HTH La-type RNA-binding domain-containing protein

Overview
NameHTH La-type RNA-binding domain-containing protein
Smed IDSMED30011104
Length (bp)2389
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of HTH La-type RNA-binding domain-containing protein (SMED30011104) t-SNE clustered cells

Violin plots show distribution of expression levels for HTH La-type RNA-binding domain-containing protein (SMED30011104) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of HTH La-type RNA-binding domain-containing protein (SMED30011104) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for HTH La-type RNA-binding domain-containing protein (SMED30011104) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011104

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30011104h1SMcG0000073 SmedASXL_016178SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30011104h1SMcG0000073 SmedASXL_016178SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
cephalic gangliaSMED30011104h1SMcG0000073 dd_Smed_v4_1420_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30011104h1SMcG0000073 dd_Smed_v4_1420_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30011104h1SMcG0000073 dd_Smed_v6_1420_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30011104h1SMcG0000073 dd_Smed_v4_1420_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30011104h1SMcG0000073 SMED_10149_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30011104h1SMcG0000073 SMED_10149_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of HTH La-type RNA-binding domain-containing protein vs. Ensembl Human
Match: LARP6 (La ribonucleoprotein 6, translational regulator [Source:HGNC Symbol;Acc:HGNC:24012])

HSP 1 Score: 89.7373 bits (221), Expect = 4.304e-18
Identity = 55/191 (28.80%), Postives = 102/191 (53.40%), Query Frame = 1
Query: 1111 PPTQSMIDSIVKQCNFYFSDANVLKDLFILKKLKSNPGGWISLATVARFKQLVKLSNDDIDNVVYAMCYSDQVQISRDASSLRRRLPIPDWD----PS--IYIRSLF----LWNL--PRICDSYEK--LDQVFREEGRF-VVNVSRYIRADRNVPADLRKLVDKIPALGKYNCGVIEFNSREAMLSAGEFI 1638
            PP + +I  +V Q  FYFSD N+ KD F+LK ++ N  G++S+  +  FK++  L+  D     +A+ YS  ++++ D   +RR  P+P +     PS  + +  L+    LW L  P+     ++  ++ + +  G F V++  R ++  R +P D+R++  +   +G   C ++EF   EA + A EF+
Sbjct:   87 PPDEELIKKLVDQIEFYFSDENLEKDAFLLKHVRRNKLGYVSVKLLTSFKKVKHLTR-DWRTTAHALKYSVVLELNEDHRKVRRTTPVPLFPNENLPSKMLLVYDLYLSPKLWALATPQKNGRVQEKVMEHLLKLFGTFGVISSVRILKPGRELPPDIRRISSRYSQVGTQECAIVEFEEVEAAIKAHEFM 276          
BLAST of HTH La-type RNA-binding domain-containing protein vs. Ensembl Human
Match: LARP7 (La ribonucleoprotein 7, transcriptional regulator [Source:HGNC Symbol;Acc:HGNC:24912])

HSP 1 Score: 51.2174 bits (121), Expect = 3.421e-6
Identity = 45/209 (21.53%), Postives = 99/209 (47.37%), Query Frame = 1
Query: 1120 QSMIDSIVKQCNFYFSDANVLKDLFILKKLKSNPGGWISLATVARFKQLVKLSNDDIDNVVYAMCYSDQVQISRDASSLRRRLPIPDWDPSIYIRSLFLWNLPRICDSYEKLDQVFREEGRFV-VNVSRYIRADRNVPADLRKLVDKIPALGKYNCGVIEFNSREAMLSAGEFIHLKWAAVKTFYLDAKEELPKPAVIVGKSSKSLPPP 1743
            + ++  I KQ +F+F DAN+ KD F+ ++++ +  G++ ++ +  F ++ KL+ D    +  A+  S  V++  + + +RR+ P+ +       R++++  LP+  + +  +++VF + G  V +++  Y         D +                +EF ++E    A EF++           +  EE P+   I  K+ K+ P P
Sbjct:   32 KQVLADIAKQVDFWFGDANLHKDRFLREQIEKSRDGYVDISLLVSFNKMKKLTTDG-KLIARALRSSAVVELDLEGTRIRRKKPLGERPKDEDERTVYVELLPKNVN-HSWIERVFGKCGNVVYISIPHY-----KSTGDPKGF------------AFVEFETKEQAAKAIEFLN-----------NPPEEAPRKPGIFPKTVKNKPIP 210          
BLAST of HTH La-type RNA-binding domain-containing protein vs. Ensembl Human
Match: LARP7 (La ribonucleoprotein 7, transcriptional regulator [Source:HGNC Symbol;Acc:HGNC:24912])

HSP 1 Score: 47.7506 bits (112), Expect = 5.260e-6
Identity = 22/87 (25.29%), Postives = 52/87 (59.77%), Query Frame = 1
Query: 1120 QSMIDSIVKQCNFYFSDANVLKDLFILKKLKSNPGGWISLATVARFKQLVKLSNDDIDNVVYAMCYSDQVQISRDASSLRRRLPIPD 1380
            + ++  I KQ +F+F DAN+ KD F+ ++++ +  G++ ++ +  F ++ KL+ D    +  A+  S  V++  + + +RR+ P+ +
Sbjct:   32 KQVLADIAKQVDFWFGDANLHKDRFLREQIEKSRDGYVDISLLVSFNKMKKLTTDG-KLIARALRSSAVVELDLEGTRIRRKKPLGE 117          
BLAST of HTH La-type RNA-binding domain-containing protein vs. Ensembl Human
Match: LARP7 (La ribonucleoprotein 7, transcriptional regulator [Source:HGNC Symbol;Acc:HGNC:24912])

HSP 1 Score: 51.6026 bits (122), Expect = 5.672e-6
Identity = 45/209 (21.53%), Postives = 99/209 (47.37%), Query Frame = 1
Query: 1120 QSMIDSIVKQCNFYFSDANVLKDLFILKKLKSNPGGWISLATVARFKQLVKLSNDDIDNVVYAMCYSDQVQISRDASSLRRRLPIPDWDPSIYIRSLFLWNLPRICDSYEKLDQVFREEGRFV-VNVSRYIRADRNVPADLRKLVDKIPALGKYNCGVIEFNSREAMLSAGEFIHLKWAAVKTFYLDAKEELPKPAVIVGKSSKSLPPP 1743
            + ++  I KQ +F+F DAN+ KD F+ ++++ +  G++ ++ +  F ++ KL+ D    +  A+  S  V++  + + +RR+ P+ +       R++++  LP+  + +  +++VF + G  V +++  Y         D +                +EF ++E    A EF++           +  EE P+   I  K+ K+ P P
Sbjct:   32 KQVLADIAKQVDFWFGDANLHKDRFLREQIEKSRDGYVDISLLVSFNKMKKLTTDG-KLIARALRSSAVVELDLEGTRIRRKKPLGERPKDEDERTVYVELLPKNVN-HSWIERVFGKCGNVVYISIPHY-----KSTGDPKGF------------AFVEFETKEQAAKAIEFLN-----------NPPEEAPRKPGIFPKTVKNKPIP 210          
BLAST of HTH La-type RNA-binding domain-containing protein vs. Ensembl Human
Match: LARP7 (La ribonucleoprotein 7, transcriptional regulator [Source:HGNC Symbol;Acc:HGNC:24912])

HSP 1 Score: 51.6026 bits (122), Expect = 5.672e-6
Identity = 45/209 (21.53%), Postives = 99/209 (47.37%), Query Frame = 1
Query: 1120 QSMIDSIVKQCNFYFSDANVLKDLFILKKLKSNPGGWISLATVARFKQLVKLSNDDIDNVVYAMCYSDQVQISRDASSLRRRLPIPDWDPSIYIRSLFLWNLPRICDSYEKLDQVFREEGRFV-VNVSRYIRADRNVPADLRKLVDKIPALGKYNCGVIEFNSREAMLSAGEFIHLKWAAVKTFYLDAKEELPKPAVIVGKSSKSLPPP 1743
            + ++  I KQ +F+F DAN+ KD F+ ++++ +  G++ ++ +  F ++ KL+ D    +  A+  S  V++  + + +RR+ P+ +       R++++  LP+  + +  +++VF + G  V +++  Y         D +                +EF ++E    A EF++           +  EE P+   I  K+ K+ P P
Sbjct:   32 KQVLADIAKQVDFWFGDANLHKDRFLREQIEKSRDGYVDISLLVSFNKMKKLTTDG-KLIARALRSSAVVELDLEGTRIRRKKPLGERPKDEDERTVYVELLPKNVN-HSWIERVFGKCGNVVYISIPHY-----KSTGDPKGF------------AFVEFETKEQAAKAIEFLN-----------NPPEEAPRKPGIFPKTVKNKPIP 210          
BLAST of HTH La-type RNA-binding domain-containing protein vs. Ensembl Fly
Match: Achl (gene:FBgn0033936 transcript:FBtr0345529)

HSP 1 Score: 77.0258 bits (188), Expect = 4.588e-14
Identity = 49/189 (25.93%), Postives = 102/189 (53.97%), Query Frame = 1
Query: 1114 PTQSMIDSIVKQCNFYFSDANVLKDLFILKKLKSNPGGWISLATVARFKQLVKLSND--DIDNVVYAMCYSDQVQISRDASSLRRRLPIPDWDPSIYIRSLFLWNLPRICDSYEKLDQVFREEGRFVVNVSRYIRADRNVPADLRKLVDKIPALGKYNCGVIEF----NSREAMLSAGEFIHLKWAAVK 1662
            P++ +   I     FYFS+ ++LKD F+LK ++ N  G++SL  V+ FK++ +L+ +   + + V     S +++++   + +RR  P+P +D ++  R++   +LP    + EK+  +F   G   + + R ++    +P D+R+ ++K P L +  C ++E+    ++R+A    G F   +  A K
Sbjct:  277 PSEELAAEITDAVEFYFSNESILKDAFLLKHVRRNKEGFVSLKLVSSFKRVRQLTREWKVVGDAVRRK--SRKIELNDVGTKVRRIEPLPSFDETMPSRTIVACDLPLDKLTIEKVSDLFSPCGE--IALIRILKPGMAIPVDVRQFMNKYPELQQKECALVEYLESSSARDARHLNGPFQVYEMVAPK 461          
BLAST of HTH La-type RNA-binding domain-containing protein vs. Ensembl Fly
Match: Achl (gene:FBgn0033936 transcript:FBtr0087488)

