Centrosomal protein 131

Overview
NameCentrosomal protein 131
Smed IDSMED30011096
Length (bp)3847
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Centrosomal protein 131 (SMED30011096) t-SNE clustered cells

Violin plots show distribution of expression levels for Centrosomal protein 131 (SMED30011096) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Centrosomal protein 131 (SMED30011096) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Centrosomal protein 131 (SMED30011096) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011096

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30011096SMESG000051138.1 SmedASXL_012210SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30011096SMESG000051138.1 dd_Smed_v4_13976_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30011096SMESG000051138.1 dd_Smed_v4_13976_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30011096SMESG000051138.1 dd_Smed_v4_13976_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30011096SMESG000051138.1 dd_Smed_v4_13976_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30011096SMESG000051138.1 dd_Smed_v4_13976_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30011096SMESG000051138.1 dd_Smed_v4_13976_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30011096SMESG000051138.1 dd_Smed_v4_13976_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30011096SMESG000051138.1 dd_Smed_v6_13976_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30011096SMESG000051138.1 dd_Smed_v4_13976_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Centrosomal protein 131 vs. Ensembl Human
Match: CEP131 (centrosomal protein 131 [Source:HGNC Symbol;Acc:HGNC:29511])

HSP 1 Score: 370.933 bits (951), Expect = 5.822e-109
Identity = 234/594 (39.39%), Postives = 384/594 (64.65%), Query Frame = 3
Query: 1644 ISDSKMNSILQFLNASEVVDDISELEGRRFTDFPTKHWNVYDVKELEENTQTAVNEVSTKVMTMKLELEERQRSVEMLQKALQQQRELTVRQVKETQKDMEKRMEVQKDEYESALQRNHTFIDQLISKNELLQDKCNKLVVEMKEKTQKYXXXXXXXXXXXXXXLKKVEAKHLAAEKLRREKWEAEKTKLIKEMTIKGMETEIAQLIANHKQELRKMKQYYENEIIQTGENSYEKYNRQVEELRKQLYKEKEEALQKENSIIKERFDQEMQRQIQILESQRKQLYQEISDERDRLNIMGNKQKAEIENLRKQLEYKEDKVGVSMKLEHQHKLEEMQRKFDTEVRELKTQTELEKQIWIETNNKRNEAWMLSKEQEIKNEMKKNRDSEIEKVILKLEDDNTQSKQEIESSFGNKLKRAKDKYEAEIKELELSERQTKEKYNQIRGXXXXXXXXXXXXKIMIRQKEKEMDEVKQLYETLNRERDHVSDIIRQEFADRLVTTEEENRKLKREISELRAKINLMQTNHNEDLERIQLNHQSDITEVHNKVKEAIKRKEENMAELKSQYQNETSLWQQKLAAAEKRSNHLESLLEQQRK 3425
            +S++K+ SI+ FL       D  E  G+   D   + W    V E         +EVST VM +KLE+EE+++++ +LQ+AL QQR+LT R+VKET+K + ++++ Q++ YE+ +QR+  FIDQLI   ++L +KC  +V E+K++ Q+  E++   Q  + +E+KK++    A EK RREKW +EKTK IKE+T++G+E EI +LIA HKQE+R++K  +E E++Q+ E + ++  RQ EELR+QL +EKE   Q+E    ++RF Q ++++   L+ QR++LY E+++ER+RL     +Q+AE+E LR+QLE     +  +++ E +   EE +R+   E+  LK Q ELE+Q W     ++ EAW+L++EQE++ E++K RD EIE VI +LE D   +K+E E +  +++KR +DKYEAE+ ELE SER+ +E+ ++++G+  E E E+  L+ ++RQKE+ +++ + + E L+ ER +++ +IRQEF DRL  +EEE R+ K E++ L+A+  L                  ++ EVH +VK A+ RKEE ++ L++Q++           AA KR++HLE LLEQ R+
Sbjct:  521 LSEAKLQSIMSFL-------DEMEKSGQDQLDSQQEGW----VPEAGPGPLELGSEVSTSVMRLKLEVEEKKQAMLLLQRALAQQRDLTARRVKETEKALSRQLQRQREHYEATIQRHLAFIDQLIEDKKVLSEKCEAVVAELKQEDQRCTERVAQAQAQHELEIKKLKELMSATEKARREKWISEKTKKIKEVTVRGLEPEIQKLIARHKQEVRRLKSLHEAELLQSDERASQRCLRQAEELREQLEREKEALGQQERERARQRFQQHLEQEQWALQQQRQRLYSEVAEERERLGQQAARQRAELEELRQQLEESSSALTRALRAEFEKGREEQERRHQMELNTLKQQLELERQAWEAGRTRKEEAWLLNREQELREEIRKGRDKEIELVIHRLEADMALAKEESEKAAESRIKRLRDKYEAELSELEQSERKLQERCSELKGQLGEAEGENLRLQGLVRQKERALEDAQAVNEQLSSERSNLAQVIRQEFEDRLAASEEETRQAKAELATLQARQQL------------------ELEEVHRRVKTALARKEEAVSSLRTQHE-----------AAVKRADHLEELLEQHRR 1074          
BLAST of Centrosomal protein 131 vs. Ensembl Human
Match: CEP131 (centrosomal protein 131 [Source:HGNC Symbol;Acc:HGNC:29511])

HSP 1 Score: 370.933 bits (951), Expect = 6.459e-109
Identity = 234/594 (39.39%), Postives = 384/594 (64.65%), Query Frame = 3
Query: 1644 ISDSKMNSILQFLNASEVVDDISELEGRRFTDFPTKHWNVYDVKELEENTQTAVNEVSTKVMTMKLELEERQRSVEMLQKALQQQRELTVRQVKETQKDMEKRMEVQKDEYESALQRNHTFIDQLISKNELLQDKCNKLVVEMKEKTQKYXXXXXXXXXXXXXXLKKVEAKHLAAEKLRREKWEAEKTKLIKEMTIKGMETEIAQLIANHKQELRKMKQYYENEIIQTGENSYEKYNRQVEELRKQLYKEKEEALQKENSIIKERFDQEMQRQIQILESQRKQLYQEISDERDRLNIMGNKQKAEIENLRKQLEYKEDKVGVSMKLEHQHKLEEMQRKFDTEVRELKTQTELEKQIWIETNNKRNEAWMLSKEQEIKNEMKKNRDSEIEKVILKLEDDNTQSKQEIESSFGNKLKRAKDKYEAEIKELELSERQTKEKYNQIRGXXXXXXXXXXXXKIMIRQKEKEMDEVKQLYETLNRERDHVSDIIRQEFADRLVTTEEENRKLKREISELRAKINLMQTNHNEDLERIQLNHQSDITEVHNKVKEAIKRKEENMAELKSQYQNETSLWQQKLAAAEKRSNHLESLLEQQRK 3425
            +S++K+ SI+ FL       D  E  G+   D   + W    V E         +EVST VM +KLE+EE+++++ +LQ+AL QQR+LT R+VKET+K + ++++ Q++ YE+ +QR+  FIDQLI   ++L +KC  +V E+K++ Q+  E++   Q  + +E+KK++    A EK RREKW +EKTK IKE+T++G+E EI +LIA HKQE+R++K  +E E++Q+ E + ++  RQ EELR+QL +EKE   Q+E    ++RF Q ++++   L+ QR++LY E+++ER+RL     +Q+AE+E LR+QLE     +  +++ E +   EE +R+   E+  LK Q ELE+Q W     ++ EAW+L++EQE++ E++K RD EIE VI +LE D   +K+E E +  +++KR +DKYEAE+ ELE SER+ +E+ ++++G+  E E E+  L+ ++RQKE+ +++ + + E L+ ER +++ +IRQEF DRL  +EEE R+ K E++ L+A+  L                  ++ EVH +VK A+ RKEE ++ L++Q++           AA KR++HLE LLEQ R+
Sbjct:  524 LSEAKLQSIMSFL-------DEMEKSGQDQLDSQQEGW----VPEAGPGPLELGSEVSTSVMRLKLEVEEKKQAMLLLQRALAQQRDLTARRVKETEKALSRQLQRQREHYEATIQRHLAFIDQLIEDKKVLSEKCEAVVAELKQEDQRCTERVAQAQAQHELEIKKLKELMSATEKARREKWISEKTKKIKEVTVRGLEPEIQKLIARHKQEVRRLKSLHEAELLQSDERASQRCLRQAEELREQLEREKEALGQQERERARQRFQQHLEQEQWALQQQRQRLYSEVAEERERLGQQAARQRAELEELRQQLEESSSALTRALRAEFEKGREEQERRHQMELNTLKQQLELERQAWEAGRTRKEEAWLLNREQELREEIRKGRDKEIELVIHRLEADMALAKEESEKAAESRIKRLRDKYEAELSELEQSERKLQERCSELKGQLGEAEGENLRLQGLVRQKERALEDAQAVNEQLSSERSNLAQVIRQEFEDRLAASEEETRQAKAELATLQARQQL------------------ELEEVHRRVKTALARKEEAVSSLRTQHE-----------AAVKRADHLEELLEQHRR 1077          
BLAST of Centrosomal protein 131 vs. Ensembl Human
Match: CEP131 (centrosomal protein 131 [Source:HGNC Symbol;Acc:HGNC:29511])

HSP 1 Score: 349.747 bits (896), Expect = 5.411e-107
Identity = 221/545 (40.55%), Postives = 364/545 (66.79%), Query Frame = 3
Query: 1806 NEVSTKVMTMKLELEERQRSVEMLQKALQQQRELTVRQVKETQKDMEKRMEVQKDEYESALQRNHTFIDQLISKNELLQDKCNKLVVEMKEKTQKYXXXXXXXXXXXXXXLKKVEAKHLAAEKLRREKWEAEKTKLIKEMTIKGMETEIAQLIANHKQELRKMKQYYENEIIQTGENSYEKYNRQVEELRKQLYKEKEEALQKENSIIKERFDQEMQRQIQILESQRKQLYQEISDERDRLNIMGNKQKAEIENLRKQLEYKEDKVGVSMKLEHQHKLEEMQRKFDTEVRELKTQTELEKQIWIETNNKR-----NEAWMLSKEQEIKNEMKKNRDSEIEKVILKLEDDNTQSKQEIESSFGNKLKRAKDKYEAEIKELELSERQTKEKYNQIRGXXXXXXXXXXXXKIMIRQKEKEMDEVKQLYETLNRERDHVSDIIRQEFADRLVTTEEENRKLKREISELRAKINLMQTNHNEDLERIQLNHQSDITEVHNKVKEAIKRKEENMAELKSQYQNETSLWQQKLAAAEKRSNHLESLLEQQRK 3425
            +EVST VM +KLE+EE+++++ +LQ+AL QQR+LT R+VKET+K + ++++ Q++ YE+ +QR+  FIDQLI   ++L +KC  +V E+K++ Q+  E++   Q  + +E+KK++    A EK RREKW +EKTK IKE+T++G+E EI +LIA HKQE+R++K  +E E++Q+ E + ++  RQ EELR+QL +EKE   Q+E    ++RF Q ++++   L+ QR++LY E+++ER+RL     +Q+AE+E LR+QLE     +  +++ E +   EE +R+   E+  LK Q ELE+Q W     ++      EAW+L++EQE++ E++K RD EIE VI +LE D   +K+E E +  +++KR +DKYEAE+ ELE SER+ +E+ ++++G+  E E E+  L+ ++RQKE+ +++ + + E L+ ER +++ +IRQEF DRL  +EEE R+ K E++ L+A+  L                  ++ EVH +VK A+ RKEE ++ L++Q++           AA KR++HLE LLEQ R+
Sbjct:    3 SEVSTSVMRLKLEVEEKKQAMLLLQRALAQQRDLTARRVKETEKALSRQLQRQREHYEATIQRHLAFIDQLIEDKKVLSEKCEAVVAELKQEDQRCTERVAQAQAQHELEIKKLKELMSATEKARREKWISEKTKKIKEVTVRGLEPEIQKLIARHKQEVRRLKSLHEAELLQSDERASQRCLRQAEELREQLEREKEALGQQERERARQRFQQHLEQEQWALQQQRQRLYSEVAEERERLGQQAARQRAELEELRQQLEESSSALTRALRAEFEKGREEQERRHQMELNTLKQQLELERQAWEAGRTRKERMSPQEAWLLNREQELREEIRKGRDKEIELVIHRLEADMALAKEESEKAAESRIKRLRDKYEAELSELEQSERKLQERCSELKGQLGEAEGENLRLQGLVRQKERALEDAQAVNEQLSSERSNLAQVIRQEFEDRLAASEEETRQAKAELATLQARQQL------------------ELEEVHRRVKTALARKEEAVSSLRTQHE-----------AAVKRADHLEELLEQHRR 518          
BLAST of Centrosomal protein 131 vs. Ensembl Human
Match: CEP131 (centrosomal protein 131 [Source:HGNC Symbol;Acc:HGNC:29511])

HSP 1 Score: 310.842 bits (795), Expect = 5.061e-88
Identity = 222/594 (37.37%), Postives = 359/594 (60.44%), Query Frame = 3
Query: 1644 ISDSKMNSILQFLNASEVVDDISELEGRRFTDFPTKHWNVYDVKELEENTQTAVNEVSTKVMTMKLELEERQRSVEMLQKALQQQRELTVRQVKETQKDMEKRMEVQKDEYESALQRNHTFIDQLISKNELLQDKCNKLVVEMKEKTQKYXXXXXXXXXXXXXXLKKVEAKHLAAEKLRREKWEAEKTKLIKEMTIKGMETEIAQLIANHKQELRKMKQYYENEIIQTGENSYEKYNRQVEELRKQLYKEKEEALQKENSIIKERFDQEMQRQIQILESQRKQLYQEISDERDRLNIMGNKQKAEIENLRKQLEYKEDKVGVSMKLEHQHKLEEMQRKFDTEVRELKTQTELEKQIWIETNNKRNEAWMLSKEQEIKNEMKKNRDSEIEKVILKLEDDNTQSKQEIESSFGNKLKRAKDKYEAEIKELELSERQTKEKYNQIRGXXXXXXXXXXXXKIMIRQKEKEMDEVKQLYETLNRERDHVSDIIRQEFADRLVTTEEENRKLKREISELRAKINLMQTNHNEDLERIQLNHQSDITEVHNKVKEAIKRKEENMAELKSQYQNETSLWQQKLAAAEKRSNHLESLLEQQRK 3425
            +S++K+ SI+ FL       D  E  G+   D   + W    V E         +EVST VM +KLE+EE+++++ +LQ+AL QQR+LT R+VKET+K + ++++ Q++ YE+ +QR+  FIDQLI   ++L +KC  +V E+K++ Q+  E++   Q  + +E+KK++    A EK RREKW +EKTK IKE+T++G+E EI +LIA HKQE+R++K  +E E++Q+ E + ++  RQ EELR+QL +EKE       ++ ++  ++  QRQ   LE  R+QL +  S        +    +AE E  R                      EE +R+   E+  LK Q ELE+Q W     ++ EAW+L++EQE++ E++K RD EIE VI +LE D   +K+E E +  +++KR +DKYEAE+ ELE SER+ +E+ ++++G+  E E E+  L+ ++RQKE+ +++ + + E L+ ER +++ +IRQEF DRL  +EEE R+ K E++ L+A+                   Q ++ EVH +VK A+ RKEE ++ L++Q++           AA KR++HLE LLEQ R+
Sbjct:  521 LSEAKLQSIMSFL-------DEMEKSGQDQLDSQQEGW----VPEAGPGPLELGSEVSTSVMRLKLEVEEKKQAMLLLQRALAQQRDLTARRVKETEKALSRQLQRQREHYEATIQRHLAFIDQLIEDKKVLSEKCEAVVAELKQEDQRCTERVAQAQAQHELEIKKLKELMSATEKARREKWISEKTKKIKEVTVRGLEPEIQKLIARHKQEVRRLKSLHEAELLQSDERASQRCLRQAEELREQLEREKE-------ALGQQERERARQRQRAELEELRQQLEESSS-------ALTRALRAEFEKGR----------------------EEQERRHQMELNTLKQQLELERQAWEAGRTRKEEAWLLNREQELREEIRKGRDKEIELVIHRLEADMALAKEESEKAAESRIKRLRDKYEAELSELEQSERKLQERCSELKGQLGEAEGENLRLQGLVRQKERALEDAQAVNEQLSSERSNLAQVIRQEFEDRLAASEEETRQAKAELATLQAR------------------QQLELEEVHRRVKTALARKEEAVSSLRTQHE-----------AAVKRADHLEELLEQHRR 1038          
BLAST of Centrosomal protein 131 vs. Ensembl Human
Match: CEP131 (centrosomal protein 131 [Source:HGNC Symbol;Acc:HGNC:29511])

