAALLRGRLSMTGSTEDTILEKIREMDSREESRDRMVSQLEAQISELVEQLGKESGFHQKALQRAQKAENMLETLQGQLTHLEAELVSGGVLRDNLNFEKQKYLKFLDQLSQKMKLDQMAAELGFDMRLDVVLARTEQL-VRLESNAV-------IENKTIAHNLQ-RKLKTQKERLESKELHMSLLRQKIAQLEEEKQARTALV---VERDNAHLTIRNLQKKVER-------LQKELNTCRDLHTELKAKLADTNELKIKTLEQTKAIEDLNKSRDQLEKMKEKAEKKLMSVKSELDTTEHEAKENKERARNMIEVVTSEMKTLKKSLEEAEKREKQLADFREVVSQMLGLNVTSLALPDYEIIKCLERLV 683          
BLAST of coiled-coil domain-containing protein 170 vs. TrEMBL
Match: A0A1I8I2T8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 2.820e-61
Identity = 200/679 (29.46%), Postives = 359/679 (52.87%), Query Frame = 1
Query:  409 LRKKQYEIDSKNEQLAVLKKESELNRLEFEKVDKENQKILNSNKTYENTVQTYESLK---HRSEYTIKLLQDQYRESQCKIADLEARIKNHLNDRERIDHMKSNVETKYQEFLISISRLINFDNIADREGIINKLGSITDQNAFLNGKMHALEEKLQISESNAKEARETIVKLMNDFG--------GAGH---DREELREAKNRFQTEKNDLKAQIDLLNNRLGSLQKLYDEAKNELESKTNNLLSLEVKVKEQQFSAQASETVFQSLLESLAAIIGTPFAPCASTEAAVKDRVKVLVKTVKDQSAAAEILDQRVLMLQKQFESQYETGRQLLDRTKDSDNMKQELVNKIKSLEDELSAQEIFRDNIRCEKDRIIRYVRKLADLLQMDYLPGDNDTVGLLDLLEG---RCQELMIKLSGGSWKCPRCVSINNPNIDSQKQSKRIASLKEEIEAKDLQIQLLEKRMVEFGKSVHPSSCLMGDETN---RDRVHXXXXXXXXXXXXXXXXXXALVRSQSSDFEIH--KQIKHKQQEELEQLSETVEKLDKVRQRQAKKIAGLKSQIE----EKSQVLMQHGKRDMDYKQARQLLEEVRRREIKLNDFRSAIAQMIGVDVRCSPDPENEIKARIQKLMAMARNAVNTPFTPYY--LSQEMPSAFQQGYSNPSLGGYTNTNNP 2361
            LR++Q E+D+ N+ LA              +  +EN ++L  N      +   E  +    R+ + ++ LQDQYR +Q +I +LEAR++  L D        S +E ++ +F+  +   +      D +G++NK+G +  +N  + G++H L ++    E +AK  RETI +L+ +             H     +  R   +R + E++DL+ Q+ LL  R+ S +K  +  + +L+ +   L  L+ + +E   S+Q SET   +LLESLA+++ + F   + TE AVK++V+++ + VK+ SA+   L++RV  L +QFE+Q+ET R+   +T+  +  + +L  +++++E EL+A ++ RD ++ +K++  +Y+R+LA+ L+MD    D   VG   L EG   R ++L  ++ G              +        +I +L+E++E+KDL ++LL K++ +   +   +    G   +   R+R ++LQ  LE+SQ  +++ R+ + R +    E +  K    +Q  EL  L  T+EKL++VRQ+QAK+IA LK++ E    +      Q      + +  R+ LEE RRRE +L +FR+AIA+M+G+D      P+ +I AR+++L+          FTP    L    PS FQ GYS+   G      +P
Sbjct:  104 LRQRQIELDAANDSLA--------------RQREENARLLALNADMARRLDACEVTRCSAERNGHAVQALQDQYRSAQERIRELEARVRAGLQD-------GSGLERRHADFVNRVIYQLGVGCAEDLDGLVNKVGELVKENVAMKGRIHGLTDRQSQLELDAKANRETIQRLLAEVSRNSSAAAAAGSHLLNGDQGARAEADRLRIERDDLQKQVQLLEMRVESGRKQLEATRADLQEREARLARLDFERREAAHSSQNSETQMHALLESLASMLSSAFCRVSPTEEAVKEKVRLMCREVKEHSASVAALEERVRTLTRQFEAQFETSRERDFKTRRVECDQIDLRERLRAMEGELAAADVIRDGLKADKEKFYKYMRRLAEALKMDRATAD---VGFDLLGEGLLARAEQLGRRVGGSGAVGGCGCCDGGGSGGGGGAGAKIRALREQLESKDLHMELLRKKVAQLEAAAGAAGTTGGSGLSSYERERAYKLQRHLEKSQEMLDDARQEIARLRGQLLECNGLKATAIEQDRELACLETTMEKLERVRQKQAKRIAALKAEAEARDRDGGDRRGQTDGMSHEIRALRRALEEARRRERQLLEFRAAIARMLGLDAASLSIPDLDIIARLERLIQAQGGGAYAAFTPAERPLGGMEPS-FQSGYSSGGAGAPVRGRSP 757          
BLAST of coiled-coil domain-containing protein 170 vs. TrEMBL
Match: A0A267ETI8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026782g1 PE=4 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 6.110e-61
Identity = 200/679 (29.46%), Postives = 359/679 (52.87%), Query Frame = 1
Query:  409 LRKKQYEIDSKNEQLAVLKKESELNRLEFEKVDKENQKILNSNKTYENTVQTYESLK---HRSEYTIKLLQDQYRESQCKIADLEARIKNHLNDRERIDHMKSNVETKYQEFLISISRLINFDNIADREGIINKLGSITDQNAFLNGKMHALEEKLQISESNAKEARETIVKLMNDFG--------GAGH---DREELREAKNRFQTEKNDLKAQIDLLNNRLGSLQKLYDEAKNELESKTNNLLSLEVKVKEQQFSAQASETVFQSLLESLAAIIGTPFAPCASTEAAVKDRVKVLVKTVKDQSAAAEILDQRVLMLQKQFESQYETGRQLLDRTKDSDNMKQELVNKIKSLEDELSAQEIFRDNIRCEKDRIIRYVRKLADLLQMDYLPGDNDTVGLLDLLEG---RCQELMIKLSGGSWKCPRCVSINNPNIDSQKQSKRIASLKEEIEAKDLQIQLLEKRMVEFGKSVHPSSCLMGDETN---RDRVHXXXXXXXXXXXXXXXXXXALVRSQSSDFEIH--KQIKHKQQEELEQLSETVEKLDKVRQRQAKKIAGLKSQIE----EKSQVLMQHGKRDMDYKQARQLLEEVRRREIKLNDFRSAIAQMIGVDVRCSPDPENEIKARIQKLMAMARNAVNTPFTPYY--LSQEMPSAFQQGYSNPSLGGYTNTNNP 2361