HSP 1 Score: 77.0258 bits (188), Expect = 4.588e-14
Identity = 49/189 (25.93%), Postives = 102/189 (53.97%), Query Frame = 1
Query: 1114 PTQSMIDSIVKQCNFYFSDANVLKDLFILKKLKSNPGGWISLATVARFKQLVKLSND--DIDNVVYAMCYSDQVQISRDASSLRRRLPIPDWDPSIYIRSLFLWNLPRICDSYEKLDQVFREEGRFVVNVSRYIRADRNVPADLRKLVDKIPALGKYNCGVIEF----NSREAMLSAGEFIHLKWAAVK 1662
            P++ +   I     FYFS+ ++LKD F+LK ++ N  G++SL  V+ FK++ +L+ +   + + V     S +++++   + +RR  P+P +D ++  R++   +LP    + EK+  +F   G   + + R ++    +P D+R+ ++K P L +  C ++E+    ++R+A    G F   +  A K
Sbjct:  277 PSEELAAEITDAVEFYFSNESILKDAFLLKHVRRNKEGFVSLKLVSSFKRVRQLTREWKVVGDAVRRK--SRKIELNDVGTKVRRIEPLPSFDETMPSRTIVACDLPLDKLTIEKVSDLFSPCGE--IALIRILKPGMAIPVDVRQFMNKYPELQQKECALVEYLESSSARDARHLNGPFQVYEMVAPK 461          
BLAST of HTH La-type RNA-binding domain-containing protein vs. Ensembl Fly
Match: La (gene:FBgn0011638 transcript:FBtr0081374)

HSP 1 Score: 64.6994 bits (156), Expect = 1.281e-10
Identity = 36/106 (33.96%), Postives = 60/106 (56.60%), Query Frame = 1
Query: 1135 SIVKQCNFYFSDANVLKDLFILKKLKSNPGGWISLATVARFKQLVKLSNDDIDNVVYAMCYSDQ--VQISRDASSLRRR--LPIPDWDP----SIYIRSLFLWNLP 1428
            +I++Q  +YF DAN+ +D F+ +++  N  GW+ L+ +  FK+L  LS  D+  +V A+  S++  V+IS D  SLRR    PIP+ +      I  R+ +    P
Sbjct:   53 AIIRQVEYYFGDANLNRDKFLREQIGKNEDGWVPLSVLVTFKRLASLST-DLSEIVAALNKSEEGLVEISEDKLSLRRHPERPIPEHNEERRKEIQERTAYAKGFP 157          
BLAST of HTH La-type RNA-binding domain-containing protein vs. Ensembl Fly
Match: Larp7 (gene:FBgn0260771 transcript:FBtr0301275)

HSP 1 Score: 53.5286 bits (127), Expect = 6.661e-7
Identity = 35/129 (27.13%), Postives = 66/129 (51.16%), Query Frame = 1
Query: 1036 EPAEQIHVMRLAPEELIYTFKEGFLPPTQSMIDSIVKQCNFYFSDANVLKDLFILKKLKSNPGGWISLATVARFKQLVKLSNDDIDNVVYAMCYSDQVQISRDASSLRRRLPIPDW----DPSIYIRSL 1410
            EPAE+ +    APE+     K+G     + + +SI  Q  FYF DAN+ KD F+ + ++ +P  ++ L     F ++  L+  D+  +  A+  S  +++      ++RR  +PD     D ++Y+ +L
Sbjct:   30 EPAEE-NSKEPAPEDASPDKKDGGRKRKRHLFNSIRGQMEFYFGDANLSKDRFLRRYVEQDP--YVPLEIFLTFNKIKTLTQ-DVQQIAKALSNSQLLELDETELKVKRRTKLPDQRDVNDKTLYVEAL 154          
BLAST of HTH La-type RNA-binding domain-containing protein vs. Ensembl Zebrafish
Match: larp6a (La ribonucleoprotein 6, translational regulator a [Source:ZFIN;Acc:ZDB-GENE-030131-6403])

HSP 1 Score: 77.411 bits (189), Expect = 1.988e-14
Identity = 54/200 (27.00%), Postives = 99/200 (49.50%), Query Frame = 1
Query: 1096 KEGFLPPTQSMIDSIVKQCNFYFSDANVLKDLFILKKLKSNPGGWISLATVARFKQLVKLSNDDIDNVVYAMCYSDQVQISRDASSLRRRLPIPDW-DPSIYIRSLFLWNLPRICD----------------SYEKL-DQVFREEGRFVVNVS-RYIRADRNVPADLRKLVDKIPALGKYNCGVIEFNSREAMLSAGEFI 1638
            +E + PP   +I  +V Q  +Y SD N+  D F+LK ++ N  G++S+  +  FK++  L+  D     YA+ +S+ ++++ +   +RRR  +P +   S+  R L L  L R  +                  E+L + + +  G +    S R ++  +++PADL+KL  +   LG   C ++EF   EA + A E +
Sbjct:   12 EESWQPPDPELIQKLVAQIEYYLSDENLEHDAFLLKHVRRNKLGFVSVKLLTSFKKVKHLTR-DWRTTAYALRHSNLLELNDEGRKVRRRSTVPVFASESLPSRMLLLSELKRWPELGIALGGDSNNGSGPTQQERLMELLLKAFGNYGPIASVRVLKPGKDLPADLKKLSGRYSQLGTEECAIVEFEEVEAAMKAHEAV 210          
BLAST of HTH La-type RNA-binding domain-containing protein vs. Ensembl Zebrafish
Match: larp6a (La ribonucleoprotein 6, translational regulator a [Source:ZFIN;Acc:ZDB-GENE-030131-6403])

HSP 1 Score: 77.411 bits (189), Expect = 2.173e-14
Identity = 54/200 (27.00%), Postives = 99/200 (49.50%), Query Frame = 1
Query: 1096 KEGFLPPTQSMIDSIVKQCNFYFSDANVLKDLFILKKLKSNPGGWISLATVARFKQLVKLSNDDIDNVVYAMCYSDQVQISRDASSLRRRLPIPDW-DPSIYIRSLFLWNLPRICD----------------SYEKL-DQVFREEGRFVVNVS-RYIRADRNVPADLRKLVDKIPALGKYNCGVIEFNSREAMLSAGEFI 1638
            +E + PP   +I  +V Q  +Y SD N+  D F+LK ++ N  G++S+  +  FK++  L+  D     YA+ +S+ ++++ +   +RRR  +P +   S+  R L L  L R  +                  E+L + + +  G +    S R ++  +++PADL+KL  +   LG   C ++EF   EA + A E +
Sbjct:   68 EESWQPPDPELIQKLVAQIEYYLSDENLEHDAFLLKHVRRNKLGFVSVKLLTSFKKVKHLTR-DWRTTAYALRHSNLLELNDEGRKVRRRSTVPVFASESLPSRMLLLSELKRWPELGIALGGDSNNGSGPTQQERLMELLLKAFGNYGPIASVRVLKPGKDLPADLKKLSGRYSQLGTEECAIVEFEEVEAAMKAHEAV 266          
BLAST of HTH La-type RNA-binding domain-containing protein vs. Ensembl Zebrafish
Match: larp6b (La ribonucleoprotein 6, translational regulator b [Source:ZFIN;Acc:ZDB-GENE-041008-244])

HSP 1 Score: 76.6406 bits (187), Expect = 4.015e-14
Identity = 55/204 (26.96%), Postives = 92/204 (45.10%), Query Frame = 1
Query: 1093 FKEG--FLPPTQSMIDSIVKQCNFYFSDANVLKDLFILKKLKSNPGGWISLATVARFKQLVKLSNDDIDNVVYAMCYSDQVQISRDASSLRRRLPIPDWDPSIYIRSLFL-WNLPRICDSYEKLDQVFREEG----------------RFVVNVSRYIRADRNVPADLRKLVDKIPALGKYNCGVIEFNSREAMLSAGEFIHLK 1647
            F EG  ++PP   +   I  Q   Y SD N+  D F+LK ++ N  G++SL  +  FK++  L+  D    + A   S Q++++   + +RRR P+PDW   I    L L WN     D    + + F   G                   ++  R +R  + +PA+L++   K   LG+  C V+E+   E    A E + ++
Sbjct:   48 FCEGELWIPPNDDVTQQIATQLENYLSDENLSDDAFLLKHVQRNKMGYVSLKLLTSFKKIRDLTR-DWRTTLAAARTSLQLEVNEMGTKVRRRTPVPDWLLCIPTSKLLLAWNF---LDGAGPVKEKFESPGVEQLGIMEAAMRVFSPYGTISSLRILRPGKEIPAELKRYTKKHLELGRKVCAVVEYEYLEGARKAFEALKVE 247          
BLAST of HTH La-type RNA-binding domain-containing protein vs. Ensembl Zebrafish
Match: larp6b (La ribonucleoprotein 6, translational regulator b [Source:ZFIN;Acc:ZDB-GENE-041008-244])

HSP 1 Score: 51.6026 bits (122), Expect = 7.600e-7
Identity = 41/157 (26.11%), Postives = 71/157 (45.22%), Query Frame = 1
Query: 1225 GWISLATVARFKQLVKLSNDDIDNVVYAMCYSDQVQISRDASSLRRRLPIPDWDPSIYIRSLFL-WNL-------------PRI--CDSYEKLDQVFREEGRFVVNVSRYIRADRNVPADLRKLVDKIPALGKYNCGVIEFNSREAMLSAGEFIHLK 1647
            G++SL  +  FK++  L+ D     + A   S Q++++   + +RRR P+PDW   I    L L WN              P +      E   +VF   G   ++  R +R  + +PA+L++   K   LG+  C V+E+   E    A E + ++
Sbjct:    2 GYVSLKLLTSFKKIRDLTRD-WRTTLAAARTSLQLEVNEMGTKVRRRTPVPDWLLCIPTSKLLLAWNFLDGAGPVKEKFESPGVEQLGIMEAAMRVFSPYG--TISSLRILRPGKEIPAELKRYTKKHLELGRKVCAVVEYEYLEGARKAFEALKVE 155          
BLAST of HTH La-type RNA-binding domain-containing protein vs. Ensembl Zebrafish
Match: larp7 (La ribonucleoprotein 7, transcriptional regulator [Source:NCBI gene;Acc:334956])