HSP 1 Score: 310.842 bits (795), Expect = 5.184e-88
Identity = 222/594 (37.37%), Postives = 359/594 (60.44%), Query Frame = 3
Query: 1644 ISDSKMNSILQFLNASEVVDDISELEGRRFTDFPTKHWNVYDVKELEENTQTAVNEVSTKVMTMKLELEERQRSVEMLQKALQQQRELTVRQVKETQKDMEKRMEVQKDEYESALQRNHTFIDQLISKNELLQDKCNKLVVEMKEKTQKYXXXXXXXXXXXXXXLKKVEAKHLAAEKLRREKWEAEKTKLIKEMTIKGMETEIAQLIANHKQELRKMKQYYENEIIQTGENSYEKYNRQVEELRKQLYKEKEEALQKENSIIKERFDQEMQRQIQILESQRKQLYQEISDERDRLNIMGNKQKAEIENLRKQLEYKEDKVGVSMKLEHQHKLEEMQRKFDTEVRELKTQTELEKQIWIETNNKRNEAWMLSKEQEIKNEMKKNRDSEIEKVILKLEDDNTQSKQEIESSFGNKLKRAKDKYEAEIKELELSERQTKEKYNQIRGXXXXXXXXXXXXKIMIRQKEKEMDEVKQLYETLNRERDHVSDIIRQEFADRLVTTEEENRKLKREISELRAKINLMQTNHNEDLERIQLNHQSDITEVHNKVKEAIKRKEENMAELKSQYQNETSLWQQKLAAAEKRSNHLESLLEQQRK 3425
            +S++K+ SI+ FL       D  E  G+   D   + W    V E         +EVST VM +KLE+EE+++++ +LQ+AL QQR+LT R+VKET+K + ++++ Q++ YE+ +QR+  FIDQLI   ++L +KC  +V E+K++ Q+  E++   Q  + +E+KK++    A EK RREKW +EKTK IKE+T++G+E EI +LIA HKQE+R++K  +E E++Q+ E + ++  RQ EELR+QL +EKE       ++ ++  ++  QRQ   LE  R+QL +  S        +    +AE E  R                      EE +R+   E+  LK Q ELE+Q W     ++ EAW+L++EQE++ E++K RD EIE VI +LE D   +K+E E +  +++KR +DKYEAE+ ELE SER+ +E+ ++++G+  E E E+  L+ ++RQKE+ +++ + + E L+ ER +++ +IRQEF DRL  +EEE R+ K E++ L+A+                   Q ++ EVH +VK A+ RKEE ++ L++Q++           AA KR++HLE LLEQ R+
Sbjct:  524 LSEAKLQSIMSFL-------DEMEKSGQDQLDSQQEGW----VPEAGPGPLELGSEVSTSVMRLKLEVEEKKQAMLLLQRALAQQRDLTARRVKETEKALSRQLQRQREHYEATIQRHLAFIDQLIEDKKVLSEKCEAVVAELKQEDQRCTERVAQAQAQHELEIKKLKELMSATEKARREKWISEKTKKIKEVTVRGLEPEIQKLIARHKQEVRRLKSLHEAELLQSDERASQRCLRQAEELREQLEREKE-------ALGQQERERARQRQRAELEELRQQLEESSS-------ALTRALRAEFEKGR----------------------EEQERRHQMELNTLKQQLELERQAWEAGRTRKEEAWLLNREQELREEIRKGRDKEIELVIHRLEADMALAKEESEKAAESRIKRLRDKYEAELSELEQSERKLQERCSELKGQLGEAEGENLRLQGLVRQKERALEDAQAVNEQLSSERSNLAQVIRQEFEDRLAASEEETRQAKAELATLQAR------------------QQLELEEVHRRVKTALARKEEAVSSLRTQHE-----------AAVKRADHLEELLEQHRR 1041          
BLAST of Centrosomal protein 131 vs. Ensembl Fly
Match: dila (gene:FBgn0033447 transcript:FBtr0309880)

HSP 1 Score: 135.191 bits (339), Expect = 1.363e-31
Identity = 136/601 (22.63%), Postives = 301/601 (50.08%), Query Frame = 3
Query: 1647 SDSKMNSILQFLNASEVVDDISELEGRRF--------TDFPTKHWNVYDVKELEENTQTAVNEVSTKVMTMKLELEERQRSVEMLQKALQQQRELTVRQVKETQKDMEKRMEVQKDEYESALQRNHTFIDQLISKNELLQDKCNKLVVEMKEKTQKYXXXXXXXXXXXXXXLKKVEAKHLAAEKLRREKWEAEKTKLIKEMTIKGMETEIAQLIANHKQELRKMKQYYENEIIQTGENSYEKYNRQVEELRKQLYKEKEEALQKENSIIKERFDQEMQRQIQILESQRKQLYQEISDERDRLNIMGNKQKAEIENLRKQLEYKEDKVGVSMKLEHQHKLEEMQRKFDTEVRELKTQTELEKQIWIETNNKRNEAWMLSKEQEIKNEMKKNRDSEIEKVILKLEDDNTQSKQEIESSFGNKLKRAKDKYEAEIKELELSERQTKEKYNQIRGXXXXXXXXXXXXKIMIRQKEKEMDEVKQLYETLNRERDHVSDIIRQEFADRLVTTEEENRKLKREISELRAKINLMQTNHNEDLERIQLNHQSDITEVHNKVKEAIKRKEENMAELKSQYQNETSLWQQKLAAAEKRSNHLESLLEQQRK 3425
            S  K   IL +LN  E   D + +E RR          +F  +     +V +L E      ++++ +V+ + L   E   ++ M ++ + Q R    + ++  +     ++  QK  YE  + R+  FI+QL+     L +K   L   ++ + Q +E +++         L + +   +A EK+RRE+W  E TK IKE+T+KG+E EI ++  +H++E+ ++K+ ++ +++   E +  K+ +    +R+   +++E  ++KE + I+ERF+++++ + +    QR++L +E + ERDRL     +++ E +  R++   ++++     K E Q ++ + + K+   V  ++ Q + + ++W   +  + +     KE  I+   +  RD +++++++++E D  Q K+E E     K+ R K+KYE ++   E  E+  +EKY + RG+  E +++  + +  ++Q + E+   K++   +  ERD + D +                      +++++++ ++   H ++++++Q            +V + I+R+EE +  LK    +  +L QQ L         L +++ QQRK
Sbjct:  604 SGDKYKDILAYLNNVESSCDKTLMETRRSIPDSNRSEVEFVVEPDVTDEVPKLSELLMLPNHQLARRVIALSLRANELANAIHMSKEHVFQLRGEKQKSLRAEKSTAAAKLRDQKKHYEEVVTRHQGFIEQLLKDKGSLCEKVAALTRRLESQNQAWEHRLETE-------LARTKETTMAGEKIRRERWVRENTKKIKELTVKGLEAEINKMNCDHQREVTELKRTHQMQLLDALEEARTKHEQIETSIRESCAQDREAIIEKERTAIRERFERQLEEEQRTQAEQRQKLTEEFAAERDRLQSELRQRENEHQARRQEALREQEQELEQAKFEMQERMAKQEEKYQNRVNTIEQQYQADFELWKTEHENKTKLAQAEKENAIRQHYRAERDRQLDELVVRMEADALQHKEEHEL----KMNRLKEKYEKDLVLAESVEKSLREKYAETRGKLAEADAQVRNSQAEVKQLQLELSHSKKMCGDIIMERDRLRDNLN---------------------ADIQSELGVLNERHKQEMDQLQ-----------KRVHQTIQRQEETIEILKG---DNDALRQQCL--------KLNAVIRQQRK 1150          
BLAST of Centrosomal protein 131 vs. Ensembl Fly
Match: dila (gene:FBgn0033447 transcript:FBtr0339409)

HSP 1 Score: 135.191 bits (339), Expect = 1.567e-31
Identity = 136/601 (22.63%), Postives = 301/601 (50.08%), Query Frame = 3
Query: 1647 SDSKMNSILQFLNASEVVDDISELEGRRF--------TDFPTKHWNVYDVKELEENTQTAVNEVSTKVMTMKLELEERQRSVEMLQKALQQQRELTVRQVKETQKDMEKRMEVQKDEYESALQRNHTFIDQLISKNELLQDKCNKLVVEMKEKTQKYXXXXXXXXXXXXXXLKKVEAKHLAAEKLRREKWEAEKTKLIKEMTIKGMETEIAQLIANHKQELRKMKQYYENEIIQTGENSYEKYNRQVEELRKQLYKEKEEALQKENSIIKERFDQEMQRQIQILESQRKQLYQEISDERDRLNIMGNKQKAEIENLRKQLEYKEDKVGVSMKLEHQHKLEEMQRKFDTEVRELKTQTELEKQIWIETNNKRNEAWMLSKEQEIKNEMKKNRDSEIEKVILKLEDDNTQSKQEIESSFGNKLKRAKDKYEAEIKELELSERQTKEKYNQIRGXXXXXXXXXXXXKIMIRQKEKEMDEVKQLYETLNRERDHVSDIIRQEFADRLVTTEEENRKLKREISELRAKINLMQTNHNEDLERIQLNHQSDITEVHNKVKEAIKRKEENMAELKSQYQNETSLWQQKLAAAEKRSNHLESLLEQQRK 3425
            S  K   IL +LN  E   D + +E RR          +F  +     +V +L E      ++++ +V+ + L   E   ++ M ++ + Q R    + ++  +     ++  QK  YE  + R+  FI+QL+     L +K   L   ++ + Q +E +++         L + +   +A EK+RRE+W  E TK IKE+T+KG+E EI ++  +H++E+ ++K+ ++ +++   E +  K+ +    +R+   +++E  ++KE + I+ERF+++++ + +    QR++L +E + ERDRL     +++ E +  R++   ++++     K E Q ++ + + K+   V  ++ Q + + ++W   +  + +     KE  I+   +  RD +++++++++E D  Q K+E E     K+ R K+KYE ++   E  E+  +EKY + RG+  E +++  + +  ++Q + E+   K++   +  ERD + D +                      +++++++ ++   H ++++++Q            +V + I+R+EE +  LK    +  +L QQ L         L +++ QQRK
Sbjct:  563 SGDKYKDILAYLNNVESSCDKTLMETRRSIPDSNRSEVEFVVEPDVTDEVPKLSELLMLPNHQLARRVIALSLRANELANAIHMSKEHVFQLRGEKQKSLRAEKSTAAAKLRDQKKHYEEVVTRHQGFIEQLLKDKGSLCEKVAALTRRLESQNQAWEHRLETE-------LARTKETTMAGEKIRRERWVRENTKKIKELTVKGLEAEINKMNCDHQREVTELKRTHQMQLLDALEEARTKHEQIETSIRESCAQDREAIIEKERTAIRERFERQLEEEQRTQAEQRQKLTEEFAAERDRLQSELRQRENEHQARRQEALREQEQELEQAKFEMQERMAKQEEKYQNRVNTIEQQYQADFELWKTEHENKTKLAQAEKENAIRQHYRAERDRQLDELVVRMEADALQHKEEHEL----KMNRLKEKYEKDLVLAESVEKSLREKYAETRGKLAEADAQVRNSQAEVKQLQLELSHSKKMCGDIIMERDRLRDNLN---------------------ADIQSELGVLNERHKQEMDQLQ-----------KRVHQTIQRQEETIEILKG---DNDALRQQCL--------KLNAVIRQQRK 1109          
BLAST of Centrosomal protein 131 vs. Ensembl Fly
Match: dila (gene:FBgn0033447 transcript:FBtr0309879)

HSP 1 Score: 134.806 bits (338), Expect = 1.726e-31
Identity = 136/601 (22.63%), Postives = 301/601 (50.08%), Query Frame = 3
Query: 1647 SDSKMNSILQFLNASEVVDDISELEGRRF--------TDFPTKHWNVYDVKELEENTQTAVNEVSTKVMTMKLELEERQRSVEMLQKALQQQRELTVRQVKETQKDMEKRMEVQKDEYESALQRNHTFIDQLISKNELLQDKCNKLVVEMKEKTQKYXXXXXXXXXXXXXXLKKVEAKHLAAEKLRREKWEAEKTKLIKEMTIKGMETEIAQLIANHKQELRKMKQYYENEIIQTGENSYEKYNRQVEELRKQLYKEKEEALQKENSIIKERFDQEMQRQIQILESQRKQLYQEISDERDRLNIMGNKQKAEIENLRKQLEYKEDKVGVSMKLEHQHKLEEMQRKFDTEVRELKTQTELEKQIWIETNNKRNEAWMLSKEQEIKNEMKKNRDSEIEKVILKLEDDNTQSKQEIESSFGNKLKRAKDKYEAEIKELELSERQTKEKYNQIRGXXXXXXXXXXXXKIMIRQKEKEMDEVKQLYETLNRERDHVSDIIRQEFADRLVTTEEENRKLKREISELRAKINLMQTNHNEDLERIQLNHQSDITEVHNKVKEAIKRKEENMAELKSQYQNETSLWQQKLAAAEKRSNHLESLLEQQRK 3425
            S  K   IL +LN  E   D + +E RR          +F  +     +V +L E      ++++ +V+ + L   E   ++ M ++ + Q R    + ++  +     ++  QK  YE  + R+  FI+QL+     L +K   L   ++ + Q +E +++         L + +   +A EK+RRE+W  E TK IKE+T+KG+E EI ++  +H++E+ ++K+ ++ +++   E +  K+ +    +R+   +++E  ++KE + I+ERF+++++ + +    QR++L +E + ERDRL     +++ E +  R++   ++++     K E Q ++ + + K+   V  ++ Q + + ++W   +  + +     KE  I+   +  RD +++++++++E D  Q K+E E     K+ R K+KYE ++   E  E+  +EKY + RG+  E +++  + +  ++Q + E+   K++   +  ERD + D +                      +++++++ ++   H ++++++Q            +V + I+R+EE +  LK    +  +L QQ L         L +++ QQRK
Sbjct:  583 SGDKYKDILAYLNNVESSCDKTLMETRRSIPDSNRSEVEFVVEPDVTDEVPKLSELLMLPNHQLARRVIALSLRANELANAIHMSKEHVFQLRGEKQKSLRAEKSTAAAKLRDQKKHYEEVVTRHQGFIEQLLKDKGSLCEKVAALTRRLESQNQAWEHRLETE-------LARTKETTMAGEKIRRERWVRENTKKIKELTVKGLEAEINKMNCDHQREVTELKRTHQMQLLDALEEARTKHEQIETSIRESCAQDREAIIEKERTAIRERFERQLEEEQRTQAEQRQKLTEEFAAERDRLQSELRQRENEHQARRQEALREQEQELEQAKFEMQERMAKQEEKYQNRVNTIEQQYQADFELWKTEHENKTKLAQAEKENAIRQHYRAERDRQLDELVVRMEADALQHKEEHEL----KMNRLKEKYEKDLVLAESVEKSLREKYAETRGKLAEADAQVRNSQAEVKQLQLELSHSKKMCGDIIMERDRLRDNLN---------------------ADIQSELGVLNERHKQEMDQLQ-----------KRVHQTIQRQEETIEILKG---DNDALRQQCL--------KLNAVIRQQRK 1129          
BLAST of Centrosomal protein 131 vs. Ensembl Zebrafish
Match: cep131 (Danio rerio centrosomal protein 131 (cep131), mRNA. [Source:RefSeq mRNA;Acc:NM_001353865])

HSP 1 Score: 417.542 bits (1072), Expect = 5.881e-126
Identity = 283/714 (39.64%), Postives = 455/714 (63.73%), Query Frame = 3
Query: 1311 GKSTNRGSEITTIDDILSTIKELESVDCLTDRSSKFDMKSNQANKCRWSAITEDIDKLLKPEQFKSISNAPSNPFIDNPLTSKALKMHNNNIGRQSQSEINLAPTKPTQSAI-SDSKMNSILQFLNASEVVDDISELEGRRFTDFPTKHWNVY----DVKELEENTQTAVNEVSTKVMTMKLELEERQRSVEMLQKALQQQRELTVRQVKETQKDMEKRMEVQKDEYESALQRNHTFIDQLISKNELLQDKCNKLVVEMKEKTQKYXXXXXXXXXXXXXXLKKVEAKHLAAEKLRREKWEAEKTKLIKEMTIKGMETEIAQLIANHKQELRKMKQYYENEIIQTGENSYEKYNRQVEELRKQLYKEKEEALQKENSIIKERFDQEMQRQIQILESQRKQLYQEISDERDRLNIMGNKQKAEIENLRKQLEYKEDKVGVSMKLEHQHKLEEMQRKFDTEVRELKTQTELEKQIWIETNNKRNEAWMLSKEQEIKNEMKKNRDSEIEKVILKLEDDNTQSKQEIESSFGNKLKRAKDKYEAEIKELELSERQTKEKYNQIRGXXXXXXXXXXXXKIMIRQKEKEMDEVKQLYETLNRERDHVSDIIRQEFADRLVTTEEENRKLKREISELRAKINLMQTNHNEDLERIQLNHQSDITEVHNKVKEAIKRKEENMAELKSQYQNETSLWQQKLAAAEKRSNHLESLLEQQRKHLLN 3437
            G S++R    TT++D+L T+K LE      +R S  + KS + +K  W  I ED D                     N LT+       +N+ R  Q  ++  P  P   A+ S++K+ SI+ FL+  E     SE E  R     + H  V     D+  +E+ + TA  EV+  +M ++LEL+E++R+V MLQ AL QQRELT+R VKET+K++    ++QK++YE+ +QR+ TFIDQLI   + L ++C ++V E+K+  QKY +KI  +QE + +E+KK++    A EK+RREKW  EKTK IKE+T+KG+E EI +LI+ HKQEL+K++  +E E++Q  E + ++Y RQ EELR+QL KEK+E  Q+E  + K+R ++++Q +  +L+ QR++LY+E+S+E++RL  +  +Q AE+E+LRKQLE      G +++ E +   +E +R+   E++ LK + E+EKQ W E   K+ EAW+LS+E+E+K E+++ RD EIE  I +LE +  ++++E E +  N++KR ++KYEAE+++LE SER + +K  ++R +  E+E+E   L+ ++RQ+E+E+ ++ Q  + L+ ER  +S++IRQEFA+RL+  EEENR++K E+SE +A++ L       ++ER+    + ++ EVH +VK AI +KEE +  L+ Q++           AA KR++HLESLLEQQRK LL 
Sbjct:  446 GASSSRAQSKTTLNDLLDTLKLLEEE---PERLS--EPKSYRKDKYSW--IDEDGD--------------------SNSLTT-------DNVERHRQ--LSQTPALPDGGALLSEAKLQSIMSFLDEMEK----SEQERPRSVTSGS-HREVVLSEEDLAVVEQASATAA-EVTGSMMRLRLELDEKKRTVNMLQTALAQQRELTIRHVKETEKELNHTFQLQKEQYEATIQRHLTFIDQLIDDKKALSERCEEVVGELKQVDQKYTKKIAQMQEQHELEIKKLKELMSATEKVRREKWINEKTKKIKEITVKGLEPEIQKLISKHKQELKKLRVLHEAELLQADERAAQRYVRQSEELRQQLEKEKDEQCQRERELAKQRLEKQLQEEENVLQQQRRRLYKEVSEEKERLTQLAARQHAELEDLRKQLEDNSSLAGRALREELEKSRDEQERRHQVEIKALKERLEIEKQTWEENYMKKEEAWLLSRERELKEEVRRGRDKEIELAIQRLEVETREAREECERAADNRMKRVREKYEAELRDLERSERTSLQKQQEMREKHSEMEAELLRLQSLLRQREQEISDLTQARDKLSEERRSLSEVIRQEFAERLIELEEENRRMKMEVSEAKARLRL-------EVERVTREKEEELAEVHQRVKSAILKKEETVNNLRKQHE-----------AAVKRADHLESLLEQQRKQLLG 1099          
BLAST of Centrosomal protein 131 vs. Ensembl Zebrafish
Match: cep131 (Danio rerio centrosomal protein 131 (cep131), mRNA. [Source:RefSeq mRNA;Acc:NM_001353865])