            LR++Q E+D+ N+ LA              +  +EN ++L  N      +   E  +    R+ + ++ LQDQYR +Q +I +LEAR++  L D        S +E ++ +F+  +   +      D +G++NK+G +  +N  + G++H L ++    E +AK  RETI +L+ +             H     +  R   +R + E++DL+ Q+ LL  R+ S +K  +  + +L+ +   L  L+ + +E   S+Q SET   +LLESLA+++ + F   + TE AVK++V+++ + VK+ SA+   L++RV  L +QFE+Q+ET R+   +T+  +  + +L  +++++E EL+A ++ RD ++ +K++  +Y+R+LA+ L+MD    D   VG   L EG   R ++L  ++ G              +        +I +L+E++E+KDL ++LL K++ +   +   +    G   +   R+R ++LQ  LE+SQ  +++ R+ + R +    E +  K    +Q  EL  L  T+EKL++VRQ+QAK+IA LK++ E    +      Q      + +  R+ LEE RRRE +L +FR+AIA+M+G+D      P+ +I AR+++L+          FTP    L    PS FQ GYS+   G      +P
Sbjct:  104 LRQRQIELDAANDSLA--------------RQREENARLLALNADMARRLDACEVTRCSAERNGHAVQALQDQYRSAQERIRELEARVRAGLQD-------GSGLERRHADFVNRVIYQLGVGCAEDLDGLVNKVGELVKENVAMKGRIHGLTDRQSQLELDAKANRETIQRLLAEVSRNSSAAAAAGSHLLNGDQGARAEADRLRIERDDLQKQVQLLEMRVESGRKQLEATRADLQEREARLARLDFERREAAHSSQNSETQMHALLESLASMLSSAFCRVSPTEEAVKEKVRLMCREVKEHSASVAALEERVRTLTRQFEAQFETSRERDFKTRRVECDQIDLRERLRAMEGELAAADVIRDGLKADKEKFYKYMRRLAEALKMDRATAD---VGFDLLGEGLLARAEQLGRRVGGSGAVGGCGCCDGGGSGGGGGAGAKIRALREQLESKDLHMELLRKKVAQLEAAAGAAGTTGGSGLSSYERERAYKLQRHLEKSQEMLDDARQEIARLRGQLLECNGLKATAIEQDRELACLETTMEKLERVRQKQAKRIAALKAEAEARDRDGGDRRGQTDGMSHEIRALRRALEEARRRERQLLEFRAAIARMLGLDAASLSIPDLDIIARLERLIQAQGGGAYAAFTPAERPLGGMEPS-FQSGYSSGGAGAPVRGRSP 757          
BLAST of coiled-coil domain-containing protein 170 vs. TrEMBL
Match: A0A267DPU9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026782g3 PE=4 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 6.169e-61
Identity = 199/679 (29.31%), Postives = 359/679 (52.87%), Query Frame = 1
Query:  409 LRKKQYEIDSKNEQLAVLKKESELNRLEFEKVDKENQKILNSNKTYENTVQTYESLK---HRSEYTIKLLQDQYRESQCKIADLEARIKNHLNDRERIDHMKSNVETKYQEFLISISRLINFDNIADREGIINKLGSITDQNAFLNGKMHALEEKLQISESNAKEARETIVKLMNDFG--------GAGH---DREELREAKNRFQTEKNDLKAQIDLLNNRLGSLQKLYDEAKNELESKTNNLLSLEVKVKEQQFSAQASETVFQSLLESLAAIIGTPFAPCASTEAAVKDRVKVLVKTVKDQSAAAEILDQRVLMLQKQFESQYETGRQLLDRTKDSDNMKQELVNKIKSLEDELSAQEIFRDNIRCEKDRIIRYVRKLADLLQMDYLPGDNDTVGLLDLLEG---RCQELMIKLSGGSWKCPRCVSINNPNIDSQKQSKRIASLKEEIEAKDLQIQLLEKRMVEFGKSVHPSSCLMGDETN---RDRVHXXXXXXXXXXXXXXXXXXALVRSQSSDFEIH--KQIKHKQQEELEQLSETVEKLDKVRQRQAKKIAGLKSQIE----EKSQVLMQHGKRDMDYKQARQLLEEVRRREIKLNDFRSAIAQMIGVDVRCSPDPENEIKARIQKLMAMARNAVNTPFTPYY--LSQEMPSAFQQGYSNPSLGGYTNTNNP 2361
            LR++Q E+D+ N+ LA              +  +EN ++L  N      +   E  +    R+ Y ++ LQDQYR +Q +I +LEAR++  L D        S +E ++ +F+  +   +      D +G++NK+G +  +N  + G++H L ++    E +AK  RETI +L+ +             H     +  R   +R + E++DL+ Q+ LL  R+ S +K  +  + +L+ +   L  L+ + +E   S++ SET   +LLESLA+++ + +   + TE AVK++V+++ + VK+ SA+   L++RV  L +QFE+Q+ET R+   +T+  +  + +L  +++++E EL+A ++ RD ++ +K++  +Y+R+LA+ L+MD    D   VG   L EG   R ++L  ++ G              +        +I +L+E++E+KDL ++LL K++ +   +   +    G   +   R+R ++LQ  LE+SQ  +++ R+ + R +    E +  K    +Q  EL  L  T+EKL++VRQ+QAK+IA LK++ E    +      Q      + +  R+ LEE RRRE +L +FR+AIA+M+G+D      P+ +I AR+++L+          FTP    L    PS FQ GYS+   G      +P
Sbjct:  104 LRQRQIELDAANDSLA--------------RQREENARLLALNADMARRLDACEVTRCSAERNGYAVQALQDQYRSAQERIRELEARVRAGLQD-------GSGLERRHADFVNRVIYQLGVGCAEDLDGLVNKVGELVKENVAMKGRIHGLTDRQSQLELDAKANRETIQRLLAEVSRNSSAAAAAGSHLLNGDQGARAEADRLRIERDDLQKQVQLLEMRVESGRKQLEATRADLQEREARLARLDCERREAAHSSRNSETQMHALLESLASMLSSAYCRVSPTEEAVKEKVRLMCREVKEHSASVAALEERVRTLTRQFEAQFETSRERDFKTRRVECDQIDLRERLRAMEGELAAADVIRDGLKADKEKFYKYMRRLAEALKMDRATAD---VGFDLLGEGLLARAEQLGRRVGGSGAVGGCGCCDGGGSGGGGGAGAKIRALREQLESKDLHMELLRKKVAQLEAAAGAAGTTGGSGLSSYERERAYKLQRHLEKSQEMLDDARQEIARLRGQLLECNGLKATAIEQDRELACLETTMEKLERVRQKQAKRIAALKAEAEARDRDGGDRRGQTDGMSHEIRALRRALEEARRRERQLLEFRAAIARMLGLDAASLSIPDLDIIARLERLVQAQGGGAYAAFTPAERPLGGMEPS-FQSGYSSGGAGATVRGRSP 757          
BLAST of coiled-coil domain-containing protein 170 vs. TrEMBL
Match: A0A1I8I2I0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 2.548e-60
Identity = 198/676 (29.29%), Postives = 355/676 (52.51%), Query Frame = 1