HSP 1 Score: 52.7582 bits (125), Expect = 1.650e-6
Identity = 31/130 (23.85%), Postives = 73/130 (56.15%), Query Frame = 1
Query: 1120 QSMIDSIVKQCNFYFSDANVLKDLFILKKLKSNPGGWISLATVARFKQLVKLSNDDIDNVVYAMCYSDQVQISRDASSLRRRLPIPDWDPSIYIRSLFLWNLPRICDSYEKLDQVFREEGRFV-VNVSRY 1506
            + ++  + KQ  F+F D N+ KD F+   ++ +  G+I +A +  F ++  L+  D+  +  A+  S  V+++ + + +RR+ P+ +    +  R++++  LP+   ++  L++VF + G  V +++ RY
Sbjct:   40 KQLLSDVKKQVEFWFGDVNLHKDRFMKSIIEQSRDGYIDIAVLTTFNRMKNLTA-DVKLIARALKNSTIVEVNDEGTRIRRKEPLGETPKDVDSRTVYVELLPKTV-THIWLERVFSKCGHVVYISIPRY 167          
BLAST of HTH La-type RNA-binding domain-containing protein vs. Ensembl Xenopus
Match: larp6-like.1 (acheron [Source:NCBI gene;Acc:780092])

HSP 1 Score: 88.9669 bits (219), Expect = 6.349e-18
Identity = 54/192 (28.12%), Postives = 101/192 (52.60%), Query Frame = 1
Query: 1114 PTQSMIDSIVKQCNFYFSDANVLKDLFILKKLKSNPGGWISLATVARFKQLVKLSNDDIDNVVYAMCYSDQVQISRDASSLRRRLPIPDWDPSI-YIRSLFLWNL--PR----ICDS---YEKLDQVFREEGRFVVNVSRYIRADRNVPADLRKLVDKIPALGKYNCGVIEFNSREAMLSAGEFIHLKWAAV 1659
            P   ++  IV Q  FY SD N+  D F+LK ++ N  G++S+  +  FK++  L+  D    +YA+ +S+Q++++ + + +RR+ P+PD+   +   + L +WN+  P      C      E +  VF   G  ++   R ++  + VP+D+RK + + P L   NC ++E+ S E    A E +  K ++ 
Sbjct:   75 PDLKLVRKIVSQVEFYLSDENLSHDAFLLKHVQKNKMGYVSIKLLTSFKKIKYLTR-DWRKTLYALRFSEQLEVNEEETKVRRKNPLPDYLLGLPPTKQLLVWNISDPEKRSFSCQQKNLMEIVTSVFATYG--LITSIRILKPGKEVPSDIRKYMSRYPELSTRNCALVEYESLEGARKALEALSGKVSST 263          
BLAST of HTH La-type RNA-binding domain-containing protein vs. Ensembl Xenopus
Match: shcbp1 (SHC SH2-domain binding protein 1 [Source:Xenbase;Acc:XB-GENE-5807675])

HSP 1 Score: 84.7297 bits (208), Expect = 2.034e-16
Identity = 51/195 (26.15%), Postives = 105/195 (53.85%), Query Frame = 1
Query: 1111 PPTQSMIDSIVKQCNFYFSDANVLKDLFILKKLKSNPGGWISLATVARFKQLVKLSNDDIDNVVYAMCYSDQVQISRDASSLRRRLPIPDWDPSIYIRS--LFLWNLPRI----CDSYEK---------LDQVFREEGRF-VVNVSRYIRADRNVPADLRKLVDKIPALGKYNCGVIEFNSREAMLSAGEFIHLK 1647
            PP   +I  ++ Q  +Y SD N+ KD F+LK ++ N  G++S+  +  FK++  L+  D     YA+ YS+ ++++ D   +RR+ P+P + PS  + S  L +++L  I    C   E+         ++ + +  G F V++  R ++  R++P+D+++   +   +G  +C ++EF   EA + A +  +++
Sbjct:   88 PPDAELIQKLITQIEYYLSDENLEKDAFLLKHVRRNKMGFVSVKLLTSFKKVKHLTR-DWRTTAYALRYSNLLELNEDNRKIRRKTPVPVF-PSENLPSKMLLVYDLHFIPELNCLGKEQENGGMQEKVMEHLLKSFGTFGVISSIRILKPGRDLPSDVKRFSSRYSQVGTKDCAIVEFEEVEAAIKAHDTFNVE 280          
BLAST of HTH La-type RNA-binding domain-containing protein vs. Ensembl Xenopus
Match: shcbp1 (SHC SH2-domain binding protein 1 [Source:Xenbase;Acc:XB-GENE-5807675])

HSP 1 Score: 83.5741 bits (205), Expect = 7.284e-16
Identity = 51/188 (27.13%), Postives = 101/188 (53.72%), Query Frame = 1
Query: 1111 PPTQSMIDSIVKQCNFYFSDANVLKDLFILKKLKSNPGGWISLATVARFKQLVKLSNDDIDNVVYAMCYSDQVQISRDASSLRRRLPIPDWDPSIYIRS--LFLWNLPRI----CDSYEK---------LDQVFREEGRF-VVNVSRYIRADRNVPADLRKLVDKIPALGKYNCGVIEFNSREAMLSA 1626
            PP   +I  ++ Q  +Y SD N+ KD F+LK ++ N  G++S+  +  FK++  L+  D     YA+ YS+ ++++ D   +RR+ P+P + PS  + S  L +++L  I    C   E+         ++ + +  G F V++  R ++  R++P+D+++   +   +G  +C ++EF   EA + A
Sbjct:  370 PPDAELIQKLITQIEYYLSDENLEKDAFLLKHVRRNKMGFVSVKLLTSFKKVKHLTR-DWRTTAYALRYSNLLELNEDNRKIRRKTPVPVF-PSENLPSKMLLVYDLHFIPELNCLGKEQENGGMQEKVMEHLLKSFGTFGVISSIRILKPGRDLPSDVKRFSSRYSQVGTKDCAIVEFEEVEAAIKA 555          
BLAST of HTH La-type RNA-binding domain-containing protein vs. Ensembl Xenopus
Match: ybx3 (Y-box binding protein 3 [Source:Xenbase;Acc:XB-GENE-1007558])

HSP 1 Score: 59.3066 bits (142), Expect = 1.747e-8
Identity = 35/131 (26.72%), Postives = 76/131 (58.02%), Query Frame = 1
Query: 1120 QSMIDSIVKQCNFYFSDANVLKDLFILKKLKSNPGGWISLATVARFKQLVKLSNDDIDNVVYAMCYSDQVQISRDASSLRRRLPIPDWDPSIYIRSLFLWNLPR-ICDSYEKLDQVFREEGRFV-VNVSRY 1506
            + ++  I KQ +F+F D N+ KD F+ ++++    G+I ++ +A F ++ K++ D    +  A+  S  V+I+   + +RRR P+ +    +  R++++  LP+ +  S+  +++VF + G  V V++ RY
Sbjct:   34 KQLLADIAKQVDFWFGDVNLHKDRFLREQIEKTRDGYIDISLLASFNKMKKITTDS-KLIARAVKNSSVVEINLSGTKIRRRFPLGEKPQDVDSRTVYVELLPKNVTHSW--IERVFGKYGMVVYVSIPRY 161          
BLAST of HTH La-type RNA-binding domain-containing protein vs. Ensembl Xenopus
Match: ybx3 (Y-box binding protein 3 [Source:Xenbase;Acc:XB-GENE-1007558])

HSP 1 Score: 58.9214 bits (141), Expect = 1.923e-8
Identity = 35/131 (26.72%), Postives = 76/131 (58.02%), Query Frame = 1
Query: 1120 QSMIDSIVKQCNFYFSDANVLKDLFILKKLKSNPGGWISLATVARFKQLVKLSNDDIDNVVYAMCYSDQVQISRDASSLRRRLPIPDWDPSIYIRSLFLWNLPR-ICDSYEKLDQVFREEGRFV-VNVSRY 1506
            + ++  I KQ +F+F D N+ KD F+ ++++    G+I ++ +A F ++ K++ D    +  A+  S  V+I+   + +RRR P+ +    +  R++++  LP+ +  S+  +++VF + G  V V++ RY
Sbjct:   30 KQLLADIAKQVDFWFGDVNLHKDRFLREQIEKTRDGYIDISLLASFNKMKKITTDS-KLIARAVKNSSVVEINLSGTKIRRRFPLGEKPQDVDSRTVYVELLPKNVTHSW--IERVFGKYGMVVYVSIPRY 157          
BLAST of HTH La-type RNA-binding domain-containing protein vs. Ensembl Mouse
Match: Larp6 (La ribonucleoprotein domain family, member 6 [Source:MGI Symbol;Acc:MGI:1914807])

HSP 1 Score: 87.8113 bits (216), Expect = 1.205e-17
Identity = 55/191 (28.80%), Postives = 101/191 (52.88%), Query Frame = 1
Query: 1111 PPTQSMIDSIVKQCNFYFSDANVLKDLFILKKLKSNPGGWISLATVARFKQLVKLSNDDIDNVVYAMCYSDQVQISRDASSLRRRLPIPDWD----PS----IYIRSLF--LWNL--PRICDSYEK--LDQVFREEGRF-VVNVSRYIRADRNVPADLRKLVDKIPALGKYNCGVIEFNSREAMLSAGEFI 1638
            PP + +I  +V Q  FYFSD N+ KD F+LK ++ N  G++S+  +  FK++  L+  D     +A+ YS  ++++ D   +RR  P+P +     PS    +Y   L   LW L  P+     ++  ++ + +  G F V++  R ++  R +P D+R++  +   +G   C ++EF   +A + A EF+
Sbjct:   87 PPDEELIRKLVDQIEFYFSDENLEKDAFLLKHVRRNKLGYVSVKLLTSFKKVKHLTR-DWRTTAHALKYSVTLELNEDHRKVRRTTPVPLFPNENLPSKMLLVYDLHLSPKLWALATPQKNGRVQEKVMEHLLKLFGTFGVISSVRILKPGRELPPDIRRISSRYSQVGTQECAIVEFEEVDAAIKAHEFM 276          
BLAST of HTH La-type RNA-binding domain-containing protein vs. Ensembl Mouse
Match: Larp7 (La ribonucleoprotein domain family, member 7 [Source:MGI Symbol;Acc:MGI:107634])