HSP 1 Score: 408.683 bits (1049), Expect = 1.486e-122
Identity = 283/724 (39.09%), Postives = 454/724 (62.71%), Query Frame = 3
Query: 1311 GKSTNRGSEITTIDDILSTIKELESVDCLTDRSSKFDMKSNQANKCRWSAITEDIDKLLKPEQFKSISNAPSNPFIDNPLTSKALKMHNNNIGRQSQSEINLAPTKPTQSAI-SDSKMNSILQFLNASEVVDDISELEGRRFTDFPTKHWNVY----DVKELEENTQTAVNEVSTKVMTMKLELEERQRSVEMLQKALQQQRELTVRQVKETQKDMEKRMEVQKDEYESALQRNHTFIDQLISKNELLQDKCNKLVVEMKEKTQKYXXXXXXXXXXXX----------XXLKKVEAKHLAAEKLRREKWEAEKTKLIKEMTIKGMETEIAQLIANHKQELRKMKQYYENEIIQTGENSYEKYNRQVEELRKQLYKEKEEALQKENSIIKERFDQEMQRQIQILESQRKQLYQEISDERDRLNIMGNKQKAEIENLRKQLEYKEDKVGVSMKLEHQHKLEEMQRKFDTEVRELKTQTELEKQIWIETNNKRNEAWMLSKEQEIKNEMKKNRDSEIEKVILKLEDDNTQSKQEIESSFGNKLKRAKDKYEAEIKELELSERQTKEKYNQIRGXXXXXXXXXXXXKIMIRQKEKEMDEVKQLYETLNRERDHVSDIIRQEFADRLVTTEEENRKLKREISELRAKINLMQTNHNEDLERIQLNHQSDITEVHNKVKEAIKRKEENMAELKSQYQNETSLWQQKLAAAEKRSNHLESLLEQQRKHLLN 3437
            G S++R    TT++D+L T+K LE      +R S  + KS + +K  W  I ED D                     N LT+       +N+ R  Q  ++  P  P   A+ S++K+ SI+ FL+  E     SE E  R     + H  V     D+  +E+ + TA  EV+  +M ++LEL+E++R+V MLQ AL QQRELT+R VKET+K++    ++QK++YE+ +QR+ TFIDQLI   + L ++C ++V E+K+  QKY +KI  +QE +            E+KK++    A EK+RREKW  EKTK IKE+T+KG+E EI +LI+ HKQEL+K++  +E E++Q  E + ++Y RQ EELR+QL KEK+E  Q+E  + K+R ++++Q +  +L+ QR++LY+E+S+E++RL  +  +Q AE+E+LRKQLE      G +++ E +   +E +R+   E++ LK + E+EKQ W E   K+ EAW+LS+E+E+K E+++ RD EIE  I +LE +  ++++E E +  N++KR ++KYEAE+++LE SER + +K  ++R +  E+E+E   L+ ++RQ+E+E+ ++ Q  + L+ ER  +S++IRQEFA+RL+  EEENR++K E+SE +A++ L       ++ER+    + ++ EVH +VK AI +KEE +  L+ Q++           AA KR++HLESLLEQQRK LL 
Sbjct:  447 GASSSRAQSKTTLNDLLDTLKLLEEE---PERLS--EPKSYRKDKYSW--IDEDGD--------------------SNSLTT-------DNVERHRQ--LSQTPALPDGGALLSEAKLQSIMSFLDEMEK----SEQERPRSVTSGS-HREVVLSEEDLAVVEQASATAA-EVTGSMMRLRLELDEKKRTVNMLQTALAQQRELTIRHVKETEKELNHTFQLQKEQYEATIQRHLTFIDQLIDDKKALSERCEEVVGELKQVDQKYTKKIAQMQEQHELVWQILGPMCEEIKKLKELMSATEKVRREKWINEKTKKIKEITVKGLEPEIQKLISKHKQELKKLRVLHEAELLQADERAAQRYVRQSEELRQQLEKEKDEQCQRERELAKQRLEKQLQEEENVLQQQRRRLYKEVSEEKERLTQLAARQHAELEDLRKQLEDNSSLAGRALREELEKSRDEQERRHQVEIKALKERLEIEKQTWEENYMKKEEAWLLSRERELKEEVRRGRDKEIELAIQRLEVETREAREECERAADNRMKRVREKYEAELRDLERSERTSLQKQQEMREKHSEMEAELLRLQSLLRQREQEISDLTQARDKLSEERRSLSEVIRQEFAERLIELEEENRRMKMEVSEAKARLRL-------EVERVTREKEEELAEVHQRVKSAILKKEETVNNLRKQHE-----------AAVKRADHLESLLEQQRKQLLG 1110          
BLAST of Centrosomal protein 131 vs. Ensembl Zebrafish
Match: cep131 (centrosomal protein 131 [Source:NCBI gene;Acc:563066])

HSP 1 Score: 407.527 bits (1046), Expect = 3.874e-122
Identity = 284/726 (39.12%), Postives = 456/726 (62.81%), Query Frame = 3
Query: 1311 GKSTNRGSEITTIDDILSTIKELESVDCLTDRSSKFDMKSNQANKCRWSAITEDIDKLLKPEQFKSISNAPSNPFIDNPLTSKALKMHNNNIGRQSQSEINLAPTKPTQSAI-SDSKMNSILQFLNASEVVDDISELEGRRFTDFPTKHWNVY----DVKELEENTQTAVNEVSTKVMTMKLELEERQRSVEMLQKALQQQRELTVRQVKETQKDMEKRMEVQKDEYESALQRNHTFIDQLISKNELLQDKCNKLVVEMKEKTQKYXXXXXXXXXXXX----------XXLKKVEAKHLAAEKLRREKWEAEKTKLIKEMTIKGMETEIAQLIANHKQELRKMKQYYENEIIQTGENSYEKYNRQVEELRKQLYKEKEEALQKENSIIKERFDQEMQRQIQILESQRKQLYQEISDERDRLNIMGNKQKAEIENLRKQLEYKEDKVGVSMKLEHQHKLEEMQRKFDTEVRELKTQTELEKQIWIETNNKRNEAWMLSKEQEIKNEMKKNRDSEIEKVILKLEDDNTQSKQEIESSFGNKLKRAKDKYEAEIKELELSERQTKEKYNQIRGXXXXXXXXXXXXKIMIRQKEKEMDEVKQLY--ETLNRERDHVSDIIRQEFADRLVTTEEENRKLKREISELRAKINLMQTNHNEDLERIQLNHQSDITEVHNKVKEAIKRKEENMAELKSQYQNETSLWQQKLAAAEKRSNHLESLLEQQRKHLLN 3437
            G S++R    TT++D+L T+K LE      +R S  + KS + +K  W  I ED D                     N LT+       +N+ R  Q  ++  P  P   A+ S++K+ SI+ FL+  E     SE E  R     + H  V     D+  +E+ + TA  EV+  +M ++LEL+E++R+V MLQ AL QQRELT+R VKET+K++    ++QK++YE+ +QR+ TFIDQLI   + L ++C ++V E+K+  QKY +KI  +QE +            E+KK++    A EK+RREKW  EKTK IKE+T+KG+E EI +LI+ HKQEL+K++  +E E++Q  E + ++Y RQ EELR+QL KEK+E  Q+E  + K+RF++++Q +  +L+ QR++LY+E+S+E++RL  +  +Q AE+E+LRKQLE      G +++ E +   +E +R+   E++ LK + E+EKQ W E   K+ EAW+LS+E+E+K E+++ RD EIE  I +LE +  ++++E E +  N++KR ++KYEAE+++LE SER + +K  ++R +  E+E+E   L+ ++RQ+E+E+ ++ Q+   + L+ ER  +S++IRQEFA+RL+  EEENR++K E+SE +A++ L       ++ER+    + ++ EVH +VK AI +KEE +  L+ Q++           AA KR++HLESLLEQQRK LL 
Sbjct:  447 GASSSRAQSKTTLNDLLDTLKLLEEE---PERLS--EPKSYRKDKYSW--IDEDGD--------------------SNSLTT-------DNVERHRQ--LSQTPALPDGGALLSEAKLQSIMSFLDEMEK----SEQERPRSVTSGS-HREVVLSEEDLAVVEQASATAA-EVTGSMMRLRLELDEKKRTVNMLQTALAQQRELTIRHVKETEKELNHTFQLQKEQYEATIQRHLTFIDQLIDDKKALSERCEEVVGELKQVDQKYTKKIAQMQEQHELVWQILGPMCEEIKKLKELMSATEKVRREKWINEKTKKIKEITVKGLEPEIQKLISKHKQELKKLRVLHEAELLQADERAAQRYVRQSEELRQQLEKEKDEQCQRERELAKQRFEKQLQEEENVLQQQRRRLYKEVSEEKERLTQLAARQHAELEDLRKQLEDNSSLAGRALREELEKSRDEQERRHQVEIKALKERLEIEKQTWEENYMKKEEAWLLSRERELKEEVRRGRDKEIELAIQRLEVETREAREECERAADNRMKRVREKYEAELRDLERSERTSLQKQQEMREKHSEMEAELLRLQSLLRQREQEISDLTQVTARDKLSEERRSLSEVIRQEFAERLIELEEENRRMKMEVSEAKARLRL-------EVERVTREKEEELAEVHQRVKSAILKKEETVNNLRKQHE-----------AAVKRADHLESLLEQQRKQLLG 1112          
BLAST of Centrosomal protein 131 vs. Ensembl Zebrafish
Match: cep131 (Danio rerio centrosomal protein 131 (cep131), mRNA. [Source:RefSeq mRNA;Acc:NM_001353865])

HSP 1 Score: 339.347 bits (869), Expect = 5.673e-98
Identity = 260/724 (35.91%), Postives = 420/724 (58.01%), Query Frame = 3
Query: 1311 GKSTNRGSEITTIDDILSTIKELESVDCLTDRSSKFDMKSNQANKCRWSAITEDIDKLLKPEQFKSISNAPSNPFIDNPLTSKALKMHNNNIGRQSQSEINLAPTKPTQSAI-SDSKMNSILQFLNASEVVDDISELEGRRFTDFPTKHWNVY----DVKELEENTQTAVNEVSTKVMTMKLELEERQRSVEMLQKALQQQRELTVRQVKETQKDMEKRMEVQKDEYESALQRNHTFIDQLISKNELLQDKCNKLVVEMKEKTQKYXXXXXXXXXXXX----------XXLKKVEAKHLAAEKLRREKWEAEKTKLIKEMTIKGMETEIAQLIANHKQELRKMKQYYENEIIQTGENSYEKYNRQVEELRKQLYKEKEEALQKENSIIKERFDQEMQRQIQILESQRKQLYQEISDERDRLNIMGNKQKAEIENLRKQLEYKEDKVGVSMKLEHQHKLEEMQRKFDTEVRELKTQTELEKQIWIETNNKRNEAWMLSKEQEIKNEMKKNRDSEIEKVILKLEDDNTQSKQEIESSFGNKLKRAKDKYEAEIKELELSERQTKEKYNQIRGXXXXXXXXXXXXKIMIRQKEKEMDEVKQLYETLNRERDHVSDIIRQEFADRLVTTEEENRKLKREISELRAKINLMQTNHNEDLERIQLNHQSDITEVHNKVKEAIKRKEENMAELKSQYQNETSLWQQKLAAAEKRSNHLESLLEQQRKHLLN 3437
            G S++R    TT++D+L T+K LE      +R S  + KS + +K  W  I ED D                     N LT+       +N+ R  Q  ++  P  P   A+ S++K+ SI+ FL+  E     SE E  R     + H  V     D+  +E+ + TA  EV+  +M ++LEL+E++R+V MLQ AL                                          LI   + L ++C ++V E+K+  QKY +KI  +QE +            E+KK++    A EK+RREKW  EKTK IKE+T+KG+E EI +LI+ HKQEL+K++  +E E++Q  E + ++Y RQ EELR+QL KEK+E  Q+E  + K+R ++++Q +  +L+ QR++LY+E+S+E++RL  +  +Q AE+E+LRKQLE      G +++ E +   +E +R+   E++ LK + E+EKQ W E   K+ EAW+LS+E+E+K E+++ RD EIE  I +LE +  ++++E E +  N++KR ++KYEAE+++LE SER + +K  ++R +  E+E+E   L+ ++RQ+E+E+ ++ Q  + L+ ER  +S++IRQEFA+RL+  EEENR++K E+SE +A++ L       ++ER+    + ++ EVH +VK AI +KEE +  L+ Q++           AA KR++HLESLLEQQRK LL 
Sbjct:  446 GASSSRAQSKTTLNDLLDTLKLLEEE---PERLS--EPKSYRKDKYSW--IDEDGD--------------------SNSLTT-------DNVERHRQ--LSQTPALPDGGALLSEAKLQSIMSFLDEMEK----SEQERPRSVTSGS-HREVVLSEEDLAVVEQASATAA-EVTGSMMRLRLELDEKKRTVNMLQTAL------------------------------------------LIDDKKALSERCEEVVGELKQVDQKYTKKIAQMQEQHELVWQILGPMCEEIKKLKELMSATEKVRREKWINEKTKKIKEITVKGLEPEIQKLISKHKQELKKLRVLHEAELLQADERAAQRYVRQSEELRQQLEKEKDEQCQRERELAKQRLEKQLQEEENVLQQQRRRLYKEVSEEKERLTQLAARQHAELEDLRKQLEDNSSLAGRALREELEKSRDEQERRHQVEIKALKERLEIEKQTWEENYMKKEEAWLLSRERELKEEVRRGRDKEIELAIQRLEVETREAREECERAADNRMKRVREKYEAELRDLERSERTSLQKQQEMREKHSEMEAELLRLQSLLRQREQEISDLTQARDKLSEERRSLSEVIRQEFAERLIELEEENRRMKMEVSEAKARLRL-------EVERVTREKEEELAEVHQRVKSAILKKEETVNNLRKQHE-----------AAVKRADHLESLLEQQRKQLLG 1067          
BLAST of Centrosomal protein 131 vs. Ensembl Xenopus
Match: ptger2 (prostaglandin E receptor 2 [Source:Xenbase;Acc:XB-GENE-967341])