Query:  409 LRKKQYEIDSKNEQLAVLKKESELNRLEFEKVDKENQKILNSNKTYENTVQTYESLK---HRSEYTIKLLQDQYRESQCKIADLEARIKNHLNDRERIDHMKSNVETKYQEFLISISRLINFDNIADREGIINKLGSITDQNAFLNGKMHALEEKLQISESNAKEARETIVKLMNDFG--------GAGH---DREELREAKNRFQTEKNDLKAQIDLLNNRLGSLQKLYDEAKNELESKTNNLLSLEVKVKEQQFSAQASETVFQSLLESLAAIIGTPFAPCASTEAAVKDRVKVLVKTVKDQSAAAEILDQRVLMLQKQFESQYETGRQLLDRTKDSDNMKQELVNKIKSLEDELSAQEIFRDNIRCEKDRIIRYVRKLADLLQMDYLPGDNDTVGLLDLLEGRCQELMIKLSGGSWKCPRCVSINNPNIDSQKQSKRIASLKEEIEAKDLQIQLLEKRMVEFGKSVHPSSCLMGDETN---RDRVHXXXXXXXXXXXXXXXXXXALVRSQSSDFEIH--KQIKHKQQEELEQLSETVEKLDKVRQRQAKKIAGLKSQIE----EKSQVLMQHGKRDMDYKQARQLLEEVRRREIKLNDFRSAIAQMIGVDVRCSPDPENEIKARIQKLMAMARNAVNTPFTPYY--LSQEMPSAFQQGYSNPSLGGYTNTNNP 2361
            LR++Q E+D+ N+ LA              +  +EN ++L  N      +   E  +    R+ Y ++ LQDQYR +Q +I +LEAR++  L D        S +E ++ +F+  +   +      D +G++NK+G +  +N  + G++H L ++    E +AK  RETI +L+ +             H     +  R   +R + E++DL+ Q+ LL  R+ S +K  +  + +L+ +   L  L+ + +E   S++ SET   +LLESLA+++ + +   + TE AVK++V+++ + VK+ SA+   L++RV  L +QFE+Q+ET R+   +T+  +  + +L  +++++E EL+A ++ RD ++ +K++  +Y+R+LA+ L+MD    D   VG   L EG    L+ +     +   RC                  +L+E++E+KDL ++LL K++ +   +   +    G   +   R+R ++LQ  LE+SQ  +++ R+ + R +    E +  K    +Q  EL  L  T+EKL++VRQ+QAK+IA LK++ E    +      Q      + +  R+ LEE RRRE +L +FR+AIA+M+G+D      P+ +I AR+++L+          FTP    L    PS FQ GYS+   G      +P
Sbjct:   86 LRQRQIELDAANDSLA--------------RQREENARLLALNADMARRLDACEVTRCSAERNGYAVQALQDQYRSAQERIRELEARVRAGLQD-------GSGLERRHADFVNRVIYQLGVGCAEDLDGLVNKVGELVKENVAMKGRIHGLTDRQSQLELDAKANRETIQRLLAEVSRNSSAAAAAGSHLLNGDQGARAEADRLRIERDDLQKQVQLLEMRVESGRKQLEATRADLQEREARLARLDCERREAAHSSRNSETQMHALLESLASMLSSAYCRVSPTEEAVKEKVRLMCREVKEHSASVAALEERVRTLTRQFEAQFETSRERDFKTRRVECDQIDLRERLRAMEGELAAADVIRDGLKADKEKFYKYMRRLAEALKMDRATAD---VGFDLLGEG----LLAR-----YLFTRC-----------------RALREQLESKDLHMELLRKKVAQLEAAAGAAGTTGGSGLSSYERERAYKLQRHLEKSQEMLDDARQEIARLRGQLLECNGLKATAIEQDRELACLETTMEKLERVRQKQAKRIAALKAEAEARDRDGGDRRGQTDGMSHEIRALRRALEEARRRERQLLEFRAAIARMLGLDAASLSIPDLDIIARLERLVQAQGGGAYAAFTPAERPLGGMEPS-FQSGYSSGGAGATVRGRSP 710          
BLAST of coiled-coil domain-containing protein 170 vs. TrEMBL
Match: A0A267E0S7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026782g2 PE=4 SV=1)

HSP 1 Score: 231.106 bits (588), Expect = 3.036e-60
Identity = 198/679 (29.16%), Postives = 359/679 (52.87%), Query Frame = 1
Query:  409 LRKKQYEIDSKNEQLAVLKKESELNRLEFEKVDKENQKILNSNKTYENTVQTYESLK---HRSEYTIKLLQDQYRESQCKIADLEARIKNHLNDRERIDHMKSNVETKYQEFLISISRLINFDNIADREGIINKLGSITDQNAFLNGKMHALEEKLQISESNAKEARETIVKLMNDFG--------GAGH---DREELREAKNRFQTEKNDLKAQIDLLNNRLGSLQKLYDEAKNELESKTNNLLSLEVKVKEQQFSAQASETVFQSLLESLAAIIGTPFAPCASTEAAVKDRVKVLVKTVKDQSAAAEILDQRVLMLQKQFESQYETGRQLLDRTKDSDNMKQELVNKIKSLEDELSAQEIFRDNIRCEKDRIIRYVRKLADLLQMDYLPGDNDTVGLLDLLEG---RCQELMIKLSGGSWKCPRCVSINNPNIDSQKQSKRIASLKEEIEAKDLQIQLLEKRMVEFGKSVHPSSCLMGDETN---RDRVHXXXXXXXXXXXXXXXXXXALVRSQSSDFEIH--KQIKHKQQEELEQLSETVEKLDKVRQRQAKKIAGLKSQIE----EKSQVLMQHGKRDMDYKQARQLLEEVRRREIKLNDFRSAIAQMIGVDVRCSPDPENEIKARIQKLMAMARNAVNTPFTPYY--LSQEMPSAFQQGYSNPSLGGYTNTNNP 2361
            LR++Q E+D+ N+ LA              +  +EN ++L  N      +   E  +    R+ + ++ LQDQYR +Q +I +LEAR++  L D        S +E ++ +F+  +   +      D +G++NK+G +  +N  + G++H L ++    E +AK  RETI +L+ +             H     +  R   +R + E++DL+ Q+ LL  R+ S +K  +  + +L+ +   L  L+ + +E   S+Q SET   +LLESLA+++ + +   + TE AVK++V+++ + VK+ SA+   L++RV  L +QFE+Q+ET R+   +T+  +  + +L  +++++E EL+A ++ RD ++ +K++  +Y+R+LA+ L+MD    D   VG   L EG   R ++L  ++ G              +        +I +L+E++E+KDL ++LL K++ +   +   +    G   +   R+R ++LQ  LE+SQ  +++ R+ + R +    E +  +    +Q  EL  L  T+EKL++VRQ+QAK+IA LK++ E    +      Q      + +  R+ LEE RRRE +L +FR+AIA+M+G+D      P+ +I AR+++L+          FTP    L    PS FQ GYS+   G      +P
Sbjct:  104 LRQRQIELDAANDSLA--------------RQREENARLLALNADMARRLDACEVTRCSAERNGHAVQALQDQYRSAQERIRELEARVRAGLQD-------GSGLERRHADFVNRVIYQLGVGCAEDLDGLVNKVGELVKENVAMKGRIHGLTDRQSQLELDAKANRETIQRLLAEVSRNSSAAAAAGSHLLNGDQGARAEADRLRIERDDLQKQVQLLEMRVESGRKQLEATRADLQEREARLARLDCERREAAHSSQNSETQMHALLESLASMLSSAYCRVSPTEEAVKEKVRLMCREVKEHSASVAALEERVRTLTRQFEAQFETSRERDFKTRRVECDQIDLRERLRAMEGELAAADVIRDGLKADKEKFYKYMRRLAEALKMDRATAD---VGFDLLGEGLLARAEQLGRRVGGSGAVGGCGCCDGGGSGGGGGAGAKIRALREQLESKDLHMELLRKKVAQLEAAAGAAGTTGGSGLSSYERERAYKLQRHLEKSQEMLDDARQEIARLRGQLLECNGLRATAIEQDRELACLETTMEKLERVRQKQAKRIAALKAEAEARDRDGGDRRGQTDGMSHEIRALRRALEEARRRERQLLEFRAAIARMLGLDAASLSIPDLDIIARLERLVQAQGGGAYAAFTPAERPLGGMEPS-FQSGYSSGGAGAPVRGRSP 757          