HSP 1 Score: 52.7582 bits (125), Expect = 1.397e-6
Identity = 46/210 (21.90%), Postives = 100/210 (47.62%), Query Frame = 1
Query: 1120 QSMIDSIVKQCNFYFSDANVLKDLFILKKLKSNPGGWISLATVARFKQLVKLSNDDIDNVVYAMCYSDQVQISRDASSLRRRLPIPDWDPSIYIRSLFLWNLPR-ICDSYEKLDQVFREEGRFV-VNVSRYIRADRNVPADLRKLVDKIPALGKYNCGVIEFNSREAMLSAGEFIHLKWAAVKTFYLDAKEELPKPAVIVGKSSKSLPPP 1743
            + ++  I KQ +F+F DAN+ KD F+ ++++ +  G++ ++ +  F ++ KL+ D    +  A+  S  V++  + + +RR+ P+ +       R++++  LP+ +  S+  +++VF + G  V +++  Y         D +                +EF ++E    A EF++           +  EE P+   I  K+ K+ P P
Sbjct:   26 KQVLADIAKQVDFWFGDANLHKDKFLREQIEKSRDGYVDISLLVSFNKMKKLTTDG-KLIARALKSSSVVELDLEGTRIRRKKPLGERPKDEEERTVYVELLPKNVTHSW--IERVFGKCGNVVYISIPHY-----KSTGDPKGFA------------FVEFETKEQAAKAIEFLN-----------NPPEEAPRKPGIFPKTVKNKPIP 204          
BLAST of HTH La-type RNA-binding domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9BRS8|LARP6_HUMAN (La-related protein 6 OS=Homo sapiens OX=9606 GN=LARP6 PE=1 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 2.067e-17
Identity = 55/191 (28.80%), Postives = 102/191 (53.40%), Query Frame = 1
Query: 1111 PPTQSMIDSIVKQCNFYFSDANVLKDLFILKKLKSNPGGWISLATVARFKQLVKLSNDDIDNVVYAMCYSDQVQISRDASSLRRRLPIPDWD----PS--IYIRSLF----LWNL--PRICDSYEK--LDQVFREEGRF-VVNVSRYIRADRNVPADLRKLVDKIPALGKYNCGVIEFNSREAMLSAGEFI 1638
            PP + +I  +V Q  FYFSD N+ KD F+LK ++ N  G++S+  +  FK++  L+  D     +A+ YS  ++++ D   +RR  P+P +     PS  + +  L+    LW L  P+     ++  ++ + +  G F V++  R ++  R +P D+R++  +   +G   C ++EF   EA + A EF+
Sbjct:   87 PPDEELIKKLVDQIEFYFSDENLEKDAFLLKHVRRNKLGYVSVKLLTSFKKVKHLTR-DWRTTAHALKYSVVLELNEDHRKVRRTTPVPLFPNENLPSKMLLVYDLYLSPKLWALATPQKNGRVQEKVMEHLLKLFGTFGVISSVRILKPGRELPPDIRRISSRYSQVGTQECAIVEFEEVEAAIKAHEFM 276          
BLAST of HTH La-type RNA-binding domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8BN59|LARP6_MOUSE (La-related protein 6 OS=Mus musculus OX=10090 GN=Larp6 PE=1 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 8.432e-17
Identity = 55/191 (28.80%), Postives = 101/191 (52.88%), Query Frame = 1
Query: 1111 PPTQSMIDSIVKQCNFYFSDANVLKDLFILKKLKSNPGGWISLATVARFKQLVKLSNDDIDNVVYAMCYSDQVQISRDASSLRRRLPIPDWD----PS----IYIRSLF--LWNL--PRICDSYEK--LDQVFREEGRF-VVNVSRYIRADRNVPADLRKLVDKIPALGKYNCGVIEFNSREAMLSAGEFI 1638
            PP + +I  +V Q  FYFSD N+ KD F+LK ++ N  G++S+  +  FK++  L+  D     +A+ YS  ++++ D   +RR  P+P +     PS    +Y   L   LW L  P+     ++  ++ + +  G F V++  R ++  R +P D+R++  +   +G   C ++EF   +A + A EF+
Sbjct:   87 PPDEELIRKLVDQIEFYFSDENLEKDAFLLKHVRRNKLGYVSVKLLTSFKKVKHLTR-DWRTTAHALKYSVTLELNEDHRKVRRTTPVPLFPNENLPSKMLLVYDLHLSPKLWALATPQKNGRVQEKVMEHLLKLFGTFGVISSVRILKPGRELPPDIRRISSRYSQVGTQECAIVEFEEVDAAIKAHEFM 276          
BLAST of HTH La-type RNA-binding domain-containing protein vs. UniProt/SwissProt
Match: sp|Q94A38|LRP6A_ARATH (La-related protein 6A OS=Arabidopsis thaliana OX=3702 GN=LARP6A PE=2 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 4.800e-10
Identity = 39/128 (30.47%), Postives = 72/128 (56.25%), Query Frame = 1
Query: 1099 EGFLPPTQSMIDSIVKQCNFYFSDANVLKDLFILKKLKSNPGGWISLATVARFKQLVKLSNDDIDNVVYAMCYSDQVQISRDASSLRRRLPIPD-WDPSIYIRSLFLWNLPRICDSYEKLDQVFREEG 1479
            +G + P   +   I++Q  +YFSD N+  D F+L  +K N  G++ ++T+A F ++ KL+ D    +V A+  S  + +S D   ++R  P+P+  DP I+  ++ + NLP    S E + ++F + G
Sbjct:   94 DGVVVPIDELNQKIIRQVEYYFSDENLPTDKFLLNAMKRNKKGFVPISTIATFHKMKKLTRDHA-LIVSALKESSFLVVSADEKKVKRLSPLPEIRDPKIF--TVLVENLPEDH-SNENIREIFGKAG 217          
BLAST of HTH La-type RNA-binding domain-containing protein vs. UniProt/SwissProt
Match: sp|P40796|LA_DROME (La protein homolog OS=Drosophila melanogaster OX=7227 GN=La PE=1 SV=2)

HSP 1 Score: 64.6994 bits (156), Expect = 1.284e-9
Identity = 36/106 (33.96%), Postives = 60/106 (56.60%), Query Frame = 1
Query: 1135 SIVKQCNFYFSDANVLKDLFILKKLKSNPGGWISLATVARFKQLVKLSNDDIDNVVYAMCYSDQ--VQISRDASSLRRR--LPIPDWDP----SIYIRSLFLWNLP 1428
            +I++Q  +YF DAN+ +D F+ +++  N  GW+ L+ +  FK+L  LS  D+  +V A+  S++  V+IS D  SLRR    PIP+ +      I  R+ +    P
Sbjct:   53 AIIRQVEYYFGDANLNRDKFLREQIGKNEDGWVPLSVLVTFKRLASLST-DLSEIVAALNKSEEGLVEISEDKLSLRRHPERPIPEHNEERRKEIQERTAYAKGFP 157          
BLAST of HTH La-type RNA-binding domain-containing protein vs. UniProt/SwissProt
Match: sp|Q28G87|LARP7_XENTR (La-related protein 7 OS=Xenopus tropicalis OX=8364 GN=larp7 PE=2 SV=1)

HSP 1 Score: 58.9214 bits (141), Expect = 1.569e-7
Identity = 35/131 (26.72%), Postives = 76/131 (58.02%), Query Frame = 1
Query: 1120 QSMIDSIVKQCNFYFSDANVLKDLFILKKLKSNPGGWISLATVARFKQLVKLSNDDIDNVVYAMCYSDQVQISRDASSLRRRLPIPDWDPSIYIRSLFLWNLPR-ICDSYEKLDQVFREEGRFV-VNVSRY 1506
            + ++  I KQ +F+F D N+ KD F+ ++++    G+I ++ +A F ++ K++ D    +  A+  S  V+I+   + +RRR P+ +    +  R++++  LP+ +  S+  +++VF + G  V V++ RY
Sbjct:   34 KQLLADIAKQVDFWFGDVNLHKDRFLREQIEKTRDGYIDISLLASFNKMKKITTDS-KLIARAVKNSSVVEINLSGTKIRRRFPLGEKPQDVDSRTVYVELLPKNVTHSW--IERVFGKYGMVVYVSIPRY 161          
BLAST of HTH La-type RNA-binding domain-containing protein vs. TrEMBL
Match: A0A504XAT4 (Lupus la ribonucleoprotein OS=Fasciola gigantica OX=46835 GN=FGIG_00939 PE=4 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 2.309e-31
Identity = 71/185 (38.38%), Postives = 107/185 (57.84%), Query Frame = 1
Query: 1126 MIDSIVKQCNFYFSDANVLKDLFILKKLKSNPGGWISLATVARFKQLVKLS-NDDIDNVVYAMCYSDQVQISRDASSLRRRLPIPDWDPSIYIRSLFLWNLPRICD-SYEKLDQVFREEGRFVVNVSRYIRADRNVPADLRKLVDKIPALGKYNCGVIEFNSREAMLSAGEFIHLKWAAVKTFYL 1674
            ++  I  QC FYFSDAN+LKD F+LKK+K++  GW+ L  V  FK++ KL+ N  I  VV A+  SD++++S D  S+RRR P+P+WDP++Y R+L +  LP + D     L + F  +G     + R+    R +P+DL++     P LG     V+EF SREA   A   I  + +     +L
Sbjct:   43 LLHQIAHQCEFYFSDANILKDQFLLKKVKTSKDGWVKLEVVEGFKKMQKLTKNHGI--VVKALALSDKLEVSEDGLSVRRRNPLPEWDPTVYYRTLIISELPSVDDIKLTSLTEFFTTQG-LPPTLLRFFAPGRKIPSDLKRSQAMHPFLGTKPSAVVEFGSREAASKALSVIRQRCSTAYIHFL 224          
BLAST of HTH La-type RNA-binding domain-containing protein vs. TrEMBL
Match: H9LHW9 (La autoantigen-like protein (Fragment) OS=Crassostrea ariakensis OX=94323 PE=2 SV=2)