HSP 1 Score: 406.371 bits (1043), Expect = 9.322e-122
Identity = 269/668 (40.27%), Postives = 429/668 (64.22%), Query Frame = 3
Query: 1479 KLLKPEQFKSISNAPSNPF------IDNPLTSKALK-----MHNNNIGRQSQSEINLAPTKPTQSAISDSKMNSILQFLNASEVVDDISELEGRRFTDFPTKHWNVYDVKELE--ENTQTAVNEVSTKVMTMKLELEERQRSVEMLQKALQQQRELTVRQVKETQKDMEKRMEVQKDEYESALQRNHTFIDQLISKNELLQDKCNKLVVEMKEKTQKYXXXXXXXXXXXXXXLKKVEAKHLAAEKLRREKWEAEKTKLIKEMTIKGMETEIAQLIANHKQELRKMKQYYENEIIQTGENSYEKYNRQVEELRKQLYKEKEEALQKENSIIKERFDQEMQRQIQILESQRKQLYQEISDERDRLNIMGNKQKAEIENLRKQLEYKEDKVGVS---MKLEHQHKLEEMQRKFDTEVRELKTQTELEKQIWIETNNKRNEAWMLSKEQEIKNEMKKNRDSEIEKVILKLEDDNTQSKQEIESSFGNKLKRAKDKYEAEIKELELSERQTKEKYNQIRGXXXXXXXXXXXXKIMIRQKEKEMDEVKQLYETLNRERDHVSDIIRQEFADRLVTTEEENRKLKREISELRAKINLMQTNHNEDLERIQLNHQSDITEVHNKVKEAIKRKEENMAELKSQYQNETSLWQQKLAAAEKRSNHLESLLEQQRKHLL 3434
            +L +PE    I + P + +      ID+ LT   L+      HN     + + EIN          +S++K+ SI+ FL+  E    ISE E  R     T+   +   +EL   E       EV++ ++ ++LE++E+ R++ +LQ AL QQRELTVR  K+T+K++ ++++ Q ++YE+ +QR+ +FIDQLI   + L ++C  LV E+K+  QKY  KI  +QE + +E+KK++    A EK+RREKW  EKTK IKE+T+KG+E EI +LI+ HKQE+RK+K  +E E+ Q+ E + ++Y RQ EE+R  L +EKEE  Q+E  + K+R+++ + ++ Q L+ QR++L+QE+S+E++RLN    +Q+AE++ LRKQL   ED   ++   +K E++   +E +R+   E++ LK + E+EKQ W +   K+ E W+LS+E+E+K +++K RD EIE VI +LE + + +K E E +  N++KR +DKYE+E++ELE SER+ +E+ NQ++ +  ELE E   L+ ++RQKE+E+++++++ + L+ ER  +S++IRQEFADRLV TEEENR+LK E SE RA+  L       +LER+      ++ EVH +VK AI +KEE +  L+ Q +           AA KR++HLE+LLEQQRK LL
Sbjct:  452 QLEEPEPLPEIKSEPKDKYQFIDGDIDSSLTVDNLERLGQLTHNG----ERKEEINGV-------LLSEAKLQSIISFLDEME----ISEQERPRSAASNTQKGALLSEEELTHLEQASAVATEVTSSMLKLRLEVQEKTRALNLLQTALAQQRELTVRHAKQTEKELGQQLKQQGEQYEATIQRHLSFIDQLIDDKKALSERCESLVKELKQVDQKYSSKISQMQEQHEMEMKKLQDLMSATEKVRREKWIDEKTKKIKEITVKGLEPEIQRLISKHKQEIRKLKALHEAELQQSDERAAQRYVRQTEEMRHNLEREKEEVSQRERELAKQRYEKHLVQEEQSLQEQRRRLFQEVSEEKERLNQQAARQRAELDELRKQL---EDNCALATRVLKEEYEKSKDEQERRHQAEIKALKERLEIEKQAWEQNYMKKEETWLLSRERELKEDVRKGRDREIELVIQRLESEMSTAKDECERACENRIKRIRDKYESELQELERSERKLQERCNQLKEQVTELEGEQIRLQGLLRQKEQEIEDIRKVTDCLSEERKSLSEVIRQEFADRLVLTEEENRRLKTEASEARARQRL-------ELERVNREKDEELEEVHKRVKTAIVKKEETVNSLRKQCE-----------AAVKRADHLEALLEQQRKQLL 1083          
BLAST of Centrosomal protein 131 vs. Ensembl Xenopus
Match: ptger2 (prostaglandin E receptor 2 [Source:Xenbase;Acc:XB-GENE-967341])

HSP 1 Score: 398.282 bits (1022), Expect = 9.412e-119
Identity = 269/678 (39.68%), Postives = 428/678 (63.13%), Query Frame = 3
Query: 1479 KLLKPEQFKSISNAPSNPF------IDNPLTSKALK-----MHNNNIGRQSQSEINLAPTKPTQSAISDSKMNSILQFLNASEVVDDISELEGRRFTDFPTKHWNVYDVKELE--ENTQTAVNEVSTKVMTMKLELEERQRSVEMLQKALQQQRELTVRQVKETQKDMEKRMEVQKDEYESALQRNHTFIDQLISKNELLQDKCNKLVVEMKEKTQKYXXXXXXXXXXXX----------XXLKKVEAKHLAAEKLRREKWEAEKTKLIKEMTIKGMETEIAQLIANHKQELRKMKQYYENEIIQTGENSYEKYNRQVEELRKQLYKEKEEALQKENSIIKERFDQEMQRQIQILESQRKQLYQEISDERDRLNIMGNKQKAEIENLRKQLEYKEDKVGVS---MKLEHQHKLEEMQRKFDTEVRELKTQTELEKQIWIETNNKRNEAWMLSKEQEIKNEMKKNRDSEIEKVILKLEDDNTQSKQEIESSFGNKLKRAKDKYEAEIKELELSERQTKEKYNQIRGXXXXXXXXXXXXKIMIRQKEKEMDEVKQLYETLNRERDHVSDIIRQEFADRLVTTEEENRKLKREISELRAKINLMQTNHNEDLERIQLNHQSDITEVHNKVKEAIKRKEENMAELKSQYQNETSLWQQKLAAAEKRSNHLESLLEQQRKHLL 3434
            +L +PE    I + P + +      ID+ LT   L+      HN     + + EIN          +S++K+ SI+ FL+  E    ISE E  R     T+   +   +EL   E       EV++ ++ ++LE++E+ R++ +LQ AL QQRELTVR  K+T+K++ ++++ Q ++YE+ +QR+ +FIDQLI   + L ++C  LV E+K+  QKY  KI  +QE +            E+KK++    A EK+RREKW  EKTK IKE+T+KG+E EI +LI+ HKQE+RK+K  +E E+ Q+ E + ++Y RQ EE+R  L +EKEE  Q+E  + K+R+++ + ++ Q L+ QR++L+QE+S+E++RLN    +Q+AE++ LRKQL   ED   ++   +K E++   +E +R+   E++ LK + E+EKQ W +   K+ E W+LS+E+E+K +++K RD EIE VI +LE + + +K E E +  N++KR +DKYE+E++ELE SER+ +E+ NQ++ +  ELE E   L+ ++RQKE+E+++++++ + L+ ER  +S++IRQEFADRLV TEEENR+LK E SE RA+  L       +LER+      ++ EVH +VK AI +KEE +  L+ Q +           AA KR++HLE+LLEQQRK LL
Sbjct:  452 QLEEPEPLPEIKSEPKDKYQFIDGDIDSSLTVDNLERLGQLTHNG----ERKEEINGV-------LLSEAKLQSIISFLDEME----ISEQERPRSAASNTQKGALLSEEELTHLEQASAVATEVTSSMLKLRLEVQEKTRALNLLQTALAQQRELTVRHAKQTEKELGQQLKQQGEQYEATIQRHLSFIDQLIDDKKALSERCESLVKELKQVDQKYSSKISQMQEQHEMVWQTLGPLCEEMKKLQDLMSATEKVRREKWIDEKTKKIKEITVKGLEPEIQRLISKHKQEIRKLKALHEAELQQSDERAAQRYVRQTEEMRHNLEREKEEVSQRERELAKQRYEKHLVQEEQSLQEQRRRLFQEVSEEKERLNQQAARQRAELDELRKQL---EDNCALATRVLKEEYEKSKDEQERRHQAEIKALKERLEIEKQAWEQNYMKKEETWLLSRERELKEDVRKGRDREIELVIQRLESEMSTAKDECERACENRIKRIRDKYESELQELERSERKLQERCNQLKEQVTELEGEQIRLQGLLRQKEQEIEDIRKVTDCLSEERKSLSEVIRQEFADRLVLTEEENRRLKTEASEARARQRL-------ELERVNREKDEELEEVHKRVKTAIVKKEETVNSLRKQCE-----------AAVKRADHLEALLEQQRKQLL 1093          
BLAST of Centrosomal protein 131 vs. Ensembl Xenopus
Match: ptger2 (prostaglandin E receptor 2 [Source:Xenbase;Acc:XB-GENE-967341])

HSP 1 Score: 379.022 bits (972), Expect = 4.042e-112
Identity = 261/665 (39.25%), Postives = 413/665 (62.11%), Query Frame = 3
Query: 1479 KLLKPEQFKSISNAPSNPF------IDNPLTSKALK-----MHNNNIGRQSQSEINLAPTKPTQSAISDSKMNSILQFLNASEVVDDISELEGRRFTDFPTKHWNVYDVKELE--ENTQTAVNEVSTKVMTMKLELEERQRSVEMLQKALQQQRELTVRQVKETQKDMEKRMEVQKDEYESALQRNHTFIDQLISKNELLQDKCNKLVVEMKEKTQKYXXXXXXXXXXXXXXLKKVEAKHLAAEKLRREKWEAEKTKLIKEMTIKGMETEIAQLIANHKQELRKMKQYYENEIIQTGENSYEKYNRQVEELRKQLYKEKEEALQKENSIIKERFDQEMQRQIQILESQRKQLYQEISDERDRLNIMGNKQKAEIENLRKQLEYKEDKVGVSMKLEHQHKLEEMQRKFDTEVRELKTQTELEKQIWIETNNKRNEAWMLSKEQEIKNEMKKNRDSEIEKVILKLEDDNTQSKQEIESSFGNKLKRAKDKYEAEIKELELSERQTKEKYNQIRGXXXXXXXXXXXXKIMIRQKEKEMDEVKQLYETLNRERDHVSDIIRQEFADRLVTTEEENRKLKREISELRAKINLMQTNHNEDLERIQLNHQSDITEVHNKVKEAIKRKEENMAELKSQYQNETSLWQQKLAAAEKRSNHLESLLEQQRKHLL 3434
            +L +PE    I + P + +      ID+ LT   L+      HN     + + EIN          +S++K+ SI+ FL+  E    ISE E  R     T+   +   +EL   E       EV++ ++ ++LE++E+ R++ +LQ AL QQRELTVR  K+T+K++ ++++ Q ++YE+ +QR+ +FIDQLI   + L ++C  LV E+K+  QKY  KI  +QE + +E+KK++    A EK+RREKW  EKTK IKE+T+KG+E EI +LI+ HKQE+RK+K  +E E+ Q+ E + ++Y RQ EE+R  L +EKEE  Q+E  + K+R+++ + ++ Q L+ QR++L+QE+S+E++RLN    +Q+AE++ LRKQL   ED   ++ ++                   LK + E  K    E   +  E W+LS+E+E+K +++K RD EIE VI +LE + + +K E E +  N++KR +DKYE+E++ELE SER+ +E+ NQ++ +  ELE E   L+ ++RQKE+E+++++++ + L+ ER  +S++IRQEFADRLV TEEENR+LK E SE RA+  L       +LER+      ++ EVH +VK AI +KEE +  L+ Q +           AA KR++HLE+LLEQQRK LL
Sbjct:  452 QLEEPEPLPEIKSEPKDKYQFIDGDIDSSLTVDNLERLGQLTHNG----ERKEEINGV-------LLSEAKLQSIISFLDEME----ISEQERPRSAASNTQKGALLSEEELTHLEQASAVATEVTSSMLKLRLEVQEKTRALNLLQTALAQQRELTVRHAKQTEKELGQQLKQQGEQYEATIQRHLSFIDQLIDDKKALSERCESLVKELKQVDQKYSSKISQMQEQHEMEMKKLQDLMSATEKVRREKWIDEKTKKIKEITVKGLEPEIQRLISKHKQEIRKLKALHEAELQQSDERAAQRYVRQTEEMRHNLEREKEEVSQRERELAKQRYEKHLVQEEQSLQEQRRRLFQEVSEEKERLNQQAARQRAELDELRKQL---EDNCALATRV-------------------LKEEYEKSKD---EQERRHQETWLLSRERELKEDVRKGRDREIELVIQRLESEMSTAKDECERACENRIKRIRDKYESELQELERSERKLQERCNQLKEQVTELEGEQIRLQGLLRQKEQEIEDIRKVTDCLSEERKSLSEVIRQEFADRLVLTEEENRRLKTEASEARARQRL-------ELERVNREKDEELEEVHKRVKTAIVKKEETVNSLRKQCE-----------AAVKRADHLEALLEQQRKQLL 1058          
BLAST of Centrosomal protein 131 vs. Ensembl Xenopus
Match: ptger2 (prostaglandin E receptor 2 [Source:Xenbase;Acc:XB-GENE-967341])

HSP 1 Score: 378.252 bits (970), Expect = 1.162e-111
Identity = 254/647 (39.26%), Postives = 410/647 (63.37%), Query Frame = 3
Query: 1479 KLLKPEQFKSISNAPSNPF------IDNPLTSKALK-----MHNNNIGRQSQSEINLAPTKPTQSAISDSKMNSILQFLNASEVVDDISELEGRRFTDFPTKHWNVYDVKELE--ENTQTAVNEVSTKVMTMKLELEERQRSVEMLQKALQQQRELTVRQVKETQKDMEKRMEVQKDEYESALQRNHTFIDQLISKNELLQDKCNKLVVEMKEKTQKYXXXXXXXXXXXX----------XXLKKVEAKHLAAEKLRREKWEAEKTKLIKEMTIKGMETEIAQLIANHKQELRKMKQYYENEIIQTGENSYEKYNRQVEELRKQLYKEKEEALQKENSIIKERFDQEMQRQIQILESQRKQLYQEISDERDRLNIMGNKQKAEIENLRKQLEYKEDKVGVS---MKLEHQHKLEEMQRKFDTEVRELKTQTELEKQIWIETNNKRNEAWMLSKEQEIKNEMKKNRDSEIEKVILKLEDDNTQSKQEIESSFGNKLKRAKDKYEAEIKELELSERQTKEKYNQIRGXXXXXXXXXXXXKIMIRQKEKEMDEVKQLYETLNRERDHVSDIIRQEFADRLVTTEEENRKLKREISELRAKINLMQTNHNEDLERIQLNHQSDITEVHNKVKEAIKRKEENMAELKSQYQN 3341
            +L +PE    I + P + +      ID+ LT   L+      HN     + + EIN          +S++K+ SI+ FL+  E    ISE E  R     T+   +   +EL   E       EV++ ++ ++LE++E+ R++ +LQ AL QQRELTVR  K+T+K++ ++++ Q ++YE+ +QR+ +FIDQLI   + L ++C  LV E+K+  QKY  KI  +QE +            E+KK++    A EK+RREKW  EKTK IKE+T+KG+E EI +LI+ HKQE+RK+K  +E E+ Q+ E + ++Y RQ EE+R  L +EKEE  Q+E  + K+R+++ + ++ Q L+ QR++L+QE+S+E++RLN    +Q+AE++ LRKQL   ED   ++   +K E++   +E +R+   E++ LK + E+EKQ W +   K+ E W+LS+E+E+K +++K RD EIE VI +LE + + +K E E +  N++KR +DKYE+E++ELE SER+ +E+ NQ++ +  ELE E   L+ ++RQKE+E+++++++ + L+ ER  +S++IRQEFADRLV TEEENR+LK E SE RA+  L       +LER+      ++ EVH +VK AI +KEE +  L+ Q +N
Sbjct:  452 QLEEPEPLPEIKSEPKDKYQFIDGDIDSSLTVDNLERLGQLTHNG----ERKEEINGV-------LLSEAKLQSIISFLDEME----ISEQERPRSAASNTQKGALLSEEELTHLEQASAVATEVTSSMLKLRLEVQEKTRALNLLQTALAQQRELTVRHAKQTEKELGQQLKQQGEQYEATIQRHLSFIDQLIDDKKALSERCESLVKELKQVDQKYSSKISQMQEQHEMVWQTLGPLCEEMKKLQDLMSATEKVRREKWIDEKTKKIKEITVKGLEPEIQRLISKHKQEIRKLKALHEAELQQSDERAAQRYVRQTEEMRHNLEREKEEVSQRERELAKQRYEKHLVQEEQSLQEQRRRLFQEVSEEKERLNQQAARQRAELDELRKQL---EDNCALATRVLKEEYEKSKDEQERRHQAEIKALKERLEIEKQAWEQNYMKKEETWLLSRERELKEDVRKGRDREIELVIQRLESEMSTAKDECERACENRIKRIRDKYESELQELERSERKLQERCNQLKEQVTELEGEQIRLQGLLRQKEQEIEDIRKVTDCLSEERKSLSEVIRQEFADRLVLTEEENRRLKTEASEARARQRL-------ELERVNREKDEELEEVHKRVKTAIVKKEETVNSLRKQCEN 1073          
BLAST of Centrosomal protein 131 vs. Ensembl Xenopus
Match: ptger2 (prostaglandin E receptor 2 [Source:Xenbase;Acc:XB-GENE-967341])