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006087.1 (pep scaffold:Pmarinus_7.0:GL479553:21345:31721:-1 gene:ENSPMAG00000005504.1 transcript:ENSPMAT00000006087.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 3.429e-9
Identity = 33/120 (27.50%), Postives = 71/120 (59.17%), Query Frame = 1
Query: 1936 QQEELEQLSETVEKLDKVRQRQAKKIAGLKSQIE----------EKSQVLMQHGKRDMDYKQARQLLEEVRRREIKLNDFRSAIAQMIGVDVRCSPDPENEIKARIQKLMAMARNAVNTP 2265
            Q + + ++  ++++L+KV+ + A+K+A L+ Q++          E+++VL++    ++  +  ++ LEEV RRE +L DFR  + + +G+DV     P+ E+ AR+++L+     +V T 
Sbjct:  146 QNKTIAEMGRSIDRLEKVKDKAARKVASLRGQLDMTAEGAQEEMERTRVLLEATTGEL--RTVKRALEEVARREKQLLDFREVVGRTLGLDVGSLAVPDYEVVARLERLVRAQHASVATA 263          
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Nematostella
Match: EDO48576 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIV6])

HSP 1 Score: 62.3882 bits (150), Expect = 4.395e-10
Identity = 84/349 (24.07%), Postives = 173/349 (49.57%), Query Frame = 1
Query: 1333 ESQYETGRQLLDRTKDSDNMKQELVNKIKSLEDELSAQEIFRDNIRCEKDRIIRYVRKLADLLQMDYLPGDN--DTVGLLDLLEGRCQELMIKLSGGSWKCPRCVSINNPNIDSQKQSKRIASLKEEIEAKDLQIQLLEKRMVEFGKSVHPSSCLMGDETNRD----RVHXXXXXXXXXXXXXXXXXXALVRSQSSDFEIH--KQIKHKQQEELEQLSETVEKLDKVRQRQAKKIAGLKSQI--------EEKSQVLMQHGKRDMDYKQARQLLEEVRRREIKLNDFRSAIAQMIGVDVRCSPDPENEIKARIQKLM-AMARNAVNTPFTPYYLSQEMPSAFQQGYSNP 2328
            +SQ    R  L R   ++   +E   ++  LE EL + ++ RD ++ +K + + +  K+A  +++D +  D   D  G  + L  R ++L +KL   +    R  +I N         +R+   K++IE+KDL   LL+K++    + +H    +   E  RD    +  +L    E+ Q E+ + ++ +   ++   EI   K    +Q + +E L + + KL + +Q+  +++ G+KS++        E +S+  M   +   + +  +  LEE R RE +L +FR  +A+++G+DV     P+ +I +R+++L+ A   +++ T      L Q++ + F+ GY + 
Sbjct:  159 DSQRNLHRTTLKRATQAEEQLKEAQERVTGLEGELLSSDVERDGLKEDKRKFVAFCEKMARTMKLDEIADDVGFDVNG--EALVARAEQL-VKLETDALD-DRKTTIYNLQ-------RRLKWAKQQIESKDLHQGLLKKKVTSLEELLHDKGRV---EVERDENSIKYRKLVKHNEKLQRELLDYKQEVTNLKAKLMEISELKVTTIEQCKTIEGLEQALNKLARSKQKTKEQLDGIKSELGVAESEARETRSKASMTQQQLRSELETTKLALEESRIREKQLLNFRQVLARLLGLDVNNLSVPDYDIISRLERLVQAHHAHSITTHSLEGSL-QDLENGFRSGYDDA 492          
BLAST of coiled-coil domain-containing protein 170 vs. Planmine SMEST
Match: SMESG000051384.1 (SMESG000051384.1)

HSP 1 Score: 1414.82 bits (3661), Expect = 0.000e+0
Identity = 710/716 (99.16%), Postives = 713/716 (99.58%), Query Frame = 1
Query:  409 LRKKQYEIDSKNEQLAVLKKESELNRLEFEKVDKENQKILNSNKTYENTVQTYESLKHRSEYTIKLLQDQYRESQCKIADLEARIKNHLNDRERIDHMKSNVETKYQEFLISISRLINFDNIADREGIINKLGSITDQNAFLNGKMHALEEKLQISESNAKEARETIVKLMNDFGGAGHDREELREAKNRFQTEKNDLKAQIDLLNNRLGSLQKLYDEAKNELESKTNNLLSLEVKVKEQQFSAQASETVFQSLLESLAAIIGTPFAPCASTEAAVKDRVKVLVKTVKDQSAAAEILDQRVLMLQKQFESQYETGRQLLDRTKDSDNMKQELVNKIKSLEDELSAQEIFRDNIRCEKDRIIRYVRKLADLLQMDYLPGDNDTVGLLDLLEGRCQELMIKLSGGSWKCPRCVSINNPNIDSQKQSKRIASLKEEIEAKDLQIQLLEKRMVEFGKSVHPSSCLMGDETNRDRVHXXXXXXXXXXXXXXXXXXALVRSQSSDFEIHKQIKHKQQEELEQLSETVEKLDKVRQRQAKKIAGLKSQIEEKSQVLMQHGKRDMDYKQARQLLEEVRRREIKLNDFRSAIAQMIGVDVRCSPDPENEIKARIQKLMAMARNAVNTPFTPYYLSQEMPSAFQQGYSNPSLGGYTNTNNPINQMVPFSKPPNTGNPNLTNDTNGQFFGRRTQVPKNKIVFQSTDDKIRPNRARSTSPSKVDERKY 2556
            LRKKQYEIDSKNEQLAVLKKESELNRLEFEKVDKENQKILNSNKTYENTVQTYESLKHRSEYTIKLLQDQYRESQCKIADLEARIKNHLNDRERIDHMKSNVETKYQEFLISISRLINFDNIADREGIINKLGSITDQNAFLNGKMHALEEKLQISESNAKEARETIVKLMNDFGGAGHDREELREAKNRFQTEKNDLKAQIDLLNNRLGSLQKLYDEAKNELESKTNNLLSLEVKVKEQQFSAQASETVFQSLLESLAAIIGTPFAPCASTEAAVKDRVK LVKTVKDQSAAAEILDQRVLMLQKQFESQYETG+QLLDRTKDSDNMKQ+LVNKIKSLEDELSAQEIFRDNIRCEKDRIIRYVRKLADLLQMDYLPGDNDTVGLLDLLEGRCQELMIKLSGGSWKCPRCVSINNPN DSQKQSKRIASLKEEIEAKDLQIQLLEKRMVEFGKSVHPSSCLMGDETNRDRVHRLQHQLEESQLEIEELRRALVRSQSSDFEIHKQIK+KQQEELEQLSETVEKLDKVRQRQAKKIAGLKSQIEEKSQVLMQHGKRDMDYKQARQLLEEVRRREIKLNDFRSAIAQMIGVDVRCSPDPENEIKARIQKLMAMARNAVNTPFTPYYLSQEMPSAFQQGYSNPSLGGYTNTNN INQMVPFSKPPNTGNPNLTNDTNGQFFGRRTQVPKNKIVFQSTDDKIRPNRARSTSPSKVDERKY