HSP 1 Score: 128.642 bits (322), Expect = 4.146e-29
Identity = 62/179 (34.64%), Postives = 109/179 (60.89%), Query Frame = 1
Query: 1105 FLPPTQSMIDSIVKQCNFYFSDANVLKDLFILKKLKSNPGGWISLATVARFKQLVKLSNDDIDNVVYAMCYSDQVQISRDASSLRRRLPIPDWDPSIYIRSLFLWNLPRICDSYEKLDQVFREEGRFVVNVSRYIRADRNVPADLRKLVDKIPALGKYNCGVIEFNSREAMLSAGEFIH 1641
            F+ P   + + I+KQ  FYFSDAN+LKD F+LK ++ N  G++S+  +  FK++  L+  D   V Y++ +SD+++++ +   +RR+ P+PDWD +   RS+ + NLP    + E + ++F + G   V++ R +R  ++VP D++K   K P +G   C V+EF   EA  +A E ++
Sbjct:   74 FVAPDDELKNRIIKQVEFYFSDANILKDAFLLKHVRRNKQGFVSIKLITSFKKVKSLTK-DYRVVAYSLRHSDKLEVNEEGRKVRRKDPLPDWDETTPSRSIVVVNLPMENPTIENVAEMFSKCGE--VSLIRILRPGKSVPQDVKKHATKHPEIGTTTCAVVEFEKHEAAKTACETMN 249          
BLAST of HTH La-type RNA-binding domain-containing protein vs. TrEMBL
Match: A0A3S5C6R0 (HTH La-type RNA-binding domain-containing protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS32462 PE=4 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 6.110e-29
Identity = 67/177 (37.85%), Postives = 105/177 (59.32%), Query Frame = 1
Query: 1105 FLPPTQSMIDSIVKQCNFYFSDANVLKDLFILKKLKSNPGGWISLATVARFKQLVKLSNDDIDNVVYAMCYSDQVQISRDASSLRRRLPIPDWDPSIYIRSLFLWNLPRI---CDSYEKLDQVFREEGRFVVNVSRYIRADRNVPADLRKLVDKIPALGKYNCGVIEFNSREAMLSA 1626
            F+ PT  +++ I++QC FYFS+AN+LKD F+LKK KS+  GWI L+ + RF ++ ++S+D +   +YA+  S  ++IS +   +RR  P+PDWDPS+Y RS+ +   P +    DS   L  +     R V    R +   R +PADL++     P LG   C +IEF+SR+  +  
Sbjct:   88 FIAPTPGVVEKIIRQCEFYFSNANILKDPFLLKKAKSDKEGWIELSIIERFSRMRQISSDHL-TFLYALRQSKLLEISENGLMIRRIEPLPDWDPSVYNRSIIISKFPCVTVTVDSITDLFTICDLPPRLV----RVLSPQRRIPADLKRTQYFHPMLGVEMCAIIEFDSRDQAMEG 259          
BLAST of HTH La-type RNA-binding domain-containing protein vs. TrEMBL
Match: A0A0R3SFJ2 (HTH La-type RNA-binding domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS3612 PE=4 SV=2)

HSP 1 Score: 128.257 bits (321), Expect = 4.045e-28
Identity = 64/164 (39.02%), Postives = 106/164 (64.63%), Query Frame = 1
Query: 1138 IVKQCNFYFSDANVLKDLFILKKLKSNPGGWISLATVARFKQLVKLSNDDIDNVVYAMCYSDQVQISRDASSLRRRLPIPDWDPSIYIRSLFLWNL-PRICDSYEKLDQVFREEGRFVVNVSRYIRADRNVPADLRKLVDKIPALGKYNCGVIEFNSREAMLSA 1626
            I+KQ  FYFSDAN+LKD +ILK +KSN  GW+ L+TVA F+++  L++D+ D +   +  S+Q+++S D + +RRR P+P+WD S+Y RS+ + +  P    +  ++ + F+      V + R I  +R +P+DL K  + +  LGK  C V+EF+++EA + A
Sbjct:   50 ILKQIEFYFSDANILKDQYILKAVKSNKEGWVKLSTVAAFRRVQMLTSDE-DLIRKVLRRSEQLEVSEDGTRIRRRNPLPEWDRSVYQRSVLITHFKPNELVTISQIAKFFKAND-LCVTLVRIIDTNRPIPSDLIKTANHLGYLGKEKCAVVEFDTKEAAMKA 211          
BLAST of HTH La-type RNA-binding domain-containing protein vs. TrEMBL
Match: A0A564YQ70 (HTH La-type RNA-binding domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS8362 PE=4 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 7.432e-28
Identity = 64/164 (39.02%), Postives = 106/164 (64.63%), Query Frame = 1
Query: 1138 IVKQCNFYFSDANVLKDLFILKKLKSNPGGWISLATVARFKQLVKLSNDDIDNVVYAMCYSDQVQISRDASSLRRRLPIPDWDPSIYIRSLFLWNL-PRICDSYEKLDQVFREEGRFVVNVSRYIRADRNVPADLRKLVDKIPALGKYNCGVIEFNSREAMLSA 1626
            I+KQ  FYFSDAN+LKD +ILK +KSN  GW+ L+TVA F+++  L++D+ D +   +  S+Q+++S D + +RRR P+P+WD S+Y RS+ + +  P    +  ++ + F+      V + R I  +R +P+DL K  + +  LGK  C V+EF+++EA + A
Sbjct:   52 ILKQIEFYFSDANILKDQYILKAVKSNKEGWVKLSTVAAFRRVQMLTSDE-DLIRKVLRRSEQLEVSEDGTRIRRRNPLPEWDRSVYQRSVLITHFKPNELVTISQIAKFFKAND-LCVTLVRIIDTNRPIPSDLIKTANHLGYLGKEKCAVVEFDTKEAAMKA 213          
BLAST of HTH La-type RNA-binding domain-containing protein vs. Ensembl Cavefish
Match: larp6b (la-related protein 6-like [Source:NCBI gene;Acc:103042034])

HSP 1 Score: 87.0409 bits (214), Expect = 1.501e-17
Identity = 53/184 (28.80%), Postives = 87/184 (47.28%), Query Frame = 1
Query: 1099 EGFLPPTQSMIDSIVKQCNFYFSDANVLKDLFILKKLKSNPGGWISLATVARFKQLVKLSNDDIDNVVYAMCYSDQVQISRDASSLRRRLPIPDWDPSIYIRSLFL-WNLPRICDSY----------EKLDQVFREEGRFV------VNVSRYIRADRNVPADLRKLVDKIPALGKYNCGVIEF 1599
            E + PP   +   I  Q   Y SD N+  D F+LK ++ N  G++SL  +  FK++ +L+  D    + A C S  ++++   + +RRR P+P+W   I    L L WN   I  S           E+L Q F E    +      +   R +R  + +PA+L++   K   LG+  C V+E+
Sbjct:   52 EAWTPPPSELKLKIAAQLEHYLSDENLEGDAFLLKHIQRNKMGYVSLKLMTSFKKIRELTR-DWRTTLAAACTSHHLEVNEAGTKVRRRTPVPEWLLCIPTTKLLLAWNFQDIISSTEVENSGSSGAEQLQQDFMETAMSIFGSHGTITSLRILRPGKEIPAELKRYTKKHTELGRKLCAVVEY 234          
BLAST of HTH La-type RNA-binding domain-containing protein vs. Ensembl Cavefish
Match: larp6b (la-related protein 6-like [Source:NCBI gene;Acc:103042034])

HSP 1 Score: 87.0409 bits (214), Expect = 2.037e-17
Identity = 53/184 (28.80%), Postives = 87/184 (47.28%), Query Frame = 1
Query: 1099 EGFLPPTQSMIDSIVKQCNFYFSDANVLKDLFILKKLKSNPGGWISLATVARFKQLVKLSNDDIDNVVYAMCYSDQVQISRDASSLRRRLPIPDWDPSIYIRSLFL-WNLPRICDSY----------EKLDQVFREEGRFV------VNVSRYIRADRNVPADLRKLVDKIPALGKYNCGVIEF 1599
            E + PP   +   I  Q   Y SD N+  D F+LK ++ N  G++SL  +  FK++ +L+  D    + A C S  ++++   + +RRR P+P+W   I    L L WN   I  S           E+L Q F E    +      +   R +R  + +PA+L++   K   LG+  C V+E+
Sbjct:  102 EAWTPPPSELKLKIAAQLEHYLSDENLEGDAFLLKHIQRNKMGYVSLKLMTSFKKIRELTR-DWRTTLAAACTSHHLEVNEAGTKVRRRTPVPEWLLCIPTTKLLLAWNFQDIISSTEVENSGSSGAEQLQQDFMETAMSIFGSHGTITSLRILRPGKEIPAELKRYTKKHTELGRKLCAVVEY 284          
BLAST of HTH La-type RNA-binding domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000042251.1 (la-related protein 6-like [Source:NCBI gene;Acc:103023834])

HSP 1 Score: 77.411 bits (189), Expect = 1.546e-14
Identity = 51/192 (26.56%), Postives = 94/192 (48.96%), Query Frame = 1
Query: 1105 FLPPTQSMIDSIVKQCNFYFSDANVLKDLFILKKLKSNPGGWISLATVARFKQLVKLSNDDIDNVVYAMCYSDQVQISRDASSLRRRLPIPDWD-PSIYIRSLFLWNLPRICDSYEKLDQVFREEGRFVVNVS-----------RYIRADRNVPADLRKLVDKIPALGKYNCGVIEFNSREAMLSAGEFIHL 1644
            ++PP  ++I  +V Q   Y SD N+ KD F+LK ++ N  G++++  +  FK++  L+  D     YA+ +S +++++ + + +RR+ P+PD     +  + L +WN   I DS    D          + ++           R  R  R +P +++K  D+ P L K    ++EF   E   SA  + HL
Sbjct:   25 WVPPNAALIKKMVSQIEHYLSDENLAKDAFLLKHVRRNKMGYVNIKLLTSFKKMKHLTK-DWRVTAYALHHSSKLEVNEEGNKVRRKDPVPDSVLAQVPSKLLLVWN---ITDSPAAEDTSVPHRSTMEMAIAMLEPFGSITTVRVNRPGRELPPEIQKYGDRYPELLKEESVLVEFEDLEGAGSA--YHHL 210          
BLAST of HTH La-type RNA-binding domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000047848.1 (la-related protein 6-like [Source:NCBI gene;Acc:103023834])