HSP 1 Score: 364.385 bits (934), Expect = 9.604e-110
Identity = 241/606 (39.77%), Postives = 393/606 (64.85%), Query Frame = 3
Query: 1479 KLLKPEQFKSISNAPSNP--FIDNPLTSKALKMHNNNIGRQSQSEINLAPTKPTQSAI-SDSKMNSILQFLNASEVVDDISELEGRRFTDFPTKHWNVYDVKELEENTQTAVNEVSTKVMTMKLELEERQRSVEMLQKALQQQRELTVRQVKETQKDMEKRMEVQKDEYESALQRNHTFIDQLISKNELLQDKCNKLVVEMKEKTQKYXXXXXXXXXXXXXXLKKVEAKHLAAEKLRREKWEAEKTKLIKEMTIKGMETEIAQLIANHKQELRKMKQYYENEIIQTGENSYEKYNRQVEELRKQLYKEKEEALQKENSIIKERFDQEMQRQIQILESQRKQLYQEISDERDRLNIMGNKQKAEIENLRKQLEYKEDKVGVS---MKLEHQHKLEEMQRKFDTEVRELKTQTELEKQIWIETNNKRNEAWMLSKEQEIKNEMKKNRDSEIEKVILKLEDDNTQSKQEIESSFGNKLKRAKDKYEAEIKELELSERQTKEKYNQIRGXXXXXXXXXXXXKIMIRQKEKEMDEVKQLYETLNRERDHVSDIIRQEFADRLVTTEEENRKLKREISELRAKINLMQTNHNEDLERIQLNHQSDITEVHNK 3278
            +L +PE    I + P +   FID    S    +  +N+ R  Q   N    +     + S++K+ SI+ FL+  E    ISE E  R             +  LE+ +  A  EV++ ++ ++LE++E+ R++ +LQ AL QQRELTVR  K+T+K++ ++++ Q ++YE+ +QR+ +FIDQLI   + L ++C  LV E+K+  QKY  KI  +QE + +E+KK++    A EK+RREKW  EKTK IKE+T+KG+E EI +LI+ HKQE+RK+K  +E E+ Q+ E + ++Y RQ EE+R  L +EKEE  Q+E  + K+R+++ + ++ Q L+ QR++L+QE+S+E++RLN    +Q+AE++ LRKQL   ED   ++   +K E++   +E +R+   E++ LK + E+EKQ W +   K+ E W+LS+E+E+K +++K RD EIE VI +LE + + +K E E +  N++KR +DKYE+E++ELE SER+ +E+ NQ++ +  ELE E   L+ ++RQKE+E+++++++ + L+ ER  +S++IRQEFADRLV TEEENR+LK E SE RA+  L       +LER+      ++ EVH +
Sbjct:  155 QLEEPEPLPEIKSEPKDKYQFIDGVRDSS---LTVDNLERLGQLTHNGERKEEINGVLLSEAKLQSIISFLDEME----ISEQERPR------------SLTHLEQASAVAT-EVTSSMLKLRLEVQEKTRALNLLQTALAQQRELTVRHAKQTEKELGQQLKQQGEQYEATIQRHLSFIDQLIDDKKALSERCESLVKELKQVDQKYSSKISQMQEQHEMEMKKLQDLMSATEKVRREKWIDEKTKKIKEITVKGLEPEIQRLISKHKQEIRKLKALHEAELQQSDERAAQRYVRQTEEMRHNLEREKEEVSQRERELAKQRYEKHLVQEEQSLQEQRRRLFQEVSEEKERLNQQAARQRAELDELRKQL---EDNCALATRVLKEEYEKSKDEQERRHQAEIKALKERLEIEKQAWEQNYMKKEETWLLSRERELKEDVRKGRDREIELVIQRLESEMSTAKDECERACENRIKRIRDKYESELQELERSERKLQERCNQLKEQVTELEGEQIRLQGLLRQKEQEIEDIRKVTDCLSEERKSLSEVIRQEFADRLVLTEEENRRLKTEASEARARQRL-------ELERVNREKDEELEEVHKR 730          
BLAST of Centrosomal protein 131 vs. Ensembl Mouse
Match: Cep131 (centrosomal protein 131 [Source:MGI Symbol;Acc:MGI:107440])

HSP 1 Score: 365.54 bits (937), Expect = 2.231e-107
Identity = 234/613 (38.17%), Postives = 394/613 (64.27%), Query Frame = 3
Query: 1608 INLAPTKPTQSAI-SDSKMNSILQFLNASEVVDDISELEGRRFTDFPTKHWNVYDVKELEENTQTAVNEVSTKVMTMKLELEERQRSVEMLQKALQQQRELTVRQVKETQKDMEKRMEVQKDEYESALQRNHTFIDQLISKNELLQDKCNKLVVEMKEKTQKYXXXXXXXXXXXXXXLKKVEAKHLAAEKLRREKWEAEKTKLIKEMTIKGMETEIAQLIANHKQELRKMKQYYENEIIQTGENSYEKYNRQVEELRKQLYKEKEEALQKENSIIKERFDQEMQRQIQILESQRKQLYQEISDERDRLNIMGNKQKAEIENLRKQLEYKEDKVGVSMKLEHQHKLEEMQRKFDTEVRELKTQTELEKQIWIETNNKRNEAWMLSKEQEIKNEMKKNRDSEIEKVILKLEDDNTQSKQEIESSFGNKLKRAKDKYEAEIKELELSERQTKEKYNQIRGXXXXXXXXXXXXKIMIRQKEKEMDEVKQLYETLNRERDHVSDIIRQEFADRLVTTEEENRKLKREISELRAKINLMQTNHNEDLERIQLNHQSDITEVHNKVKEAIKRKEENMAELKSQYQNETSLWQQKLAAAEKRSNHLESLLEQQRKHLLNLK 3443
            ++ AP  P    + S++K+ SI+ FL+         E+E +   + P   W    V E    +     E ST VM +KLELEE+++++ +LQ+AL QQR+LTVR+VKET+K++ +++  QK++YE+ +QR+ +FIDQLI   ++L +KC  +V E+K   Q+  E++  +QE + +E+KK++    A EK+RREKW  EKTK IKE+T++G+E EI +LIA HKQE+R+++  +E E+ Q  E + +++ RQ EELR+ L +E+E   Q+E    ++RF+Q ++++ + LE QR++LY E+++E++RL     +Q+AE+E LR+QLE     +  +++ E +   EE +R+   E++ LK Q E E+Q W+ +  K+ EAW+L++E+E+K E++K RD EIE VI +LE D T +K+E E +  +++KR +DKYE E+ ELE SER+ +E+ ++++G   E E E E L+ ++RQKEKE+++++ +   +  ER  ++ ++RQEFA++L  ++EE +++K E++EL+A+                   Q ++ EVH +VK A+ RKE  +  L+ Q++           AA KR++HLE LLEQ +   L+ K
Sbjct:  492 LSAAPGPPDDGTLLSEAKLQSIMTFLD---------EME-KSGQERPAP-WRESLVLEAGSGS-----EGSTSVMRLKLELEEKKQAMALLQRALAQQRDLTVRRVKETEKELTRQLRQQKEQYEATIQRHLSFIDQLIEDKKVLSEKCEAVVAELKHGDQRCRERVAQMQEQHELEIKKLKELMSATEKIRREKWINEKTKKIKEITVRGLEPEIQKLIAKHKQEVRRLRGLHEAELQQREEQAAQRHLRQAEELRQHLDREREVLGQQERERAQQRFEQHLEQEQRALEQQRRRLYNEVAEEKERLGQQAARQRAELEELRQQLEESSAALTRALRAEFERSREEQERRHQMELKALKDQLEAERQAWVASCAKKEEAWLLTRERELKEEIRKGRDQEIELVIHRLEADMTLAKEESERAAESRVKRVRDKYETELSELEQSERKLQERCSELKGRLGEAEGEKERLQSLVRQKEKELEDLRAVNTQMCSERASLAQVVRQEFAEQLAASQEETQRVKVELAELQAR------------------QQVELDEVHRRVKTALARKEAAVNSLRKQHE-----------AAVKRADHLEELLEQHKGSSLSSK 1059          
BLAST of Centrosomal protein 131 vs. Ensembl Mouse
Match: Cep131 (centrosomal protein 131 [Source:MGI Symbol;Acc:MGI:107440])

HSP 1 Score: 365.54 bits (937), Expect = 2.534e-107
Identity = 234/613 (38.17%), Postives = 394/613 (64.27%), Query Frame = 3
Query: 1608 INLAPTKPTQSAI-SDSKMNSILQFLNASEVVDDISELEGRRFTDFPTKHWNVYDVKELEENTQTAVNEVSTKVMTMKLELEERQRSVEMLQKALQQQRELTVRQVKETQKDMEKRMEVQKDEYESALQRNHTFIDQLISKNELLQDKCNKLVVEMKEKTQKYXXXXXXXXXXXXXXLKKVEAKHLAAEKLRREKWEAEKTKLIKEMTIKGMETEIAQLIANHKQELRKMKQYYENEIIQTGENSYEKYNRQVEELRKQLYKEKEEALQKENSIIKERFDQEMQRQIQILESQRKQLYQEISDERDRLNIMGNKQKAEIENLRKQLEYKEDKVGVSMKLEHQHKLEEMQRKFDTEVRELKTQTELEKQIWIETNNKRNEAWMLSKEQEIKNEMKKNRDSEIEKVILKLEDDNTQSKQEIESSFGNKLKRAKDKYEAEIKELELSERQTKEKYNQIRGXXXXXXXXXXXXKIMIRQKEKEMDEVKQLYETLNRERDHVSDIIRQEFADRLVTTEEENRKLKREISELRAKINLMQTNHNEDLERIQLNHQSDITEVHNKVKEAIKRKEENMAELKSQYQNETSLWQQKLAAAEKRSNHLESLLEQQRKHLLNLK 3443
            ++ AP  P    + S++K+ SI+ FL+         E+E +   + P   W    V E    +     E ST VM +KLELEE+++++ +LQ+AL QQR+LTVR+VKET+K++ +++  QK++YE+ +QR+ +FIDQLI   ++L +KC  +V E+K   Q+  E++  +QE + +E+KK++    A EK+RREKW  EKTK IKE+T++G+E EI +LIA HKQE+R+++  +E E+ Q  E + +++ RQ EELR+ L +E+E   Q+E    ++RF+Q ++++ + LE QR++LY E+++E++RL     +Q+AE+E LR+QLE     +  +++ E +   EE +R+   E++ LK Q E E+Q W+ +  K+ EAW+L++E+E+K E++K RD EIE VI +LE D T +K+E E +  +++KR +DKYE E+ ELE SER+ +E+ ++++G   E E E E L+ ++RQKEKE+++++ +   +  ER  ++ ++RQEFA++L  ++EE +++K E++EL+A+                   Q ++ EVH +VK A+ RKE  +  L+ Q++           AA KR++HLE LLEQ +   L+ K
Sbjct:  493 LSAAPGPPDDGTLLSEAKLQSIMTFLD---------EME-KSGQERPAP-WRESLVLEAGSGS-----EGSTSVMRLKLELEEKKQAMALLQRALAQQRDLTVRRVKETEKELTRQLRQQKEQYEATIQRHLSFIDQLIEDKKVLSEKCEAVVAELKHGDQRCRERVAQMQEQHELEIKKLKELMSATEKIRREKWINEKTKKIKEITVRGLEPEIQKLIAKHKQEVRRLRGLHEAELQQREEQAAQRHLRQAEELRQHLDREREVLGQQERERAQQRFEQHLEQEQRALEQQRRRLYNEVAEEKERLGQQAARQRAELEELRQQLEESSAALTRALRAEFERSREEQERRHQMELKALKDQLEAERQAWVASCAKKEEAWLLTRERELKEEIRKGRDQEIELVIHRLEADMTLAKEESERAAESRVKRVRDKYETELSELEQSERKLQERCSELKGRLGEAEGEKERLQSLVRQKEKELEDLRAVNTQMCSERASLAQVVRQEFAEQLAASQEETQRVKVELAELQAR------------------QQVELDEVHRRVKTALARKEAAVNSLRKQHE-----------AAVKRADHLEELLEQHKGSSLSSK 1060          
BLAST of Centrosomal protein 131 vs. Ensembl Mouse
Match: Cep131 (centrosomal protein 131 [Source:MGI Symbol;Acc:MGI:107440])

HSP 1 Score: 365.155 bits (936), Expect = 2.855e-107
Identity = 234/613 (38.17%), Postives = 394/613 (64.27%), Query Frame = 3
Query: 1608 INLAPTKPTQSAI-SDSKMNSILQFLNASEVVDDISELEGRRFTDFPTKHWNVYDVKELEENTQTAVNEVSTKVMTMKLELEERQRSVEMLQKALQQQRELTVRQVKETQKDMEKRMEVQKDEYESALQRNHTFIDQLISKNELLQDKCNKLVVEMKEKTQKYXXXXXXXXXXXXXXLKKVEAKHLAAEKLRREKWEAEKTKLIKEMTIKGMETEIAQLIANHKQELRKMKQYYENEIIQTGENSYEKYNRQVEELRKQLYKEKEEALQKENSIIKERFDQEMQRQIQILESQRKQLYQEISDERDRLNIMGNKQKAEIENLRKQLEYKEDKVGVSMKLEHQHKLEEMQRKFDTEVRELKTQTELEKQIWIETNNKRNEAWMLSKEQEIKNEMKKNRDSEIEKVILKLEDDNTQSKQEIESSFGNKLKRAKDKYEAEIKELELSERQTKEKYNQIRGXXXXXXXXXXXXKIMIRQKEKEMDEVKQLYETLNRERDHVSDIIRQEFADRLVTTEEENRKLKREISELRAKINLMQTNHNEDLERIQLNHQSDITEVHNKVKEAIKRKEENMAELKSQYQNETSLWQQKLAAAEKRSNHLESLLEQQRKHLLNLK 3443
            ++ AP  P    + S++K+ SI+ FL+         E+E +   + P   W    V E    +     E ST VM +KLELEE+++++ +LQ+AL QQR+LTVR+VKET+K++ +++  QK++YE+ +QR+ +FIDQLI   ++L +KC  +V E+K   Q+  E++  +QE + +E+KK++    A EK+RREKW  EKTK IKE+T++G+E EI +LIA HKQE+R+++  +E E+ Q  E + +++ RQ EELR+ L +E+E   Q+E    ++RF+Q ++++ + LE QR++LY E+++E++RL     +Q+AE+E LR+QLE     +  +++ E +   EE +R+   E++ LK Q E E+Q W+ +  K+ EAW+L++E+E+K E++K RD EIE VI +LE D T +K+E E +  +++KR +DKYE E+ ELE SER+ +E+ ++++G   E E E E L+ ++RQKEKE+++++ +   +  ER  ++ ++RQEFA++L  ++EE +++K E++EL+A+                   Q ++ EVH +VK A+ RKE  +  L+ Q++           AA KR++HLE LLEQ +   L+ K
Sbjct:  493 LSAAPGPPDDGTLLSEAKLQSIMTFLD---------EME-KSGQERPAP-WRESLVLEAGSGS-----EGSTSVMRLKLELEEKKQAMALLQRALAQQRDLTVRRVKETEKELTRQLRQQKEQYEATIQRHLSFIDQLIEDKKVLSEKCEAVVAELKHGDQRCRERVAQMQEQHELEIKKLKELMSATEKIRREKWINEKTKKIKEITVRGLEPEIQKLIAKHKQEVRRLRGLHEAELQQREEQAAQRHLRQAEELRQHLDREREVLGQQERERAQQRFEQHLEQEQRALEQQRRRLYNEVAEEKERLGQQAARQRAELEELRQQLEESSAALTRALRAEFERSREEQERRHQMELKALKDQLEAERQAWVASCAKKEEAWLLTRERELKEEIRKGRDQEIELVIHRLEADMTLAKEESERAAESRVKRVRDKYETELSELEQSERKLQERCSELKGRLGEAEGEKERLQSLVRQKEKELEDLRAVNTQMCSERASLAQVVRQEFAEQLAASQEETQRVKVELAELQAR------------------QQVELDEVHRRVKTALARKEAAVNSLRKQHE-----------AAVKRADHLEELLEQHKGSSLSSK 1060          
BLAST of Centrosomal protein 131 vs. UniProt/SwissProt
Match: sp|U3JAG9|CP131_DANRE (Centrosomal protein of 131 kDa OS=Danio rerio OX=7955 GN=cep131 PE=1 SV=1)