Sbjct:   75 LRKKQYEIDSKNEQLAVLKKESELNRLEFEKVDKENQKILNSNKTYENTVQTYESLKHRSEYTIKLLQDQYRESQCKIADLEARIKNHLNDRERIDHMKSNVETKYQEFLISISRLINFDNIADREGIINKLGSITDQNAFLNGKMHALEEKLQISESNAKEARETIVKLMNDFGGAGHDREELREAKNRFQTEKNDLKAQIDLLNNRLGSLQKLYDEAKNELESKTNNLLSLEVKVKEQQFSAQASETVFQSLLESLAAIIGTPFAPCASTEAAVKDRVKQLVKTVKDQSAAAEILDQRVLMLQKQFESQYETGKQLLDRTKDSDNMKQDLVNKIKSLEDELSAQEIFRDNIRCEKDRIIRYVRKLADLLQMDYLPGDNDTVGLLDLLEGRCQELMIKLSGGSWKCPRCVSINNPNTDSQKQSKRIASLKEEIEAKDLQIQLLEKRMVEFGKSVHPSSCLMGDETNRDRVHRLQHQLEESQLEIEELRRALVRSQSSDFEIHKQIKYKQQEELEQLSETVEKLDKVRQRQAKKIAGLKSQIEEKSQVLMQHGKRDMDYKQARQLLEEVRRREIKLNDFRSAIAQMIGVDVRCSPDPENEIKARIQKLMAMARNAVNTPFTPYYLSQEMPSAFQQGYSNPSLGGYTNTNNSINQMVPFSKPPNTGNPNLTNDTNGQFFGRRTQVPKNKIVFQSTDDKIRPNRARSTSPSKVDERKY 790          
BLAST of coiled-coil domain-containing protein 170 vs. Planmine SMEST
Match: SMESG000048767.1 (SMESG000048767.1)

HSP 1 Score: 131.724 bits (330), Expect = 3.446e-31
Identity = 133/594 (22.39%), Postives = 287/594 (48.32%), Query Frame = 1
Query:  583 RSEYTIKLLQDQYRESQCKIADLEARIKNHLNDRERIDHMKSNVETKYQEFLISISRLINFDNIADREGIINKLGSITDQNAFLNGKMHALEEKLQISESNAKEARETIVKLMNDFGGAGHDREE-LREAKN------RFQTEKNDLKAQIDLLNNRLGSLQKLYDEAKNELESKTNNLLSLEVKVKEQQFSAQASETVFQSLLESLAAIIGTPFAPCASTEAAVKDRVKVLVKTVKDQSAAAEILDQRVLMLQKQFESQYETGRQLLDRTKDSDNMKQELVNKIKSLEDELSAQEIFRDNIRCEKDRIIRYVRKLADLLQMDYLPGDNDTVGLLDLLEGRCQELMIKLSGGSWKCPRCVSINNPNIDSQKQ----SKRIASLKEEIEAKDLQIQLLEKRMV----EFGKSVHPSSCLMGDETNRDRVHXXXXXXXXXXXXXXXXXXALVRS--QSSDFEIHKQIKHKQQEELEQLSETVEKLDKVRQRQAKKIAGLKSQIE------EKSQVLMQHGKRDM--DYKQARQLLEEVRRREIKLNDFRSAIAQMIGVDVRCSPDPENEIKARIQKLMAMARNAVN--TPFTPYYL 2283
            RSE  I  LQ +  +S  K+  LE  +KN   +    +  + ++      F   ++  +N ++ ++   +  K+  +T +N  L G++  ++   +  E    E+RE+  ++M +      D EE +R  KN      + Q EK  ++     L  RL  +  +  E +  L+ K   L  + ++ +E   +       F++  ES+A ++ T  + C S+E ++K+R+++L+   K++      LD ++  + +Q+E  YE  ++   + +  +    +L ++I+ LE ELS++++ RD++R +K++   ++R+LA +++MD    +++   + D +  R + ++              + N  NID+ +      +RI  LK+++ ++DL ++L+ K+M     +   ++  +    G     D +     +++    ++ +  +AL     + SD +I       Q +E+E L   ++KL++VRQ+QA+KIA L   +E        ++ +  +  + +  + +  R  LE  +R E +L DFR  + +++G+ V     P  +I  R++KL+++  + V    P   Y L
Sbjct:  128 RSELAISSLQKELTDSLDKVVKLEDELKNLTLNNSTTEKSRESLAAVISNFYQELNTYLNLESDSEPGVVFQKIKDLTSENNMLKGEISNIKATAEDREKKYLESRESFRQMMQNVDKDKGDLEEYIRMKKNLTFEIEKLQVEKKAVEIHNSELTKRLADIDGILKETQRILDEKEAQLSKVFLEKRESNQNMSFVNREFETFRESIAGLLSTSLSRCMSSEESIKERLRILINEAKEKDNKILQLDMKLKNVSEQYERNYEINKETGLKARRVELEYLDLKDRIRQLEKELSSRDVTRDSLRADKEKFYHFLRRLAAVMKMDPYTQEHEFSLIFDGILDRAKAMI-------------QNENERNIDTSQTISSLKRRIRDLKDQLHSRDLHLELMRKKMANQEDQIRGALDENDFRKGLVDTEDNLKEKLSKMQRKVDQLRDENKALKAELFECSDVKISVA---SQTKEMETLQHNLQKLERVRQKQAEKIADLTKSLEIYDSEANHTKFVSDNAVQSLASELRTLRNALERAKRSEKELLDFRCVVGRILGLCVDDLAIPNYDIIRRLEKLVSIPHSGVTVAVPVQHYPL 705          
BLAST of coiled-coil domain-containing protein 170 vs. Planmine SMEST
Match: SMESG000074429.1 (SMESG000074429.1)

HSP 1 Score: 63.929 bits (154), Expect = 5.043e-10
Identity = 132/617 (21.39%), Postives = 280/617 (45.38%), Query Frame = 1
Query:  559 QTYESLKHRSEYTIKLLQDQYRESQCKIADLEARIKNHLNDRERIDHMKSNVETKYQEFLISISRLINFDNIADREGIINKLGSITDQNAFLNGKMHALEEKLQISESNAKEARETIVKLMNDFGG-----AGHDRE--ELREAKNRFQTEKNDLKAQIDLLNNRLGSLQKLYD--EAKNELESKTNNLLSLEVKVKEQQFSAQASETVF-QSLLESLAAIIGTP----------FAPCASTEAAVKDRVKVLVKTVKDQSAAAEILDQRVLMLQKQFESQYETGRQLLDRTKDSDNMKQELVNKIKSLEDELSAQEIFRDNIRCEKDRIIRYVRKLADLLQMDYLPGDNDTVGLLDLLEGRCQELMIKLSGGSWKCPRCVSINNPNIDSQKQSKRIASLKEEIEAKDLQIQLLEKRMVEFGKSVHPSSCLMGDETNRDRV-HXXXXXXXXXXXXXXXXXXALVRSQSSDFEIHKQIKHKQ---QEELEQLSETVEKLDKVRQRQAKKIAGLK----------SQIEEKSQVLMQHGKRDMDYKQARQLLEEVRRREIKLNDFRSAIAQMIGVDVRCSPDPENEIKARIQKLMAMARNAVNTPFTPYYLSQEMPSAF 2307