HSP 1 Score: 76.2554 bits (186), Expect = 4.106e-14
Identity = 51/192 (26.56%), Postives = 94/192 (48.96%), Query Frame = 1
Query: 1105 FLPPTQSMIDSIVKQCNFYFSDANVLKDLFILKKLKSNPGGWISLATVARFKQLVKLSNDDIDNVVYAMCYSDQVQISRDASSLRRRLPIPDWD-PSIYIRSLFLWNLPRICDSYEKLDQVFREEGRFVVNVS-----------RYIRADRNVPADLRKLVDKIPALGKYNCGVIEFNSREAMLSAGEFIHL 1644
            ++PP  ++I  +V Q   Y SD N+ KD F+LK ++ N  G++++  +  FK++  L+  D     YA+ +S +++++ + + +RR+ P+PD     +  + L +WN   I DS    D          + ++           R  R  R +P +++K  D+ P L K    ++EF   E   SA  + HL
Sbjct:   53 WVPPNAALIKKMVSQIEHYLSDENLAKDAFLLKHVRRNKMGYVNIKLLTSFKKMKHLTK-DWRVTAYALHHSSKLEVNEEGNKVRRKDPVPDSVLAQVPSKLLLVWN---ITDSPAAEDTSVPHRSTMEMAIAMLEPFGSITTVRVNRPGRELPPEIQKYGDRYPELLKEESVLVEFEDLEGAGSA--YHHL 238          
BLAST of HTH La-type RNA-binding domain-containing protein vs. Ensembl Cavefish
Match: larp6a (La ribonucleoprotein 6, translational regulator [Source:NCBI gene;Acc:103040761])

HSP 1 Score: 71.633 bits (174), Expect = 2.104e-12
Identity = 51/203 (25.12%), Postives = 94/203 (46.31%), Query Frame = 1
Query: 1096 KEGFLPPTQSMIDSIVKQCNFYFSDANVLKDLFILKKLKSNPGGWISLATVARFKQLVKLSNDDIDNVVYAMCYSDQVQISRDASSLRRRLPIPDW-DPSIYIRSLFLWNLPR----------------------ICDSYEKLDQVFREEGRFVVNVS-RYIRADRNVPADLRKLVDKIPALGKYNCGVIEFNSREAMLSAGE 1632
            +E + PP   +   +V Q  +Y SD N+  D F+LK ++ N  G++S+  +  FK++  L+  D     YA+  S+ ++++ +   +RRR  +P +   S+  R L L  L R                      +      ++ + +  G +    S R ++  +++PADL+KL  +   LG   C ++EF   EA + A E
Sbjct:  233 EESWQPPDPELTQKLVAQIEYYLSDENLEHDAFLLKHVRRNKLGFVSVKLLTSFKKVKHLTR-DWRTTAYALRQSNLLELNDEGRKVRRRTSVPVFASESLPSRMLLLSELQRWPELGMALAGGGGAGDGSPGGGVAQQERLMELLLKAFGVYGPIASVRVLKPGKDLPADLKKLSGRYSQLGSEECAIVEFEEVEAAVRAHE 434          
BLAST of HTH La-type RNA-binding domain-containing protein vs. Ensembl Sea Lamprey
Match: larp7 (La ribonucleoprotein 7, transcriptional regulator [Source:NCBI gene;Acc:334956])

HSP 1 Score: 56.9954 bits (136), Expect = 1.133e-8
Identity = 36/128 (28.12%), Postives = 71/128 (55.47%), Query Frame = 1
Query: 1126 MIDSIVKQCNFYFSDANVLKDLFILKKLKSNPGGWISLATVARFKQLVKLSNDDIDNVVYAMCYSDQVQISRDASSLRRRLPIPDWDPSIYIRSLFLWNLPRICDSYEKLDQVFREEGRFV-VNVSRY 1506
            ++  I +Q  F+F D N+ KD F+ + + ++P G++ L+ +  F ++  LS  DI+ +  A+  S Q+++S D   +RR  P+         R++++  LP    ++E L +VF   GR + V++ R+
Sbjct:   46 ILSEIRRQIEFWFGDTNLHKDKFLRQVVDASPDGFVPLSVLMSFNRMKTLST-DINIIRRAVSTSTQLEVSSDGLKIRRSSPLGPKPEDEDERTVYVERLPHGV-THEWLSRVFSPCGRVLYVSLPRF 171          
BLAST of HTH La-type RNA-binding domain-containing protein vs. Ensembl Yeast
Match: LHP1 (RNA binding protein required for maturation of tRNA and U6 snRNA; acts as a molecular chaperone for RNAs transcribed by polymerase III; homologous to human La (SS-B) autoantigen [Source:SGD;Acc:S000002209])

HSP 1 Score: 54.299 bits (129), Expect = 2.417e-8
Identity = 27/86 (31.40%), Postives = 51/86 (59.30%), Query Frame = 1
Query: 1117 TQSMIDSIVKQCNFYFSDANVLKDLFILKKLKSNPGGWISLATVARFKQLVKLSNDDIDNVVYAMCYSDQVQISRDASSLRRRLPI 1374
            T  ++D  +KQ  FYFS+ N   D F+    + N  GW+ ++T+A F ++ K     +D V+ A+  S+ +++S D  +++RR+P+
Sbjct:   26 TPEVLDRCLKQVEFYFSEFNFPYDRFLRTTAEKN-DGWVPISTIATFNRMKKYR--PVDKVIEALRSSEILEVSADGENVKRRVPL 108          
BLAST of HTH La-type RNA-binding domain-containing protein vs. Ensembl Nematostella
Match: EDO33058 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST95])

HSP 1 Score: 72.4034 bits (176), Expect = 4.549e-13
Identity = 39/131 (29.77%), Postives = 87/131 (66.41%), Query Frame = 1
Query: 1117 TQSMIDSIVKQCNFYFSDANVLKDLFILKKLKSNPGGWISLATVARFKQLVKLSNDDIDNVVYAMCYSDQVQISRDASSLRRRLPIPDWDPSIYIRSLFLWNLPRICDSYEKLDQVFREEGRFV-VNVSRY 1506
            T+ +++ + +Q +FYFSD+ +LKD F+ ++++++P G+++++T+A F ++ +++ DDI  V  AM  S Q++++ D + +RR  P+P    ++   ++++  LP   D ++ L +VF E G+ + V++ R+
Sbjct:   22 TKLLVNQLKEQIDFYFSDSALLKDRFLKQQIENHPDGYVAISTIASFNKIKQMT-DDIKLVKKAMKLSQQLELNEDGTMVRRMAPLPQ-PRNVDAETVYVEKLPFHAD-HDWLKKVFSEFGKVLYVSLPRF 149          
BLAST of HTH La-type RNA-binding domain-containing protein vs. Ensembl Nematostella
Match: EDO45578 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSK2])

HSP 1 Score: 65.4698 bits (158), Expect = 3.627e-11
Identity = 47/178 (26.40%), Postives = 86/178 (48.31%), Query Frame = 1
Query: 1105 FLPPTQSMIDSIVKQCNFYFSDANVLKDLFILKKLKSNPGGWISLATVARFKQLVKLSNDDIDNVVYAMCYSDQVQISRDASSLRRRLPIP----DWDPSIYIRSLFLWNLPRICDSYEKLDQVFREEGRFVVNVSRYIRADRNVPADLRKLVDKIPALGKYNCGVIEFNSREAMLSA 1626
            F PP   +   I  Q  FY SD N+ +D F+LK ++ N  G+++L  +  FK++  L+  D   V  ++  S  + ++ + + ++R  P+     D +P   + +  + N      S+E + ++F + G  V  + R IR  + +P DL++   K P    +   VIEF +  A   A
Sbjct:   73 FQPPNDELKARIKSQVEFYLSDDNLARDAFLLKHVRRNKEGYVNLKLITSFKKVKSLTK-DYRVVAESLKDSTMLSMNDENTKVKRNEPLRAELMDRNPGRTVVATNIEN-----PSFEHVSEMFSKCGEIV--LIRIIRGGKTIPPDLKEYESKFPENETF--AVIEFETMAAAARA 240          
BLAST of HTH La-type RNA-binding domain-containing protein vs. Ensembl Nematostella
Match: EDO45820 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRT7])

HSP 1 Score: 52.373 bits (124), Expect = 4.211e-7
Identity = 34/125 (27.20%), Postives = 66/125 (52.80%), Query Frame = 1
Query: 1138 IVKQCNFYFSDANVLKDLFILKKLKSNPGGWISLATVARFKQLVKLSNDDIDNVVYAM--CYSDQVQISRDASSLRRRLPIPDWDPSIYIR------SLFLWNLPRICDSYEKLDQVFREEGRFV 1488
            IVKQ  FYF D N+ +D F+ +K + +  GW++   +A F +L  +S DD++ +   M    SD +++S D + +RR    P  + +   R      ++++   P+   + ++L + F  +G+ V
Sbjct:   23 IVKQIEFYFGDKNLPRDKFLRQKTEEDD-GWVTFECLATFNRLKSMS-DDVNFLAKTMKKSSSDLIEVSEDLTKVRRTKSKPVEELTTEARQKAKAKTVYVKGFPKEA-TLDELQEYFEGKGKIV 144          
BLAST of HTH La-type RNA-binding domain-containing protein vs. Ensembl Medaka
Match: larp6a (la-related protein 6-like [Source:NCBI gene;Acc:101166706])