HSP 1 Score: 407.527 bits (1046), Expect = 2.925e-121
Identity = 284/726 (39.12%), Postives = 456/726 (62.81%), Query Frame = 3
Query: 1311 GKSTNRGSEITTIDDILSTIKELESVDCLTDRSSKFDMKSNQANKCRWSAITEDIDKLLKPEQFKSISNAPSNPFIDNPLTSKALKMHNNNIGRQSQSEINLAPTKPTQSAI-SDSKMNSILQFLNASEVVDDISELEGRRFTDFPTKHWNVY----DVKELEENTQTAVNEVSTKVMTMKLELEERQRSVEMLQKALQQQRELTVRQVKETQKDMEKRMEVQKDEYESALQRNHTFIDQLISKNELLQDKCNKLVVEMKEKTQKYXXXXXXXXXXXX----------XXLKKVEAKHLAAEKLRREKWEAEKTKLIKEMTIKGMETEIAQLIANHKQELRKMKQYYENEIIQTGENSYEKYNRQVEELRKQLYKEKEEALQKENSIIKERFDQEMQRQIQILESQRKQLYQEISDERDRLNIMGNKQKAEIENLRKQLEYKEDKVGVSMKLEHQHKLEEMQRKFDTEVRELKTQTELEKQIWIETNNKRNEAWMLSKEQEIKNEMKKNRDSEIEKVILKLEDDNTQSKQEIESSFGNKLKRAKDKYEAEIKELELSERQTKEKYNQIRGXXXXXXXXXXXXKIMIRQKEKEMDEVKQLY--ETLNRERDHVSDIIRQEFADRLVTTEEENRKLKREISELRAKINLMQTNHNEDLERIQLNHQSDITEVHNKVKEAIKRKEENMAELKSQYQNETSLWQQKLAAAEKRSNHLESLLEQQRKHLLN 3437
            G S++R    TT++D+L T+K LE      +R S  + KS + +K  W  I ED D                     N LT+       +N+ R  Q  ++  P  P   A+ S++K+ SI+ FL+  E     SE E  R     + H  V     D+  +E+ + TA  EV+  +M ++LEL+E++R+V MLQ AL QQRELT+R VKET+K++    ++QK++YE+ +QR+ TFIDQLI   + L ++C ++V E+K+  QKY +KI  +QE +            E+KK++    A EK+RREKW  EKTK IKE+T+KG+E EI +LI+ HKQEL+K++  +E E++Q  E + ++Y RQ EELR+QL KEK+E  Q+E  + K+RF++++Q +  +L+ QR++LY+E+S+E++RL  +  +Q AE+E+LRKQLE      G +++ E +   +E +R+   E++ LK + E+EKQ W E   K+ EAW+LS+E+E+K E+++ RD EIE  I +LE +  ++++E E +  N++KR ++KYEAE+++LE SER + +K  ++R +  E+E+E   L+ ++RQ+E+E+ ++ Q+   + L+ ER  +S++IRQEFA+RL+  EEENR++K E+SE +A++ L       ++ER+    + ++ EVH +VK AI +KEE +  L+ Q++           AA KR++HLESLLEQQRK LL 
Sbjct:  447 GASSSRAQSKTTLNDLLDTLKLLEEE---PERLS--EPKSYRKDKYSW--IDEDGD--------------------SNSLTT-------DNVERHRQ--LSQTPALPDGGALLSEAKLQSIMSFLDEMEK----SEQERPRSVTSGS-HREVVLSEEDLAVVEQASATAA-EVTGSMMRLRLELDEKKRTVNMLQTALAQQRELTIRHVKETEKELNHTFQLQKEQYEATIQRHLTFIDQLIDDKKALSERCEEVVGELKQVDQKYTKKIAQMQEQHELVWQILGPMCEEIKKLKELMSATEKVRREKWINEKTKKIKEITVKGLEPEIQKLISKHKQELKKLRVLHEAELLQADERAAQRYVRQSEELRQQLEKEKDEQCQRERELAKQRFEKQLQEEENVLQQQRRRLYKEVSEEKERLTQLAARQHAELEDLRKQLEDNSSLAGRALREELEKSRDEQERRHQVEIKALKERLEIEKQTWEENYMKKEEAWLLSRERELKEEVRRGRDKEIELAIQRLEVETREAREECERAADNRMKRVREKYEAELRDLERSERTSLQKQQEMREKHSEMEAELLRLQSLLRQREQEISDLTQVTARDKLSEERRSLSEVIRQEFAERLIELEEENRRMKMEVSEAKARLRL-------EVERVTREKEEELAEVHQRVKSAILKKEETVNNLRKQHE-----------AAVKRADHLESLLEQQRKQLLG 1112          
BLAST of Centrosomal protein 131 vs. UniProt/SwissProt
Match: sp|Q9UPN4|CP131_HUMAN (Centrosomal protein of 131 kDa OS=Homo sapiens OX=9606 GN=CEP131 PE=1 SV=3)

HSP 1 Score: 370.933 bits (951), Expect = 3.102e-108
Identity = 234/594 (39.39%), Postives = 384/594 (64.65%), Query Frame = 3
Query: 1644 ISDSKMNSILQFLNASEVVDDISELEGRRFTDFPTKHWNVYDVKELEENTQTAVNEVSTKVMTMKLELEERQRSVEMLQKALQQQRELTVRQVKETQKDMEKRMEVQKDEYESALQRNHTFIDQLISKNELLQDKCNKLVVEMKEKTQKYXXXXXXXXXXXXXXLKKVEAKHLAAEKLRREKWEAEKTKLIKEMTIKGMETEIAQLIANHKQELRKMKQYYENEIIQTGENSYEKYNRQVEELRKQLYKEKEEALQKENSIIKERFDQEMQRQIQILESQRKQLYQEISDERDRLNIMGNKQKAEIENLRKQLEYKEDKVGVSMKLEHQHKLEEMQRKFDTEVRELKTQTELEKQIWIETNNKRNEAWMLSKEQEIKNEMKKNRDSEIEKVILKLEDDNTQSKQEIESSFGNKLKRAKDKYEAEIKELELSERQTKEKYNQIRGXXXXXXXXXXXXKIMIRQKEKEMDEVKQLYETLNRERDHVSDIIRQEFADRLVTTEEENRKLKREISELRAKINLMQTNHNEDLERIQLNHQSDITEVHNKVKEAIKRKEENMAELKSQYQNETSLWQQKLAAAEKRSNHLESLLEQQRK 3425
            +S++K+ SI+ FL       D  E  G+   D   + W    V E         +EVST VM +KLE+EE+++++ +LQ+AL QQR+LT R+VKET+K + ++++ Q++ YE+ +QR+  FIDQLI   ++L +KC  +V E+K++ Q+  E++   Q  + +E+KK++    A EK RREKW +EKTK IKE+T++G+E EI +LIA HKQE+R++K  +E E++Q+ E + ++  RQ EELR+QL +EKE   Q+E    ++RF Q ++++   L+ QR++LY E+++ER+RL     +Q+AE+E LR+QLE     +  +++ E +   EE +R+   E+  LK Q ELE+Q W     ++ EAW+L++EQE++ E++K RD EIE VI +LE D   +K+E E +  +++KR +DKYEAE+ ELE SER+ +E+ ++++G+  E E E+  L+ ++RQKE+ +++ + + E L+ ER +++ +IRQEF DRL  +EEE R+ K E++ L+A+  L                  ++ EVH +VK A+ RKEE ++ L++Q++           AA KR++HLE LLEQ R+
Sbjct:  524 LSEAKLQSIMSFL-------DEMEKSGQDQLDSQQEGW----VPEAGPGPLELGSEVSTSVMRLKLEVEEKKQAMLLLQRALAQQRDLTARRVKETEKALSRQLQRQREHYEATIQRHLAFIDQLIEDKKVLSEKCEAVVAELKQEDQRCTERVAQAQAQHELEIKKLKELMSATEKARREKWISEKTKKIKEVTVRGLEPEIQKLIARHKQEVRRLKSLHEAELLQSDERASQRCLRQAEELREQLEREKEALGQQERERARQRFQQHLEQEQWALQQQRQRLYSEVAEERERLGQQAARQRAELEELRQQLEESSSALTRALRAEFEKGREEQERRHQMELNTLKQQLELERQAWEAGRTRKEEAWLLNREQELREEIRKGRDKEIELVIHRLEADMALAKEESEKAAESRIKRLRDKYEAELSELEQSERKLQERCSELKGQLGEAEGENLRLQGLVRQKERALEDAQAVNEQLSSERSNLAQVIRQEFEDRLAASEEETRQAKAELATLQARQQL------------------ELEEVHRRVKTALARKEEAVSSLRTQHE-----------AAVKRADHLEELLEQHRR 1077          
BLAST of Centrosomal protein 131 vs. UniProt/SwissProt
Match: sp|Q62036|CP131_MOUSE (Centrosomal protein of 131 kDa OS=Mus musculus OX=10090 GN=Cep131 PE=1 SV=2)

HSP 1 Score: 365.155 bits (936), Expect = 1.997e-106
Identity = 234/613 (38.17%), Postives = 394/613 (64.27%), Query Frame = 3
Query: 1608 INLAPTKPTQSAI-SDSKMNSILQFLNASEVVDDISELEGRRFTDFPTKHWNVYDVKELEENTQTAVNEVSTKVMTMKLELEERQRSVEMLQKALQQQRELTVRQVKETQKDMEKRMEVQKDEYESALQRNHTFIDQLISKNELLQDKCNKLVVEMKEKTQKYXXXXXXXXXXXXXXLKKVEAKHLAAEKLRREKWEAEKTKLIKEMTIKGMETEIAQLIANHKQELRKMKQYYENEIIQTGENSYEKYNRQVEELRKQLYKEKEEALQKENSIIKERFDQEMQRQIQILESQRKQLYQEISDERDRLNIMGNKQKAEIENLRKQLEYKEDKVGVSMKLEHQHKLEEMQRKFDTEVRELKTQTELEKQIWIETNNKRNEAWMLSKEQEIKNEMKKNRDSEIEKVILKLEDDNTQSKQEIESSFGNKLKRAKDKYEAEIKELELSERQTKEKYNQIRGXXXXXXXXXXXXKIMIRQKEKEMDEVKQLYETLNRERDHVSDIIRQEFADRLVTTEEENRKLKREISELRAKINLMQTNHNEDLERIQLNHQSDITEVHNKVKEAIKRKEENMAELKSQYQNETSLWQQKLAAAEKRSNHLESLLEQQRKHLLNLK 3443
            ++ AP  P    + S++K+ SI+ FL+         E+E +   + P   W    V E    +     E ST VM +KLELEE+++++ +LQ+AL QQR+LTVR+VKET+K++ +++  QK++YE+ +QR+ +FIDQLI   ++L +KC  +V E+K   Q+  E++  +QE + +E+KK++    A EK+RREKW  EKTK IKE+T++G+E EI +LIA HKQE+R+++  +E E+ Q  E + +++ RQ EELR+ L +E+E   Q+E    ++RF+Q ++++ + LE QR++LY E+++E++RL     +Q+AE+E LR+QLE     +  +++ E +   EE +R+   E++ LK Q E E+Q W+ +  K+ EAW+L++E+E+K E++K RD EIE VI +LE D T +K+E E +  +++KR +DKYE E+ ELE SER+ +E+ ++++G   E E E E L+ ++RQKEKE+++++ +   +  ER  ++ ++RQEFA++L  ++EE +++K E++EL+A+                   Q ++ EVH +VK A+ RKE  +  L+ Q++           AA KR++HLE LLEQ +   L+ K
Sbjct:  493 LSAAPGPPDDGTLLSEAKLQSIMTFLD---------EME-KSGQERPAP-WRESLVLEAGSGS-----EGSTSVMRLKLELEEKKQAMALLQRALAQQRDLTVRRVKETEKELTRQLRQQKEQYEATIQRHLSFIDQLIEDKKVLSEKCEAVVAELKHGDQRCRERVAQMQEQHELEIKKLKELMSATEKIRREKWINEKTKKIKEITVRGLEPEIQKLIAKHKQEVRRLRGLHEAELQQREEQAAQRHLRQAEELRQHLDREREVLGQQERERAQQRFEQHLEQEQRALEQQRRRLYNEVAEEKERLGQQAARQRAELEELRQQLEESSAALTRALRAEFERSREEQERRHQMELKALKDQLEAERQAWVASCAKKEEAWLLTRERELKEEIRKGRDQEIELVIHRLEADMTLAKEESERAAESRVKRVRDKYETELSELEQSERKLQERCSELKGRLGEAEGEKERLQSLVRQKEKELEDLRAVNTQMCSERASLAQVVRQEFAEQLAASQEETQRVKVELAELQAR------------------QQVELDEVHRRVKTALARKEAAVNSLRKQHE-----------AAVKRADHLEELLEQHKGSSLSSK 1060          
BLAST of Centrosomal protein 131 vs. UniProt/SwissProt
Match: sp|A1Z7Z9|CP131_DROME (Centrosomal protein of 131 kDa OS=Drosophila melanogaster OX=7227 GN=dila PE=2 SV=2)

HSP 1 Score: 134.806 bits (338), Expect = 1.730e-30
Identity = 136/601 (22.63%), Postives = 301/601 (50.08%), Query Frame = 3
Query: 1647 SDSKMNSILQFLNASEVVDDISELEGRRF--------TDFPTKHWNVYDVKELEENTQTAVNEVSTKVMTMKLELEERQRSVEMLQKALQQQRELTVRQVKETQKDMEKRMEVQKDEYESALQRNHTFIDQLISKNELLQDKCNKLVVEMKEKTQKYXXXXXXXXXXXXXXLKKVEAKHLAAEKLRREKWEAEKTKLIKEMTIKGMETEIAQLIANHKQELRKMKQYYENEIIQTGENSYEKYNRQVEELRKQLYKEKEEALQKENSIIKERFDQEMQRQIQILESQRKQLYQEISDERDRLNIMGNKQKAEIENLRKQLEYKEDKVGVSMKLEHQHKLEEMQRKFDTEVRELKTQTELEKQIWIETNNKRNEAWMLSKEQEIKNEMKKNRDSEIEKVILKLEDDNTQSKQEIESSFGNKLKRAKDKYEAEIKELELSERQTKEKYNQIRGXXXXXXXXXXXXKIMIRQKEKEMDEVKQLYETLNRERDHVSDIIRQEFADRLVTTEEENRKLKREISELRAKINLMQTNHNEDLERIQLNHQSDITEVHNKVKEAIKRKEENMAELKSQYQNETSLWQQKLAAAEKRSNHLESLLEQQRK 3425
            S  K   IL +LN  E   D + +E RR          +F  +     +V +L E      ++++ +V+ + L   E   ++ M ++ + Q R    + ++  +     ++  QK  YE  + R+  FI+QL+     L +K   L   ++ + Q +E +++         L + +   +A EK+RRE+W  E TK IKE+T+KG+E EI ++  +H++E+ ++K+ ++ +++   E +  K+ +    +R+   +++E  ++KE + I+ERF+++++ + +    QR++L +E + ERDRL     +++ E +  R++   ++++     K E Q ++ + + K+   V  ++ Q + + ++W   +  + +     KE  I+   +  RD +++++++++E D  Q K+E E     K+ R K+KYE ++   E  E+  +EKY + RG+  E +++  + +  ++Q + E+   K++   +  ERD + D +                      +++++++ ++   H ++++++Q            +V + I+R+EE +  LK    +  +L QQ L         L +++ QQRK
Sbjct:  583 SGDKYKDILAYLNNVESSCDKTLMETRRSIPDSNRSEVEFVVEPDVTDEVPKLSELLMLPNHQLARRVIALSLRANELANAIHMSKEHVFQLRGEKQKSLRAEKSTAAAKLRDQKKHYEEVVTRHQGFIEQLLKDKGSLCEKVAALTRRLESQNQAWEHRLETE-------LARTKETTMAGEKIRRERWVRENTKKIKELTVKGLEAEINKMNCDHQREVTELKRTHQMQLLDALEEARTKHEQIETSIRESCAQDREAIIEKERTAIRERFERQLEEEQRTQAEQRQKLTEEFAAERDRLQSELRQRENEHQARRQEALREQEQELEQAKFEMQERMAKQEEKYQNRVNTIEQQYQADFELWKTEHENKTKLAQAEKENAIRQHYRAERDRQLDELVVRMEADALQHKEEHEL----KMNRLKEKYEKDLVLAESVEKSLREKYAETRGKLAEADAQVRNSQAEVKQLQLELSHSKKMCGDIIMERDRLRDNLN---------------------ADIQSELGVLNERHKQEMDQLQ-----------KRVHQTIQRQEETIEILKG---DNDALRQQCL--------KLNAVIRQQRK 1129          
BLAST of Centrosomal protein 131 vs. TrEMBL
Match: A0A2T7PW04 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_00211 PE=4 SV=1)