            + +E+++ R+   I  LQD+  E+Q  + + +   K   +    I   +  ++ + Q+  +SI+   + + I +   +INK+ ++  +N     K+ +LEEKL+  +   + +R+TI +L+          A +D +   L    ++++  K  ++  I+    +L SL+K  +     NE++SK    +S   K  +Q    QA    F  SL+  L+    TP             C  +    K  VK L +T+   S  ++I+D  +  L  +  S+ +   +L           ++L  ++K+ E +L +  +  D + C+K +  R + +LA ++ M+ +  D     + + L  R  +L  KL        R        +     ++++  LKE++ +KDL I LL K++    +    S  L+G E +++ + ++   +  +   E  E  RA V         + ++K       +E++ L+  V KL+ +RQ+Q+K ++  K          ++I+E +   +     + + +  +  L + +R+E ++ + R+ IA+++G+D+     P+ EI  R+++L+    + + T ++     QEM   F
Sbjct:  164 EAFETMRQRNNILISSLQDELTETQQGLVENKVYAKELEDQISDISAARDELQRQIQDIKLSITEATS-EEIYNVSEVINKVKTLIFENDSSKNKILSLEEKLKSRDCEQQASRQTITRLVAKLSAEETKNANNDEKIANLTREVDQYKVSKTIIETDINSYECQLTSLRKEIELLTQDNEIKSKRIQEISATAKTNQQTDEQQALINHFINSLISILSENYKTPKNDSLTIFEWIIGCVKSLLQNKGDVKNLNETI--NSLRSDIID--IEKLNSRISSEEDPQLRL---------TVEDLNKRLKNAETDLLSSSLIIDGLNCDKTKYFRILSELARVMNMNEINKDIGFDMISEALYARATQLQ-KLEYDVKTDHR--------LTEHSLNRKVKELKEKVHSKDLHIDLLHKKLAS-TEGRQQSVELIGKERDKELLSNKKLAKHNQKLQEEVENLRAEVIELKGSLINYNKLKVNALSLDQEVKSLTAKVNKLESIRQKQSKLLSESKSSQINKEQELNEIKETADAAI--ASLNTELRVVKDSLNDCKRKENQMIEMRTVIAKLLGLDLDNLAIPDFEIINRLERLITAHHSNIYTQYSMEKTLQEMNQGF 754          
BLAST of coiled-coil domain-containing protein 170 vs. Planmine SMEST
Match: SMESG000074429.1 (SMESG000074429.1)

HSP 1 Score: 63.1586 bits (152), Expect = 6.901e-10
Identity = 132/617 (21.39%), Postives = 280/617 (45.38%), Query Frame = 1
Query:  559 QTYESLKHRSEYTIKLLQDQYRESQCKIADLEARIKNHLNDRERIDHMKSNVETKYQEFLISISRLINFDNIADREGIINKLGSITDQNAFLNGKMHALEEKLQISESNAKEARETIVKLMNDFGG-----AGHDRE--ELREAKNRFQTEKNDLKAQIDLLNNRLGSLQKLYD--EAKNELESKTNNLLSLEVKVKEQQFSAQASETVF-QSLLESLAAIIGTP----------FAPCASTEAAVKDRVKVLVKTVKDQSAAAEILDQRVLMLQKQFESQYETGRQLLDRTKDSDNMKQELVNKIKSLEDELSAQEIFRDNIRCEKDRIIRYVRKLADLLQMDYLPGDNDTVGLLDLLEGRCQELMIKLSGGSWKCPRCVSINNPNIDSQKQSKRIASLKEEIEAKDLQIQLLEKRMVEFGKSVHPSSCLMGDETNRDRV-HXXXXXXXXXXXXXXXXXXALVRSQSSDFEIHKQIKHKQ---QEELEQLSETVEKLDKVRQRQAKKIAGLK----------SQIEEKSQVLMQHGKRDMDYKQARQLLEEVRRREIKLNDFRSAIAQMIGVDVRCSPDPENEIKARIQKLMAMARNAVNTPFTPYYLSQEMPSAF 2307
            + +E+++ R+   I  LQD+  E+Q  + + +   K   +    I   +  ++ + Q+  +SI+   + + I +   +INK+ ++  +N     K+ +LEEKL+  +   + +R+TI +L+          A +D +   L    ++++  K  ++  I+    +L SL+K  +     NE++SK    +S   K  +Q    QA    F  SL+  L+    TP             C  +    K  VK L +T+   S  ++I+D  +  L  +  S+ +   +L           ++L  ++K+ E +L +  +  D + C+K +  R + +LA ++ M+ +  D     + + L  R  +L  KL        R        +     ++++  LKE++ +KDL I LL K++    +    S  L+G E +++ + ++   +  +   E  E  RA V         + ++K       +E++ L+  V KL+ +RQ+Q+K ++  K          ++I+E +   +     + + +  +  L + +R+E ++ + R+ IA+++G+D+     P+ EI  R+++L+    + + T ++     QEM   F
Sbjct:  160 EAFETMRQRNNILISSLQDELTETQQGLVENKVYAKELEDQISDISAARDELQRQIQDIKLSITEATS-EEIYNVSEVINKVKTLIFENDSSKNKILSLEEKLKSRDCEQQASRQTITRLVAKLSAEETKNANNDEKIANLTREVDQYKVSKTIIETDINSYECQLTSLRKEIELLTQDNEIKSKRIQEISATAKTNQQTDEQQALINHFINSLISILSENYKTPKNDSLTIFEWIIGCVKSLLQNKGDVKNLNETI--NSLRSDIID--IEKLNSRISSEEDPQLRL---------TVEDLNKRLKNAETDLLSSSLIIDGLNCDKTKYFRILSELARVMNMNEINKDIGFDMISEALYARATQLQ-KLEYDVKTDHR--------LTEHSLNRKVKELKEKVHSKDLHIDLLHKKLAS-TEGRQQSVELIGKERDKELLSNKKLAKHNQKLQEEVENLRAEVIELKGSLINYNKLKVNALSLDQEVKSLTAKVNKLESIRQKQSKLLSESKSSQINKEQELNEIKETADAAI--ASLNTELRVVKDSLNDCKRKENQMIEMRTVIAKLLGLDLDNLAIPDFEIINRLERLITAHHSNIYTQYSMEKTLQEMNQGF 750          
BLAST of coiled-coil domain-containing protein 170 vs. Planmine SMEST
Match: SMESG000074429.1 (SMESG000074429.1)

HSP 1 Score: 60.8474 bits (146), Expect = 3.976e-9
Identity = 130/625 (20.80%), Postives = 285/625 (45.60%), Query Frame = 1
Query:  559 QTYESLKHRSEYTIKLLQDQYRESQCKIADLEARIKNHLNDRERIDHMKSNVETKYQEFLISISRLINFDNIADREGIINKLGSITDQNAFLNGKMHALEEKLQISESNAKEARETIVKLMNDFGG-----AGHDRE--ELREAKNRFQTEKNDLKAQIDLLNNRLGSLQKLYD--EAKNELESKTNNLLSLEVKVKEQQFSAQASETVF-QSLLESLAAIIGTPFAPCASTEAAVKDRVKVLVKTVKD-QSAAAEILDQRVLMLQKQFESQYETGRQLLDRTKDSDNMKQELVNK-IKSLEDELSAQEIFRDNIRCEKDRIIRYVRKLADLLQMDYLPGDNDTVGLLDLLEGRCQELMIKLSGGSWKCPRCVSINNPNIDSQKQSKRIASLKEEIEAKDLQIQLLEKRMVEFGKSVHPSSCLMGDETNRDRV-HXXXXXXXXXXXXXXXXXXALVRSQSSDFEIHKQIKHKQ---QEELEQLSETVEKLDKVRQRQAKKIAGLK----------SQIEEKSQVLMQHGKRDMDYKQARQLLEEVRRREIKLNDFRSAIAQMIGVDVRCSPDPENEIKARIQKLMAMARNAVNTPFTPYYLSQEMPSAFQQGYSNPSLGGYTNTN 2355