HSP 1 Score: 83.1889 bits (204), Expect = 3.220e-16
Identity = 53/200 (26.50%), Postives = 102/200 (51.00%), Query Frame = 1
Query: 1096 KEGFLPPTQSMIDSIVKQCNFYFSDANVLKDLFILKKLKSNPGGWISLATVARFKQLVKLSNDDIDNVVYAMCYSDQVQISRDASSLRRRLPIPDW-DPSIYIRSLFLWNLPRICD----------------SYEKLDQ-VFREEGRF-VVNVSRYIRADRNVPADLRKLVDKIPALGKYNCGVIEFNSREAMLSAGEFI 1638
            +E + PP   +I  +V Q  +Y SD N+  D F+LK ++ N  G++S+  +  FK++  L+  D     YA+ +S  ++++ +   +RR+  +P +   S+  R L L +L +  D                  E+L + + +E G F  ++  R ++  +++PADL++L  + P LG   C ++EF   EA + A + +
Sbjct:   85 EESWQPPDPELIQKLVAQIEYYLSDENLEHDAFLLKHVRRNKLGFVSVKLLTSFKKVKHLTR-DWRTTAYALKHSKMLELNEEGRKVRRKSAVPVFASESLPSRMLLLSDLQKWPDLAVLTKENGSGEGGATQQEQLMKLLLKEFGTFGAISSVRVLKPGKDLPADLKRLSGRYPQLGADECAIVEFEEVEAAVKANDAV 283          
BLAST of HTH La-type RNA-binding domain-containing protein vs. Planmine SMEST
Match: SMESG000000519.1 (SMESG000000519.1)

HSP 1 Score: 1390.17 bits (3597), Expect = 0.000e+0
Identity = 711/741 (95.95%), Postives = 719/741 (97.03%), Query Frame = 1
Query:   76 MLSLKRNLEETIHKLSLNLSVIGVYCLPDSWKSISLISQDLKNLNVNFYTAFIVPTNSLVFKNSCHICQINXXXXXXXXXXXXXXIPNDEVSGVINKLNACYPEIKTLSICQVNLRKDLICPLMSEQQKERVEIVEKLVDVVENYFSDEEIHKNKDILVSMNSNGWVPLTVIENRLCELIIVNTREIVDKLRNSQTLQLDTTEKYVRRKQATLPVTTEHRQVVVLDIPDTIKSMRQLPTYLQLDGDSGVEYFDYSIHSAIVTLQSRQDAIRLVDEVQISGKMKAKLLVPSIVADDSSNVILSLSDVMDVDKVLASLALKHEPAEQIHVMRLAPEELIYTFKEGFLPPTQSMIDSIVKQCNFYFSDANVLKDLFILKKLKSNPGGWISLATVARFKQLVKLSNDDIDNVVYAMCYSDQVQISRDASSLRRRLPIPDWDPSIYIRSLFLWNLPRICDSYEKLDQVFREEGRFVVNVSRYIRADRNVPADLRKLVDKIPALGKYNCGVIEFNSREAMLSAGEFIHLKWAAVKTFYLDAKEELPKPAVIVGKSSKSLPPPIPVSTFADNRVAALQAGTRIDPRFWQVARLLSAKKRNEMKIYTNDCDNGGVSRREIDTKLSKFNINNIREFPALGGSSSGTANKXXXXXXXXXXXXXXXXXXXXXXXXXNKSGRKMSPLKPINTNTEIDRSATAANEEEIGMRNRAAKSDSKGKKWRYRKNRSKSKPLAATNTENEGAVAAAVIG 2298
            MLSLKRNLEETI KLSLNLSVIGVYCLPDSWKSISLISQDLKNLNVNFYTAFIVPTNSLVFKNSCHICQINYKS+YVYKYYLSLSIPNDEVSGVINKLNACYPEIKTLSICQVNLRKDLICPLMSEQQKERVEIVEKLVDVVENYFSDEEIHKNKDILVSMNSNGWVPLTVIEN+LCELIIVNTREIV+KLRNSQTLQLDTTEKYVRRKQATLPVT EHRQVVVLDIPDTIKSMRQLPTYLQLDGDSGVEYFDYSIHSAIVTLQSRQDAIRLVDEVQISGKMKAKLLVPSIVADDSSNVILSLSDVMDVDKVLASLALKHEP EQIHVMRLAPEELIYTFK GFL PTQSMIDSIVKQCNFYFSDANVLKDLFILKKLKSNPGGWISLATVARFKQLVKLSNDDIDNVVYAMCYSDQVQISRDASSLRRRLPIPDWDPSIYIRSLFLWNLPRICDSYEKLDQVFREEGRFVVNVSRYIRADRNVPADLRKLVDKIPALGKYNCGVIEFNSREAMLSAGEFIHLKWAAVKTF+LDAKEELPKPAVIVGKSSKSLPPPIPVSTFADNRVAALQAGTRIDPRFWQVARLLSAKKRNEMKIYTNDCDNGGVSRREIDTKLSKFNINNIREFPALGGSSSGTANK     + +    RGT TRGSGTANRNKSGRKMSPLKPINTNTEIDRSATAA EEEIGMRNR +K DSK KKWRYR NRSKSKP+ ATNTENEGAVAAAVIG
Sbjct:    1 MLSLKRNLEETIDKLSLNLSVIGVYCLPDSWKSISLISQDLKNLNVNFYTAFIVPTNSLVFKNSCHICQINYKSIYVYKYYLSLSIPNDEVSGVINKLNACYPEIKTLSICQVNLRKDLICPLMSEQQKERVEIVEKLVDVVENYFSDEEIHKNKDILVSMNSNGWVPLTVIENKLCELIIVNTREIVEKLRNSQTLQLDTTEKYVRRKQATLPVTAEHRQVVVLDIPDTIKSMRQLPTYLQLDGDSGVEYFDYSIHSAIVTLQSRQDAIRLVDEVQISGKMKAKLLVPSIVADDSSNVILSLSDVMDVDKVLASLALKHEPTEQIHVMRLAPEELIYTFKPGFLAPTQSMIDSIVKQCNFYFSDANVLKDLFILKKLKSNPGGWISLATVARFKQLVKLSNDDIDNVVYAMCYSDQVQISRDASSLRRRLPIPDWDPSIYIRSLFLWNLPRICDSYEKLDQVFREEGRFVVNVSRYIRADRNVPADLRKLVDKIPALGKYNCGVIEFNSREAMLSAGEFIHLKWAAVKTFFLDAKEELPKPAVIVGKSSKSLPPPIPVSTFADNRVAALQAGTRIDPRFWQVARLLSAKKRNEMKIYTNDCDNGGVSRREIDTKLSKFNINNIREFPALGGSSSGTANK----VSGSGKANRGTTTRGSGTANRNKSGRKMSPLKPINTNTEIDRSATAATEEEIGMRNRPSKFDSKRKKWRYRNNRSKSKPIVATNTENEGAVAAAVIG 737          
The following BLAST results are available for this feature:
BLAST of HTH La-type RNA-binding domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LARP64.304e-1828.80La ribonucleoprotein 6, translational regulator [S... [more]
LARP73.421e-621.53La ribonucleoprotein 7, transcriptional regulator ... [more]
LARP75.260e-625.29La ribonucleoprotein 7, transcriptional regulator ... [more]
LARP75.672e-621.53La ribonucleoprotein 7, transcriptional regulator ... [more]
LARP75.672e-621.53La ribonucleoprotein 7, transcriptional regulator ... [more]
back to top
BLAST of HTH La-type RNA-binding domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HTH La-type RNA-binding domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Achl4.588e-1425.93gene:FBgn0033936 transcript:FBtr0345529[more]
Achl4.588e-1425.93gene:FBgn0033936 transcript:FBtr0087488[more]
La1.281e-1033.96gene:FBgn0011638 transcript:FBtr0081374[more]
Larp76.661e-727.13gene:FBgn0260771 transcript:FBtr0301275[more]
back to top
BLAST of HTH La-type RNA-binding domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
larp6a1.988e-1427.00La ribonucleoprotein 6, translational regulator a ... [more]
larp6a2.173e-1427.00La ribonucleoprotein 6, translational regulator a ... [more]
larp6b4.015e-1426.96La ribonucleoprotein 6, translational regulator b ... [more]
larp6b7.600e-726.11La ribonucleoprotein 6, translational regulator b ... [more]
larp71.650e-623.85La ribonucleoprotein 7, transcriptional regulator ... [more]
back to top
BLAST of HTH La-type RNA-binding domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
larp6-like.16.349e-1828.13acheron [Source:NCBI gene;Acc:780092][more]
shcbp12.034e-1626.15SHC SH2-domain binding protein 1 [Source:Xenbase;A... [more]
shcbp17.284e-1627.13SHC SH2-domain binding protein 1 [Source:Xenbase;A... [more]
ybx31.747e-826.72Y-box binding protein 3 [Source:Xenbase;Acc:XB-GEN... [more]
ybx31.923e-826.72Y-box binding protein 3 [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of HTH La-type RNA-binding domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Larp61.205e-1728.80La ribonucleoprotein domain family, member 6 [Sour... [more]
Larp71.397e-621.90La ribonucleoprotein domain family, member 7 [Sour... [more]
back to top
BLAST of HTH La-type RNA-binding domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9BRS8|LARP6_HUMAN2.067e-1728.80La-related protein 6 OS=Homo sapiens OX=9606 GN=LA... [more]
sp|Q8BN59|LARP6_MOUSE8.432e-1728.80La-related protein 6 OS=Mus musculus OX=10090 GN=L... [more]
sp|Q94A38|LRP6A_ARATH4.800e-1030.47La-related protein 6A OS=Arabidopsis thaliana OX=3... [more]
sp|P40796|LA_DROME1.284e-933.96La protein homolog OS=Drosophila melanogaster OX=7... [more]
sp|Q28G87|LARP7_XENTR1.569e-726.72La-related protein 7 OS=Xenopus tropicalis OX=8364... [more]
back to top
BLAST of HTH La-type RNA-binding domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504XAT42.309e-3138.38Lupus la ribonucleoprotein OS=Fasciola gigantica O... [more]
H9LHW94.146e-2934.64La autoantigen-like protein (Fragment) OS=Crassost... [more]
A0A3S5C6R06.110e-2937.85HTH La-type RNA-binding domain-containing protein ... [more]
A0A0R3SFJ24.045e-2839.02HTH La-type RNA-binding domain-containing protein ... [more]
A0A564YQ707.432e-2839.02HTH La-type RNA-binding domain-containing protein ... [more]
back to top
BLAST of HTH La-type RNA-binding domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
larp6b1.501e-1728.80la-related protein 6-like [Source:NCBI gene;Acc:10... [more]
larp6b2.037e-1728.80la-related protein 6-like [Source:NCBI gene;Acc:10... [more]
ENSAMXT00000042251.11.546e-1426.56la-related protein 6-like [Source:NCBI gene;Acc:10... [more]
ENSAMXT00000047848.14.106e-1426.56la-related protein 6-like [Source:NCBI gene;Acc:10... [more]
larp6a2.104e-1225.12La ribonucleoprotein 6, translational regulator [S... [more]
back to top
BLAST of HTH La-type RNA-binding domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
larp71.133e-828.13La ribonucleoprotein 7, transcriptional regulator ... [more]
back to top
BLAST of HTH La-type RNA-binding domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
LHP12.417e-831.40RNA binding protein required for maturation of tRN... [more]
back to top
BLAST of HTH La-type RNA-binding domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO330584.549e-1329.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO455783.627e-1126.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458204.211e-727.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of HTH La-type RNA-binding domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
larp6a3.220e-1626.50la-related protein 6-like [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of HTH La-type RNA-binding domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000000519.10.000e+095.95SMESG000000519.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011104 ID=SMED30011104|Name=HTH La-type RNA-binding domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2389bp
GTTTAAATAAGACTAAAACTTTATTCATTTTTGTTTAAATTTTCAACTGC
TTAAATTTTATTTCTAGTAGTTATTATGCTATCTCTAAAACGTAATTTGG
AAGAAACTATTCATAAGCTCAGTTTAAACCTTAGTGTTATTGGAGTCTAT
TGTCTGCCTGATTCATGGAAATCAATTTCATTAATTTCCCAAGATTTAAA
AAATTTAAATGTAAATTTTTATACAGCATTCATCGTTCCAACAAATTCTT
TGGTTTTCAAAAATTCTTGCCATATCTGTCAAATTAACTACAAATCTGTT
TATGTTTATAAATACTATTTATCTTTATCCATACCAAATGATGAAGTATC
GGGCGTTATTAATAAGCTTAATGCATGTTATCCGGAGATTAAAACCCTTT
CAATATGCCAAGTAAATTTGCGAAAAGATTTAATTTGTCCGTTGATGAGT
GAGCAGCAAAAAGAAAGAGTAGAAATCGTTGAAAAGTTGGTTGATGTAGT
TGAGAATTATTTTTCCGATGAAGAAATCCATAAAAATAAAGATATTTTGG
TTTCAATGAATAGCAATGGTTGGGTTCCATTAACTGTAATAGAGAACAGA
TTATGTGAACTGATTATCGTAAATACGCGGGAAATCGTTGATAAATTAAG
AAATTCTCAAACATTGCAATTAGACACAACAGAAAAATACGTCCGACGCA
AGCAAGCAACATTGCCAGTCACCACGGAACATCGGCAAGTTGTCGTGCTT
GACATTCCCGACACGATAAAATCGATGAGACAATTGCCCACATATCTACA
GTTGGATGGGGATTCGGGCGTGGAATATTTCGATTATTCCATCCATTCAG
CGATTGTCACACTGCAATCGAGGCAAGATGCGATACGATTGGTCGATGAA
GTTCAAATAAGCGGGAAAATGAAAGCGAAACTATTGGTTCCCAGCATTGT
TGCGGACGACAGCAGCAACGTGATTCTGTCGCTGTCGGATGTGATGGACG
TCGATAAGGTGCTTGCAAGTCTGGCACTGAAGCACGAGCCGGCGGAACAA
ATCCACGTGATGCGGCTGGCACCAGAGGAATTGATTTACACATTCAAGGA
GGGATTTCTCCCTCCGACACAATCAATGATCGACAGCATCGTGAAGCAGT
GCAATTTCTATTTCTCCGACGCCAACGTGCTCAAGGACCTCTTCATACTG
AAAAAGCTCAAATCGAATCCCGGTGGCTGGATCAGCCTAGCAACCGTTGC
TAGGTTCAAGCAGCTCGTGAAACTGTCCAATGACGACATCGACAATGTGG
TGTACGCCATGTGCTACTCGGATCAGGTGCAGATCAGCAGGGACGCCAGC
AGTCTCCGTCGGCGTCTCCCGATACCCGATTGGGACCCTTCCATCTACAT
CCGGAGCTTGTTTCTATGGAATTTGCCACGGATTTGCGATTCCTATGAGA
AACTTGACCAAGTGTTCCGAGAGGAAGGCCGATTCGTTGTCAATGTATCC
CGTTACATCCGGGCCGATCGCAACGTGCCGGCCGATCTCAGGAAACTTGT
CGACAAGATTCCAGCGCTCGGTAAATATAATTGCGGCGTTATCGAGTTCA
ATTCGAGAGAGGCGATGTTGTCAGCCGGGGAATTTATCCACCTGAAATGG
GCAGCTGTCAAAACCTTCTATTTAGATGCGAAAGAGGAACTCCCGAAACC
GGCCGTAATTGTCGGCAAATCATCAAAATCTCTGCCTCCGCCAATTCCCG
TATCGACATTTGCTGACAATCGCGTCGCGGCCCTTCAAGCGGGAACTCGT
ATCGATCCCCGATTTTGGCAAGTTGCCCGATTGTTATCAGCGAAAAAACG
AAACGAGATGAAAATTTACACGAATGATTGCGACAATGGCGGAGTTTCAA
GACGGGAAATCGATACCAAATTGAGTAAATTTAATATCAATAATATTAGG
GAGTTCCCAGCGTTGGGGGGCAGCAGTAGTGGCACAGCCAATAAGGTTAG
CGGTAGCGGCACAGTCAATAGAGGCAACGGTAGAGGCACCGCCACTAGGG
GCAGCGGCACAGCCAATAGGAACAAGTCTGGCAGGAAAATGTCTCCTTTG
AAGCCGATCAATACCAATACGGAAATCGATAGATCAGCAACAGCAGCTAA
CGAAGAAGAGATCGGAATGAGAAATCGCGCAGCAAAATCTGATTCTAAAG
GGAAAAAATGGAGATATCGCAAAAATAGAAGCAAATCGAAACCATTAGCT
GCGACTAATACCGAGAATGAAGGAGCGGTGGCTGCGGCTGTTATTGGTTG
ATTTAAGCACTCCGGGGCGATTTGGGCGAGCATTTATTATTATTATTATT
GTTGATGTTGTCCATTTCATATATATATATATATATATA
back to top