HSP 1 Score: 437.958 bits (1125), Expect = 1.630e-129
Identity = 299/729 (41.02%), Postives = 462/729 (63.37%), Query Frame = 3
Query: 1278 PVEEKS-ICENDGKSTNRGSEI---TTIDDILSTIKELESVD-CLTDRSSKFDMKSNQANKCRWSAITEDIDKLLKPEQFKSISNAPSNPFIDNPLTSKALKMHNNNIGRQSQSEINLAPTKPTQSAISDSKMNSILQFLNASEVVDDISELEG---RRFTDFPTKHWNVYDVKEL--EENTQTAVNEVSTKVMTMKLELEERQRSVEMLQKALQQQRELTVRQVKETQKDMEKRMEVQKDEYESALQRNHTFIDQLISKNELLQDKCNKLVVEMKEKTQKYXXXXXXXXXXXXXXLKKVEAKHLAAEKLRREKWEAEKTKLIKEMTIKGMETEIAQLIANHKQELRKMKQYYENEIIQTGENSYEKYNRQVEELRKQLYKEKEEALQKENSIIKERFDQEMQRQIQILESQRKQLYQEISDERDRLNIMGNKQKAEIENLRKQLEYKEDKVGVSMKLEHQHKLEEMQRKFDTEVRELKTQTELEKQIWIETNNKRNEAWMLSKEQEIKNEMKKNRDSEIEKVILKLEDDNTQSKQEIESSFGNKLKRAKDKYEAEIKELELSERQTKEKYNQIRGXXXXXXXXXXXXKIMIRQKEKEMDEVKQLYETLNRERDHVSDIIRQEFADRLVTTEEENRKLKREISELRAKINLMQTNHNEDLERIQLNHQSDITEVHNKVKEAIKRKEENMAELKSQYQNETSLWQQKLAAAEKRSNHLESLLEQQRKHLL 3434
            P+EE   +   DGK  + G+ +   TT+ D+  T+++LE  +  LT RS K                T  +DKL K EQ    SN          LT++ L+  N    + S+S            +++D K+ SI+ FL+  +V D +SE++    R   +       V    E+   E  QT  +EV+  V++ +LELEE+ R+V MLQKAL QQRELTVR  KET+K+M++R++ QK+EYE A++R+ +FIDQLI   ++L +KC +LV E+K   +KY++KIK+++E++ +E+ K++    AAEKLRREKW  EKTK IKEMT+KG+E EI +LIA HK EL+K+K  +E E+++  E + ++Y +  EELR QL KEKE A  +E  I KER+++++Q++ +  + QR++LY E+ DE+DR+    ++Q+ E+++LR QLE    +   +MK E +   EE +R+   EVR L+ + +LEK+ W E   K++  W+  KE+E+K +    RD EIE VI +LE+D   +++EI+ S   K++R ++K+EAE +ELE SER+  +KYN+I+    E+E E+E LK++I+QK++E+ + K++   ++ ER HVSDIIRQEFADR+V TEEEN+++K EI+ELRAK  +       ++E I+     ++ EVH +VK+AI +KEE +++L+ QYQ           AA KR++HLE LL+QQRKHLL
Sbjct:  484 PLEESDRVAPADGKG-DPGTLVATRTTLSDLYDTLRKLEEEEHFLTQRSEKR---------------TSLLDKLEKDEQESKGSN----------LTAENLEKLNAAKEQLSKS-----------GSLTDDKLKSIMSFLHEVQVSDRLSEIDAEIHRMNEELEKPALLVPSPDEILQMEKAQTMASEVTNTVLSQRLELEEKGRTVSMLQKALNQQRELTVRHAKETEKEMKRRLDFQKEEYEEAVKRHLSFIDQLIDDKKVLSEKCEQLVKELKTVDRKYQDKIKSVEESHAIEITKLKEIQAAAEKLRREKWIDEKTKKIKEMTVKGLEPEIQRLIAKHKAELKKVKHVHEAELLEADERAAQRYVKMTEELRDQLAKEKEAACAREREIAKERYEKQLQQEEEAFQQQRRRLYSEVQDEKDRIATNASRQRQELDSLRHQLEDTHRQALTAMKEEFEKAREEQERRHLAEVRGLQERLQLEKEAWEENYKKKHSTWLAQKERELKEQAHHERDKEIELVITRLEEDACAAREEIDKSSEAKIRRLREKFEAETRELENSERRAVQKYNEIKARATEVEGENERLKVIIKQKDEEIRDTKKVLHKMSEERGHVSDIIRQEFADRIVATEEENKRIKNEIAELRAKHRIELDRAKAEIEEIKKAKDEEMEEVHKRVKQAIVKKEEVVSQLRQQYQ-----------AACKRADHLEGLLDQQRKHLL 1164          
BLAST of Centrosomal protein 131 vs. TrEMBL
Match: A0A2C9M5K1 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106063262 PE=4 SV=1)

HSP 1 Score: 439.113 bits (1128), Expect = 2.028e-129
Identity = 287/708 (40.54%), Postives = 459/708 (64.83%), Query Frame = 3
Query: 1341 TTIDDILSTIKELESV-DCLTDRSSKFDMKSNQANKCRWSAITEDIDKLLKPEQFKSISNAPSNPFIDNPLTSKALKMHNNNIGRQSQSEINLAPTKPTQSAISDSKMNSILQFLNASEVVDDISELE---GRRFTDFPTKHWNV---YDVKELEENTQTAVNEVSTKVMTMKLELEERQRSVEMLQKALQQQRELTVRQVKETQKDMEKRMEVQKDEYESALQRNHTFIDQLISKNELLQDKCNKLVVEMKEKTQKYXXXXXXXXXXXXXXLKKVEAKHLAAEKLRREKWEAEKTKLIKEMTIKGMETEIAQLIANHKQELRKMKQYYENEIIQTGENSYEKYNRQVEELRKQLYKEKEEALQKENSIIKERFDQEMQRQIQILESQRKQLYQEISDERDRLNIMGNKQKAEIENLRKQLEYKEDKVGVSMKLEHQHKLEEMQRKFDTEVRELKTQTELEKQIWIETNNKRNEAWMLSKEQEIKNEMKKNRDSEIEKVILKLEDDNTQSKQEIESSFGNKLKRAKDKYEAEIKELELSERQTKEKYNQIRGXXXXXXXXXXXXKIMIRQKEKEMDEVKQLYETLNRERDHVSDIIRQEFADRLVTTEEENRKLKREISELRAKINLMQTNHNEDLERIQLNHQSDITEVHNKVKEAIKRKEENMAELKSQYQNETSLWQQKLAAAEKRSNHLESLLEQQRKHLLNLK 3443
            TT++D+ ST+K+LE   + LT R+          NK  W     D DK    E             +D+ LT++ L+  N+     ++S             +SD K+ SI+ FL+  +V D +SE++    R   D       V   +D+ ++E+  Q   +EV+T V+T +LELEE++R+V MLQKAL QQRELTVR  KET+K+M+KR++VQK+EYE A++R+ +FIDQLI   + L +KC KLV E+K   +KY++K+K ++ N+ +EL K++    AAEKLRREKW  +KTK IKEMT+KG+E EI +LIA HK +++K++Q +E E++++ E + ++Y +  EELR QL  EKE A+ +E    K R+++++Q + +  + ++++LYQE+ +E+DRL    ++Q+AE+E L++QLE        ++K E     EE +++  +E++ L+ + +LEK+ W E   K++E W++ KE+E++++++++  + I  V+ +LE+D + +++E E +   K++R ++K+E E +ELE SER+  ++YN+I+ +  E+E E+E LK++IRQKE+E+ + K+L E +N ER HVSDIIRQEFADR+V T+EEN+++K EISELRA+  +       D E +Q +   ++ EVH +VK+AI +KEE +A+LK QYQ           AA KR++HLE LLEQQRK LLN K
Sbjct:  565 TTLEDLYSTLKKLEEEENFLTARTE---------NKASW---LNDFDKDEGKE-------------LDSHLTAENLERLNSQKDDLTKSGF-----------LSDDKLKSIISFLDEVQVTDKLSEIDMEICRINEDLEKPALLVPSAFDIAQIEQ-AQATASEVTTTVLTQRLELEEKKRTVSMLQKALNQQRELTVRHAKETEKEMKKRLDVQKEEYEEAIKRHLSFIDQLIDDKKNLSEKCEKLVTELKSVDKKYQDKMKTLETNHTIELTKLKEVQAAAEKLRREKWIEDKTKKIKEMTVKGLEPEIQRLIAKHKSDIKKIQQIHEAELLESDERAAQRYVKMTEELRDQLAAEKEAAIAREREASKLRYEKQLQHEEEAYQQKQRRLYQEVQEEKDRLASSASRQRAELEKLQRQLEDSHRIALETIKEEFDKSREEQEKRHKSEIKMLQEKLKLEKESWEENYMKKHETWLVQKERELRDQVRRHXXAAIYIVVERLEEDASTTREENERTTEQKIRRLREKFEVETRELEQSERKAVQRYNEIKAKMTEVEGENERLKVIIRQKEQEILDTKKLLEKMNSERSHVSDIIRQEFADRIVATDEENKRIKHEISELRARHRIDLEKAQRDYEELQRSKDQELEEVHKRVKQAIVKKEEVVAQLKQQYQ-----------AANKRADHLEGLLEQQRKQLLNHK 1224          
BLAST of Centrosomal protein 131 vs. TrEMBL
Match: A0A3B3U0Z0 (Centrosomal protein 131 OS=Poecilia latipinna OX=48699 PE=4 SV=1)

HSP 1 Score: 432.565 bits (1111), Expect = 3.958e-127
Identity = 298/771 (38.65%), Postives = 467/771 (60.57%), Query Frame = 3
Query: 1179 PKSSMTNKTQELKGIENVIEERKSVEVNSKNTSPVE----------EKSICEND---GKSTNRGSEITTIDDILSTIKELESVDCLTDRSSKFDMKSNQANKCRWSAITEDIDKLLKPEQFKSISNAPSNPFID---NPLTSKALKMHNNNIGRQSQSEINLAPTKPTQSAI-SDSKMNSILQFLNASEVVDDISELEGRRFTDFPTKHWNVYDVKELE--ENTQTAVNEVSTKVMTMKLELEERQRSVEMLQKALQQQRELTVRQVKETQKDMEKRMEVQKDEYESALQRNHTFIDQLISKNELLQDKCNKLVVEMKEKTQKYXXXXXXXXXXXXXXLKKVEAKHLAAEKLRREKWEAEKTKLIKEMTIKGMETEIAQLIANHKQELRKMKQYYENEIIQTGENSYEKYNRQVEELRKQLYKEKEEALQKENSIIKERFDQEMQRQIQILESQRKQLYQEISDERDRLNIMGNKQKAEIENLRKQLEYKEDKVGVSMKLEHQHKLEEMQRKFDTEVRELKTQTELEKQIWIETNNKRNEAWMLSKEQEIKNEMKKNRDSEIEKVILKLEDDNTQSKQEIESSFGNKLKRAKDKYEAEIKELELSERQTKEKYNQIRGXXXXXXXXXXXXKIMIRQKEKEMDEVKQLYETLNRERDHVSDIIRQEFADRLVTTEEENRKLKREISELRAKINLMQTNHNEDLERIQLNHQSDITEVHNKVKEAIKRKEENMAELKSQYQNETSLWQQKLAAAEKRSNHLESLLEQQRKHLL 3434
            PKS   NK++      NV+ +    ++  +  SPV           ++S+   D   G  ++R    TT++++L T+K LE                            E+ +KL +P  ++    A    +ID   + LT+  L+ H    G+ SQ+     P  P   A+ S++K+ SI+ FL+  E     SE E  R     +    V   +EL   ++      EVS+ +M +KLELEE++R+V MLQ AL QQRELT R VKET+K++ +  ++QK++YE+ +QR+ TFIDQLI+  + L ++C  +V E+K   QKY +KI ++Q+ + +E+KK++    A EK+RREKW  EKTK IKE+TIKG+E E+ +LI+ HKQEL+K++  +E E++Q  E + ++Y RQ EELR+QL  EKEE  ++E  + K+R+D+++Q +   L+ QR++LY+E++DE++R+  +  +Q+ E+E LR+QLE        +++ E     EE +R+   E++ L+ + ++EKQ W ET  K+ EAWMLS+E+E+K E+++ RD EIE  I  LE++ ++ K+E E +  NK++R K+KY+AE++ELE SER   EK  + R + +E + E   L+  +RQKE+E+ +V Q  + L  ER  ++++IRQEFADRLV TEEENRKLK E+SE+RA++ L       +LERI    + ++ EVH +VK AI +KEE +  L+ QY+           AA KR++HLE+L EQQRKHLL
Sbjct:  498 PKSPTDNKSKNTDFNLNVVND--GTDLGFRAVSPVCSHHRSSQDLLQRSVSVEDQRHGAPSSRPQSKTTLNELLDTLKLLE----------------------------EEPEKLSEPRCYQKEKYA----WIDEDGDSLTTDNLERH----GQLSQN-----PVLPDGGALLSEAKLQSIMSFLDEMEK----SEQERPRSVTSGSHREAVLSEEELVGIDHVSATAAEVSSSMMRIKLELEEKKRTVNMLQAALAQQRELTARHVKETEKELSRNFQLQKEQYEATIQRHLTFIDQLINDKKALSERCEGVVAELKHVDQKYTKKIAHMQQQHELEIKKLKDLMSATEKIRREKWIDEKTKKIKEITIKGLEPEVQKLISKHKQELKKLRTLHEAELLQADERAAQRYVRQSEELRQQLETEKEEQCRRERELAKQRYDKQLQEEELSLQQQRRRLYKEVADEKERVVELAARQRGELEELRRQLEENSSLASRALREEMDKSREEQERRHQMEMKILQERLDVEKQTWEETYKKKEEAWMLSRERELKEELRRERDKEIEIAIWTLEEETSKDKEECERAADNKIRRLKEKYDAELRELERSERAAVEKQQEARKQQVEAQGELIRLQAALRQKEQEVQDVTQTRDKLAEERGTLAEVIRQEFADRLVMTEEENRKLKVEVSEVRARLRL-------ELERITREKEEELAEVHQRVKSAILKKEETVNNLRKQYE-----------AAVKRADHLEALWEQQRKHLL 1203          
BLAST of Centrosomal protein 131 vs. TrEMBL
Match: A0A3P9PH67 (Centrosomal protein 131 OS=Poecilia reticulata OX=8081 PE=4 SV=1)

HSP 1 Score: 430.639 bits (1106), Expect = 2.022e-126
Identity = 299/768 (38.93%), Postives = 461/768 (60.03%), Query Frame = 3
Query: 1179 PKSSMTNKTQELKGIENVIEERKSVEVNSKNTSPVE----------EKSICEND---GKSTNRGSEITTIDDILSTIKELESVDCLTDRSSKFDMKSNQANKCRWSAITEDIDKLLKPEQFKSISNAPSNPFIDNPLTSKALKMHNNNIGRQSQSEINLAPTKPTQSAI-SDSKMNSILQFLNASEVVDDISELEGRRFTDFPTKHWNVYDVKELE--ENTQTAVNEVSTKVMTMKLELEERQRSVEMLQKALQQQRELTVRQVKETQKDMEKRMEVQKDEYESALQRNHTFIDQLISKNELLQDKCNKLVVEMKEKTQKYXXXXXXXXXXXXXXLKKVEAKHLAAEKLRREKWEAEKTKLIKEMTIKGMETEIAQLIANHKQELRKMKQYYENEIIQTGENSYEKYNRQVEELRKQLYKEKEEALQKENSIIKERFDQEMQRQIQILESQRKQLYQEISDERDRLNIMGNKQKAEIENLRKQLEYKEDKVGVSMKLEHQHKLEEMQRKFDTEVRELKTQTELEKQIWIETNNKRNEAWMLSKEQEIKNEMKKNRDSEIEKVILKLEDDNTQSKQEIESSFGNKLKRAKDKYEAEIKELELSERQTKEKYNQIRGXXXXXXXXXXXXKIMIRQKEKEMDEVKQLYETLNRERDHVSDIIRQEFADRLVTTEEENRKLKREISELRAKINLMQTNHNEDLERIQLNHQSDITEVHNKVKEAIKRKEENMAELKSQYQNETSLWQQKLAAAEKRSNHLESLLEQQRKHLL 3434
            PKS   NKT+      NV+ +    ++  +  SPV           ++S+   D   G  ++R    TT++++L T+K LE          ++     Q  K  W  I ED D L                      T+  L+ H    G+ SQ      P  P   A+ S++K+ SI+ FL+  E     SE E  R     +    V   +EL   ++      EVS+ +M +KLELEE++R+V MLQ AL QQRELT R VKET+K++ +  ++QK++YE+ +QR+ TFIDQLI+  + L ++C  +V E+K   QKY +KI ++Q+ + +E+KK++    A EK+RREKW  EKTK IKE+TIKG+E E+ +LI+ HKQEL+K++  +E E++Q  E + ++Y RQ EELR+QL  EKEE  Q+E  + K+R+++++Q +   L+ QR++LY+E++DE++RL  +G +Q+ E+E LR+QLE      G +++ E     EE +R+   E++ L+ + ++EKQ W E   K+ EAWMLS+E+E+K E+++ RD EIE  I  LE++ ++ K+E E +  NK++R K+KY+AE++ELE SER   EK  + R + +E + E   L+  +RQ E+E+ +V Q  + L  ER  ++++IRQEFADRLV TEEENR+LK E+SE+RA++ L       +LERI    + ++ EVH +VK AI +KEE +  L+ QY+           AA KR++HLE+L EQQRKHLL
Sbjct:  498 PKSPTDNKTKNTDFNLNVVND--GADLGFRAVSPVCSHHSSSQDLLQRSVSVEDQRQGAPSSRPQSKTTLNELLDTLKLLEEEPEKLPEPRRY-----QKEKYAW--IDEDGDSL----------------------TTDNLERH----GQLSQH-----PVLPDGGALLSEAKLQSIMSFLDEMEK----SEQERPRSVTSGSHREAVLSEEELVGIDHVSATAAEVSSSMMRIKLELEEKKRTVNMLQAALAQQRELTARHVKETEKELSRNFQLQKEQYEATIQRHLTFIDQLINDKKALSERCEGVVAELKHVDQKYTKKIAHMQQQHEMEIKKLKDLMSATEKIRREKWIDEKTKKIKEITIKGLEPEVQKLISKHKQELKKLRALHEAELLQADERAAQRYVRQSEELRQQLETEKEEQCQRERELAKQRYEKQLQEEELSLQQQRRRLYKEVADEKERLVELGTRQRGELEELRRQLEENSSLAGRALREEMDKSREEQERRHQMEMKILQERLDVEKQTWEENYKKKEEAWMLSRERELKEELRRERDKEIEIAIWTLEEETSKDKEECERAADNKIRRLKEKYDAELRELEGSERAAVEKQQEARKQQVEAQGELIRLQAALRQMEQEVQDVTQTRDKLAEERRSLAEVIRQEFADRLVMTEEENRRLKVEVSEVRARLRL-------ELERITREKEEELAEVHQRVKSAILKKEETVNNLRKQYE-----------AAVKRADHLEALWEQQRKHLL 1203          
BLAST of Centrosomal protein 131 vs. TrEMBL
Match: I3KNP9 (Centrosomal protein 131 OS=Oreochromis niloticus OX=8128 GN=cep131 PE=4 SV=1)