            + +E+++ R+   I  LQD+  E+Q  + + +   K   +    I   +  ++ + Q+  +SI+   + + I +   +INK+ ++  +N     K+ +LEEKL+  +   + +R+TI +L+          A +D +   L    ++++  K  ++  I+    +L SL+K  +     NE++SK    +S   K  +Q    QA    F  SL+  L+    TP     +    +   VK L++   D ++  +  L++ +  L+       +   ++         +  E +NK +K+ E +L +  +  D + C+K +  R + +LA ++ M+ +  D     + + L  R  +L  KL        R        +     ++++  LKE++ +KDL I LL K++    +    S  L+G E +++ + ++   +  +   E  E  RA V         + ++K       +E++ L+  V KL+ +RQ+Q+K ++  K          ++I+E +   +     + + +  +  L + +R+E ++ + R+ IA+++G+D+     P+ EI  R+++L+    + + T ++     QEM   F   + +P +    +T+
Sbjct:  160 EAFETMRQRNNILISSLQDELTETQQGLVENKVYAKELEDQISDISAARDELQRQIQDIKLSITEATS-EEIYNVSEVINKVKTLIFENDSSKNKILSLEEKLKSRDCEQQASRQTITRLVAKLSAEETKNANNDEKIANLTREVDQYKVSKTIIETDINSYECQLTSLRKEIELLTQDNEIKSKRIQEISATAKTNQQTDEQQALINHFINSLISILSENYKTPKNDSLTIFEWIIGCVKSLLQNKGDVKNTPSSPLNETINSLRSDIIDIEKLNSRISSEEDPQLRLTVEDLNKRLKNAETDLLSSSLIIDGLNCDKTKYFRILSELARVMNMNEINKDIGFDMISEALYARATQLQ-KLEYDVKTDHR--------LTEHSLNRKVKELKEKVHSKDLHIDLLHKKLAS-TEGRQQSVELIGKERDKELLSNKKLAKHNQKLQEEVENLRAEVIELKGSLINYNKLKVNALSLDQEVKSLTAKVNKLESIRQKQSKLLSESKSSQINKEQELNEIKETADAAI--ASLNTELRVVKDSLNDCKRKENQMIEMRTVIAKLLGLDLDNLAIPDFEIINRLERLITAHHSNIYTQYSMEKTLQEMNQGF---FHDPCVVHTHHTH 768          
The following BLAST results are available for this feature:
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CCDC1706.525e-2222.01coiled-coil domain containing 170 [Source:HGNC Sym... [more]
back to top
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ccdc1704.059e-921.70coiled-coil domain containing 170 [Source:ZFIN;Acc... [more]
back to top
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
c1qtnf44.123e-2823.06C1q and TNF related 4 [Source:Xenbase;Acc:XB-GENE-... [more]
ENSXETT00000000426.12.352e-2323.06coiled-coil domain-containing protein 170-like [So... [more]
back to top
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Ccdc1709.437e-2722.35coiled-coil domain containing 170 [Source:MGI Symb... [more]
Ccdc1702.068e-2622.35coiled-coil domain containing 170 [Source:MGI Symb... [more]
back to top
BLAST of coiled-coil domain-containing protein 170 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q8IYT3|CC170_HUMAN3.133e-2122.01Coiled-coil domain-containing protein 170 OS=Homo ... [more]
back to top
BLAST of coiled-coil domain-containing protein 170 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8I2T82.820e-6129.46Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267ETI86.110e-6129.46Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DPU96.169e-6129.31Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8I2I02.548e-6029.29Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267E0S73.036e-6029.16Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000006087.13.429e-927.50pep scaffold:Pmarinus_7.0:GL479553:21345:31721:-1 ... [more]
back to top
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO485764.395e-1024.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of coiled-coil domain-containing protein 170 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051384.10.000e+099.16SMESG000051384.1[more]
SMESG000048767.13.446e-3122.39SMESG000048767.1[more]
SMESG000074429.15.043e-1021.39SMESG000074429.1[more]
SMESG000074429.16.901e-1021.39SMESG000074429.1[more]
SMESG000074429.13.976e-920.80SMESG000074429.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011111 ID=SMED30011111|Name=coiled-coil domain-containing protein 170|organism=Schmidtea mediterranea sexual|type=transcript|length=2704bp
TGAATGAATAAATGTTTTATTTTGGTCGCTCTGTAAAGTATTTTGCTTAC
ATAGTTTGCAGAAATTACTGATGACATAAGACGAAAAAAGCAGTAAAATG
TCAATCTTTATTTTACATAACCTCTCTTATTCTCGATTTTTCATGTTATC
GTCGTTTATATCTTTCATTGGAAATAATTTGTGTCCATGTGACAATGTTA