protein sequence of SMED30011104-orf-1

>SMED30011104-orf-1 ID=SMED30011104-orf-1|Name=SMED30011104-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=742bp
MLSLKRNLEETIHKLSLNLSVIGVYCLPDSWKSISLISQDLKNLNVNFYT
AFIVPTNSLVFKNSCHICQINYKSVYVYKYYLSLSIPNDEVSGVINKLNA
CYPEIKTLSICQVNLRKDLICPLMSEQQKERVEIVEKLVDVVENYFSDEE
IHKNKDILVSMNSNGWVPLTVIENRLCELIIVNTREIVDKLRNSQTLQLD
TTEKYVRRKQATLPVTTEHRQVVVLDIPDTIKSMRQLPTYLQLDGDSGVE
YFDYSIHSAIVTLQSRQDAIRLVDEVQISGKMKAKLLVPSIVADDSSNVI
LSLSDVMDVDKVLASLALKHEPAEQIHVMRLAPEELIYTFKEGFLPPTQS
MIDSIVKQCNFYFSDANVLKDLFILKKLKSNPGGWISLATVARFKQLVKL
SNDDIDNVVYAMCYSDQVQISRDASSLRRRLPIPDWDPSIYIRSLFLWNL
PRICDSYEKLDQVFREEGRFVVNVSRYIRADRNVPADLRKLVDKIPALGK
YNCGVIEFNSREAMLSAGEFIHLKWAAVKTFYLDAKEELPKPAVIVGKSS
KSLPPPIPVSTFADNRVAALQAGTRIDPRFWQVARLLSAKKRNEMKIYTN
DCDNGGVSRREIDTKLSKFNINNIREFPALGGSSSGTANKVSGSGTVNRG
NGRGTATRGSGTANRNKSGRKMSPLKPINTNTEIDRSATAANEEEIGMRN
RAAKSDSKGKKWRYRKNRSKSKPLAATNTENEGAVAAAVIG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:1990904ribonucleoprotein complex
GO:0005634nucleus
GO:0030529intracellular ribonucleoprotein complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036388WH-like_DNA-bd_sf
IPR036390WH_DNA-bd_sf
IPR002344Lupus_La
IPR006630La_HTH
IPR011991WHTH_DNA-bd_dom
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
Vocabulary: biological process
TermDefinition
GO:0006396RNA processing
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002344Lupus La proteinPRINTSPR00302LUPUSLAcoord: 384..399
score: 36.36
coord: 416..429
score: 29.87
coord: 358..375
score: 40.91
IPR006630La-type HTH domainSMARTSM00715lacoord: 349..430
e-value: 3.0E-15
score: 66.6
coord: 132..209
e-value: 3.5E-5
score: 16.0
IPR006630La-type HTH domainPFAMPF05383Lacoord: 355..412
e-value: 1.2E-14
score: 54.0
IPR006630La-type HTH domainPROSITEPS50961HTH_LAcoord: 128..217
score: 13.082
IPR006630La-type HTH domainPROSITEPS50961HTH_LAcoord: 345..437
score: 19.721
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 124..218
e-value: 1.3E-9
score: 39.5
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 346..434
e-value: 4.9E-19
score: 69.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 685..699
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 634..667
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 700..714
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 685..717
NoneNo IPR availablePANTHERPTHR22792LUPUS LA PROTEIN-RELATEDcoord: 344..647
coord: 131..233
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 133..210
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 346..437