ACATTCCGAATAAGATTTAGACAGTATCAAATGTTTCCATTTCTCAAAGT
TCTGAATGGCCGTTCCTAAGCCATTAGATTTACAATTTAACCCCATTGAA
TTTTAATTAATCTGAATTATTTTTATTTGGTTTCTACGTTTGAAATTGAC
TGAAATTCCCATTGCAAAACATTAACAATTCAAGGGCTTCTAACCCTAGT
CTGTTTAGCTTCGGAAAAAGCAATATGAGATTGATTCCAAAAATGAACAG
TTGGCCGTCTTGAAAAAAGAATCAGAATTAAATCGACTTGAATTTGAAAA
AGTTGACAAAGAAAATCAAAAAATATTGAATTCAAATAAAACATACGAAA
ATACTGTTCAAACTTACGAATCACTCAAGCATAGAAGTGAATATACAATA
AAGCTTCTACAAGATCAATATCGTGAATCTCAATGTAAAATTGCGGATTT
AGAAGCAAGGATAAAGAATCATTTAAATGATCGTGAAAGAATCGATCACA
TGAAGTCCAATGTGGAAACTAAATATCAGGAATTCCTGATCAGTATTTCT
CGATTAATAAATTTTGATAACATCGCTGATAGGGAAGGAATTATAAATAA
ACTTGGTTCAATAACTGACCAAAATGCGTTTCTTAATGGAAAAATGCATG
CATTAGAAGAAAAACTGCAGATATCTGAAAGTAATGCCAAGGAAGCTCGA
GAAACTATAGTAAAATTAATGAATGATTTCGGAGGAGCTGGGCATGACAG
AGAAGAATTGAGAGAAGCAAAAAATCGCTTTCAAACCGAAAAAAACGATT
TGAAAGCTCAAATTGATCTCCTGAATAACAGATTGGGTTCCCTTCAGAAA
TTGTACGACGAAGCAAAAAATGAACTCGAATCAAAAACCAATAATCTGCT
TTCATTGGAAGTAAAAGTGAAAGAGCAGCAATTTTCCGCCCAAGCTTCAG
AAACCGTTTTCCAATCATTGCTGGAATCTCTGGCTGCAATAATAGGAACA
CCCTTTGCTCCATGTGCTTCCACGGAGGCAGCTGTTAAAGACAGAGTAAA
AGTACTTGTAAAAACAGTAAAAGATCAATCGGCAGCGGCAGAGATTCTCG
ATCAGCGGGTACTAATGCTCCAGAAACAATTCGAGTCTCAATATGAAACC
GGTAGACAACTTTTGGACAGAACAAAGGATTCCGATAATATGAAACAGGA
GCTGGTTAATAAAATAAAATCGCTGGAAGATGAATTGTCTGCTCAGGAAA
TTTTCCGGGATAACATCCGATGTGAAAAAGACCGAATAATTCGTTACGTC
AGAAAGTTAGCTGATTTGCTTCAGATGGATTATCTTCCAGGAGATAATGA
TACGGTTGGATTACTGGACCTTTTAGAGGGACGATGTCAAGAGTTAATGA
TAAAGTTGTCTGGAGGATCTTGGAAATGTCCAAGATGCGTTTCTATCAAT
AATCCAAATATTGATTCACAAAAGCAGTCTAAACGAATCGCTTCTCTTAA
AGAGGAAATAGAAGCTAAAGATTTGCAAATACAATTATTAGAGAAACGAA
TGGTGGAATTTGGTAAATCTGTGCACCCTTCATCGTGTTTGATGGGCGAT
GAAACTAATCGAGATCGAGTCCATAGATTGCAGCACCAATTGGAAGAGTC
TCAATTAGAAATCGAAGAACTACGCAGAGCTCTTGTTAGGAGTCAATCAT
CCGATTTCGAAATCCATAAACAAATCAAACATAAGCAGCAAGAGGAATTG
GAACAATTGTCAGAAACTGTAGAAAAGCTTGATAAAGTCCGCCAACGACA
AGCCAAAAAGATTGCCGGCTTGAAATCACAGATTGAAGAAAAAAGCCAAG
TTCTAATGCAGCATGGAAAGCGGGATATGGATTACAAGCAAGCGAGACAA
TTATTGGAAGAGGTCAGGCGGCGGGAAATAAAATTGAATGATTTCCGCTC
GGCAATTGCTCAAATGATTGGAGTGGACGTCCGATGTTCCCCTGATCCGG
AAAATGAAATCAAAGCCCGAATACAAAAACTAATGGCTATGGCTCGGAAC
GCAGTTAATACGCCATTCACTCCGTATTATCTTTCACAGGAAATGCCATC
AGCTTTTCAGCAAGGATATTCGAATCCGTCACTAGGGGGATATACAAATA
CCAATAACCCCATCAATCAGATGGTCCCATTCTCAAAACCTCCAAACACT
GGAAATCCAAATTTAACCAATGATACCAACGGTCAATTTTTTGGCAGAAG
AACGCAAGTTCCCAAAAACAAAATCGTATTCCAGAGCACAGATGACAAAA
TTAGGCCCAATCGCGCACGTTCTACCTCACCTTCAAAGGTTGATGAAAGG
AAATATTGACAAACAATTTTTGTTAATTAATCTGTGATATTATTCGTCTT
TAATTCTTTATTTTTCTCCTTTATATCGTTTTTATAATTATATCGAGCAT
TTCAGATTTTTGCCTTGTTTATTTGTTGGATTCAAATATGTCACTACTTA
CCCC
back to top

protein sequence of SMED30011111-orf-1

>SMED30011111-orf-1 ID=SMED30011111-orf-1|Name=SMED30011111-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=620bp
MKSNVETKYQEFLISISRLINFDNIADREGIINKLGSITDQNAFLNGKMH
ALEEKLQISESNAKEARETIVKLMNDFGGAGHDREELREAKNRFQTEKND
LKAQIDLLNNRLGSLQKLYDEAKNELESKTNNLLSLEVKVKEQQFSAQAS
ETVFQSLLESLAAIIGTPFAPCASTEAAVKDRVKVLVKTVKDQSAAAEIL
DQRVLMLQKQFESQYETGRQLLDRTKDSDNMKQELVNKIKSLEDELSAQE
IFRDNIRCEKDRIIRYVRKLADLLQMDYLPGDNDTVGLLDLLEGRCQELM
IKLSGGSWKCPRCVSINNPNIDSQKQSKRIASLKEEIEAKDLQIQLLEKR
MVEFGKSVHPSSCLMGDETNRDRVHRLQHQLEESQLEIEELRRALVRSQS
SDFEIHKQIKHKQQEELEQLSETVEKLDKVRQRQAKKIAGLKSQIEEKSQ
VLMQHGKRDMDYKQARQLLEEVRRREIKLNDFRSAIAQMIGVDVRCSPDP
ENEIKARIQKLMAMARNAVNTPFTPYYLSQEMPSAFQQGYSNPSLGGYTN
TNNPINQMVPFSKPPNTGNPNLTNDTNGQFFGRRTQVPKNKIVFQSTDDK
IRPNRARSTSPSKVDERKY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR039139CCDC170-like
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 42..76
NoneNo IPR availableCOILSCoilCoilcoord: 410..437
NoneNo IPR availableCOILSCoilCoilcoord: 374..401
NoneNo IPR availableCOILSCoilCoilcoord: 323..350
NoneNo IPR availableCOILSCoilCoilcoord: 225..245
NoneNo IPR availableCOILSCoilCoilcoord: 84..139
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 595..619
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 581..619
IPR039139Coiled-coil domain-containing protein 170-likePANTHERPTHR18863TSEC-2-RELATEDcoord: 3..513