HSP 1 Score: 431.024 bits (1107), Expect = 3.218e-126
Identity = 284/712 (39.89%), Postives = 451/712 (63.34%), Query Frame = 3
Query: 1311 GKSTNRGSEITTIDDILSTIKELESVDCLTDRSSKFDMKSNQANKCRWSAITEDIDKLLKPEQFKSISNAPSNPFIDNPLTSKALKMHNNNIGRQSQSEINLAPTKPTQSAI-SDSKMNSILQFLNASEVVDDISELEGRRFTDFPTKHWNVYDVKEL---EENTQTAVNEVSTKVMTMKLELEERQRSVEMLQKALQQQRELTVRQVKETQKDMEKRMEVQKDEYESALQRNHTFIDQLISKNELLQDKCNKLVVEMKEKTQKYXXXXXXXXXXXXXXLKKVEAKHLAAEKLRREKWEAEKTKLIKEMTIKGMETEIAQLIANHKQELRKMKQYYENEIIQTGENSYEKYNRQVEELRKQLYKEKEEALQKENSIIKERFDQEMQRQIQILESQRKQLYQEISDERDRLNIMGNKQKAEIENLRKQLEYKEDKVGVSMKLEHQHKLEEMQRKFDTEVRELKTQTELEKQIWIETNNKRNEAWMLSKEQEIKNEMKKNRDSEIEKVILKLEDDNTQSKQEIESSFGNKLKRAKDKYEAEIKELELSERQTKEKYNQIRGXXXXXXXXXXXXKIMIRQKEKEMDEVKQLYETLNRERDHVSDIIRQEFADRLVTTEEENRKLKREISELRAKINLMQTNHNEDLERIQLNHQSDITEVHNKVKEAIKRKEENMAELKSQYQNETSLWQQKLAAAEKRSNHLESLLEQQRKHLL 3434
            G S++R    TT++++L T+K LE                            E+ ++L +P+ ++    A    +ID    S +L    +N+ R  Q  ++  P  P   A+ S++K+ SI+ FL+  E     SE E  R     +    V   +EL   E+ + TA  E++  +M +KLELEE++R+V MLQ AL QQRELT+R VKET++++ +  ++QK++YES +QR+ TFIDQLI+  + L ++C  +V E+K+  QKY +KI  +QE + +E+KK++    A EK+RREKW  EKTK IKE+T+KG+E EI +LI+ HKQEL+K++  +E E++Q  + + ++Y RQ EELR+QL KEKEE  Q+E  + K+R+++++Q +   L+ QR++LY+E++DE++RL  +  +Q+AE+E+LR+QLE      G ++K E     EE +R+   E++ L+ + ++EKQ W E   K+ EAW+L++E+E+K E+++ RD EIE  I  LE++ ++ K+E E +  N+LKR ++KYEAE++ELE SER   EK  ++R + +E E E   L+  +RQKE+E +E+ Q  + L  ER  ++++IRQEFADRLV TEEENR+LK E+SE+RA++ L       ++ER+    + ++ EVH +VK AI +KEE +  L+ Q++           AA KR++HLE+L EQQRK LL
Sbjct:  596 GASSSRAQSKTTLNELLDTLKLLE----------------------------EEPERLSEPKCYRKEKYA----WIDEDGDSNSLT--TDNLERHGQ--LSHHPALPDGGALLSEAKLQSIMSFLDEMEK----SEQERPRSVTSGSHREAVLSEEELAGVEQASATAA-ELTGSMMRIKLELEEKKRTVNMLQTALAQQRELTIRHVKETERELSRNFQLQKEQYESTIQRHLTFIDQLINDKKALSERCEGVVGELKQVDQKYTKKIAQMQEQHEMEIKKLKDLMSATEKIRREKWIDEKTKKIKEITVKGLEPEIQKLISKHKQELKKLRTLHEAELLQADDRAAQRYVRQCEELRQQLEKEKEEQCQRERELAKQRYEKQLQEEEVSLQQQRRRLYKEVADEKERLAQLAARQRAELEDLRRQLEENSSLAGRALKEELDKTREEQERRHQVEMKALQERLDIEKQTWEENYKKKEEAWLLTRERELKEELRRERDKEIELAIWTLEEETSKDKEECERAAENRLKRVREKYEAELRELERSERTAVEKQQELRKQQMETEGELIRLQAALRQKEQETEEITQARDKLAEERRSLAEVIRQEFADRLVMTEEENRRLKVEVSEVRARMRL-------EVERVTREKEEELAEVHQRVKSAILKKEETVNNLRKQHE-----------AALKRADHLEALWEQQRKQLL 1248          
BLAST of Centrosomal protein 131 vs. Ensembl Cavefish
Match: cep131 (Danio rerio centrosomal protein 131 (cep131), mRNA. [Source:RefSeq mRNA;Acc:NM_001353865])

HSP 1 Score: 397.897 bits (1021), Expect = 6.597e-119
Identity = 269/722 (37.26%), Postives = 440/722 (60.94%), Query Frame = 3
Query: 1311 GKSTNRGSEITTIDDILSTIKELESVDCLTDRSSKFDMKSNQANKCRWSAITEDIDKLLKPEQFKSISNAPSNPFIDNPLTSKALKMHNNNIGRQSQSEINLAPTKPTQSAI-SDSKMNSILQFLNASEVVDDISELEGRRFTDFPTKHWNVYDVKELE--ENTQTAVNEVSTKVMTMKLELEERQRSVEMLQKALQQQRELTVRQVKETQKDMEKRMEVQKDEYESALQRNHTFIDQLISKNELLQDKCNKLVVEMKEKTQKYXXXXXXXXXXXX----------XXLKKVEAKHLAAEKLRREKWEAEKTKLIKEMTIKGMETEIAQLIANHKQELRKMKQYYENEIIQTGENSYEKYNRQVEELRKQLYKEKEEALQKENSIIKERFDQEMQRQIQILESQRKQLYQEISDERDRLNIMGNKQKAEIENLRKQLEYKEDKVGVSMKLEHQHKLEEMQRKFDTEVRELKTQTELEKQIWIETNNKRNEAWMLSKEQEIKNEMKKNRDSEIEKVILKLEDDNTQSKQEIESSFGNKLKRAKDKYEAEIKELELSERQTKEKYNQIRGXXXXXXXXXXXXKIMIRQKEKEMDEVKQLYETLNRERDHVSDIIRQEFADRLVTTEEENRKLKREISELRAKINLMQTNHNEDLERIQLNHQSDITEVHNKVKEAIKRKEENMAELKSQYQNETSLWQQKLAAAEKRSNHLESLLEQQRKHLLN 3437
            G  ++R    TT+ D+L ++K LE    +   S     KS + +K  W  I ED                       N LT+  L+ H    G+ SQ+     P  P + A+ S++K+ SI+ FL+  E     SE E  R     +    +   +EL   ++   AV EVS+ +M +KLEL+E++R+V MLQ AL QQRELT+  VK T+K++    ++QK +YE+ +QR+  FIDQLI   + L ++C  +V E+K+  QKY +KI  +QE +            E+KK++    A EK+RREKW  EKTK IKE+T+KG+E EI +LI+ HKQEL+K++  +E E++Q  E + ++Y  Q EELR+QL++E+E+  Q+E  + K+R+++++Q +   L+ QR++LY+E+++E++RLN +  +Q+AE+E L+  LE        +++ E +   EE +R+   E++ L+ + ++EKQ W E   K+ EAW+LS+E+E+K E+++ RD EIE  I +LE++ + +++E E +  N++KR +DKYEAE++E E SER   EK  +++   +E+E E   L+ ++ Q+++E+ ++ Q+ + L  ER  ++++IRQEFADRLV TEEENR++K E++E+RA++ L       ++ER+    + ++ EVH +VK AI +KEE +  L+ Q++            A KR+ HLE+LLEQQRK LL 
Sbjct:  426 GVQSSRAQSKTTLHDLLDSLKLLEEEPEVLSES-----KSYRKDKYAW--IDED--------------------GASNSLTTDNLERH----GQLSQT-----PALPDEGALLSEAKLQSIMSFLDEMEK----SEQERPRSVTSGSHREVLLSEEELVGVDHASAAVVEVSSSMMRIKLELDEKKRTVHMLQSALAQQRELTLHHVKATEKELNHNFQLQKQQYEATIQRHLAFIDQLIDDKKALSERCEGVVTELKQVDQKYTKKIGQMQEQHELVWQILGPLCEEIKKLKELMSATEKIRREKWIDEKTKKIKEITVKGLEPEIQKLISKHKQELKKLRVLHEAELLQADERAAQRYVLQTEELRQQLHQEREQQCQRERELAKQRYEKQLQEEENALQQQRRRLYKEVAEEKERLNQLSARQRAELEELKTHLENNSSLAARALREEMEKSREEQERRHQIEMKALRERLDIEKQTWEENYMKKEEAWLLSRERELKEEVRRGRDKEIELAIQRLEEETSGAREECERAADNRVKRVRDKYEAELREAEQSERAAVEKQQEVKKRLVEVEGEMLRLQTLLTQRDQEITDITQVRDRLAEERRSLAEVIRQEFADRLVETEEENRRMKGEVAEVRARLRL-------EVERLSREKEEELAEVHQRVKSAILKKEETVNNLRKQHE-----------VALKRAEHLETLLEQQRKQLLG 1089          
BLAST of Centrosomal protein 131 vs. Ensembl Sea Lamprey
Match: cep131 (Danio rerio centrosomal protein 131 (cep131), mRNA. [Source:RefSeq mRNA;Acc:NM_001353865])

HSP 1 Score: 266.159 bits (679), Expect = 1.100e-77
Identity = 198/548 (36.13%), Postives = 333/548 (60.77%), Query Frame = 3
Query: 1809 EVSTKVMTMKLELEERQRSVEMLQKALQQQRELTVRQVKETQKDMEKRMEVQKDEYESALQRNHTFIDQLISKNELLQDKCNKLVVEMKEKTQKYXXXXXXXXX-XXXXXLKKVEAKHLAAEKLRREKWEAEKTKLIKEMTIKGMETEIAQLIANHKQELRKMKQYYENEIIQTGENSYEKYNRQVEELRKQLYKEKEEALQKENSIIKER---FDQEMQRQIQILESQRKQLYQEISDERDRLNIMGNKQKAEIENLRKQLEYKEDKVGVSMKLEHQHKLEEMQRKFDTEVRELKTQTELEKQIWIETNNKRNEAWMLSKEQEIKNEMKKNRDSEIEKVILKLEDDNTQSKQEIESSFGNKLK-RAKDKYEAEIKELELSERQTKEKYNQIRGXXXXXXXXXXXXKIMIRQKEKEMDEVKQLYETLNRERDHVSDIIRQEFADRLVTTEEENRKLKREISELRAKINLMQTNHNEDLERIQLNHQSDITEVHNKVKEAIKRKEENMAELKSQYQNETSLWQQKLAAAEKRSNHLESLLEQQRKHLLN 3437
            EV++ ++ MKLELEE++RSV MLQ AL    E+T  +V    + ++K   VQ   +   +++ ++ + QL+ ++ ++  +C        +    Y   +    E      LK V A   A EKLRREKW  EKTK IKE+T+KG+E EI +LI+ HKQEL ++   ++ E+  + E + ++Y +Q++ELR QL KEKE A Q+E  + +++   ++Q +  + + L  QR ++  E+S E++RL+   ++Q+A++E LR+QLE        ++K E+ H  EE +++   E+   K + E+EKQ W E   K+ EAW+LS+E+E++ E++K RD EIE VI +LEDD T ++QE + +  N+   R ++  EAE++ELE +E++ + K  ++R    ++E E    + +++QK+ E+ E+ ++   L  ER+ +  ++RQEFA+RL  TEEENR L+ E++ELRA+        + +++R+  + + ++ EVH +VK AI +KEE +  L+ Q++           A+ KR+ HLE LLEQQRK LL 
Sbjct:   13 EVTSTLIKMKLELEEKRRSVHMLQTALTLCEEITFHKV--WMRVLDKIFRVQHKLHYKCVEKWYSQLKQLLHQSMVVNHQCFSNPGSTPKTPIGYSSSVVLPLELYEVKRLKDVMA---ATEKLRREKWIDEKTKKIKEITVKGLEPEIQKLISKHKQELARLSALHDAELQASDERAAKRYVQQIQELRAQLDKEKEAACQRERDVAQKQMRSYEQALMEEQKALHQQRLRIAAELSQEKERLSEQAHRQRADLEELRRQLERNSITACQALKEEYHHAKEEQEKRHQVELLGYKERLEIEKQTWEENYRKKQEAWLLSRERELREEVRKTRDEEIEMVIRRLEDDATATRQECDRAAENRSSNRVREMQEAEVRELEQAEKRAQAKAVELRTRLTQVEGEAARCQGLLQQKDAELSEMNKVNSQLMEERNRLGAVLRQEFAERLAMTEEENRHLQAEMTELRAR-------QHAEIQRVHQDKEKELQEVHQRVKAAIVKKEEMVNSLRKQHE-----------ASVKRAEHLEGLLEQQRKQLLG 537          
BLAST of Centrosomal protein 131 vs. Ensembl Nematostella
Match: EDO36823 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHG3])

HSP 1 Score: 344.354 bits (882), Expect = 3.296e-100
Identity = 258/729 (35.39%), Postives = 422/729 (57.89%), Query Frame = 3
Query: 1317 STNRGSEI---TTIDDILSTIKELESVDCLTDRSSKFDMKSNQANKCRWSAITEDIDKLLKPEQFKSISNAPSNPFID-------NPLTSKA-LKMHNNNIGRQSQSEINLAPTKPTQSAISDSKMNSILQFLNASEVVDD--------ISELEGRRFTDFPTKHWNVYDVKELE----ENTQTAVNEVSTKVMTMKLELEERQRSVEMLQKALQQQRELTVRQVKETQKDMEKRMEVQKDEYESALQRNHTFIDQLISKNELLQDKCNKLVVEMKEKTQKYXXXXXXXXXXXXXXLKKVEAKHLAAEKLRREKWEAEKTKLIKEMTIKGMETEIAQLIANHKQELRKMKQYYENEIIQTGENSYEKYNRQVEELRKQLYKEKEEALQKENSIIKERFDQEMQRQIQILESQRKQLYQEISDERDRLNIMGNKQKAEIENLRKQLEYKEDKVGVSMKLEHQHKLEEMQRKFDTEVRELKTQTELEKQIWIETNNKRNEAWMLSKEQEIKNEMKKNRDSEIEKVILKLEDDNTQSKQEIESSFGNKLKRAKDKYEAEIKELELSERQTKEKYNQIRGXXXXXXXXXXXXKIMIRQKEKEMDEVKQLYETLNRERDHVSDIIRQEFADRLVTTEEENRKLKREISELRAKINLMQTNHNEDLERIQLNHQSDITEVHNKVKEAIKRKEENMAELKSQYQNETSLWQQKLAAAEKRSNHLESLLEQQRKHLL 3434
            S N GS++   TT DD+L+++K+LE                            ++ ++LL P    + S+   N ++D        P  S A +  HN++   + QS+        + +A+S  K+ +I+ FL+  E  ++        + E    R    P+   ++   KE E    E    A  +V+  +M +K+ELEE++R+ ++LQ+AL QQRE T+RQ KE +KD ++R+ +QK EYE+A+QR+ +FIDQLI   + L ++C +LV ++K+  +KY +KIK ++EN+ VE+KK +   LAAEKLRREKW  EKT+ IKE+T+KG+E +I +LIA HK E++K+K  ++ E++++ E +  +Y +Q+EELR QL +EKE A  +E  + ++R +++M+++ Q  + QR++LY E+ +E++R+ +   +Q+ E+++ R+ LE  ED V                                                +++KE+E+K  +++ RD EIE VI +LED+   S++E E +  N++KR +DKYE+EI+ELE SE   +++YN+++    E+E E    + ++RQKE +  + +Q    L  ER  V+DIIRQEFADRLVTT+E+N++LK E+SE+RA+       H  +LERI    + ++ +VH +VK+AI +KEE M  L+ Q Q           AA KR++HLE LL+QQRK LL
Sbjct:  460 SKNAGSDVNSKTTFDDLLNSLKQLE----------------------------QEPEELLSP-GIPAASDHKLNSWLDEIDKDNEKPYLSVANVDSHNHH---KVQSD--------SSTALSAEKLRNIIHFLDEVEKAEEDVRSEITQVREEAISRGLPSPSASTSITFDKEKERAALEEASHAATDVTNAMMAVKIELEEKKRTNDLLQRALNQQREFTLRQAKEMEKDAKQRLTIQKQEYEAAIQRHLSFIDQLIDDKKTLGERCEELVKKLKDIDKKYSDKIKLMEENHQVEIKKQKEVILAAEKLRREKWITEKTQQIKEVTVKGLEPDIQKLIAKHKAEVKKIKSVHQAELLESDERAGRRYIQQIEELRDQLEREKEMACTRERELAQQRMEKQMEQEEQAYQQQRRRLYSEVQEEKERIALQAQRQRQELDDARRALE--EDTV------------------------------------------------LMAKERELKEGVREARDREIEMVINRLEDEAAASREECERAAENRIKRVRDKYESEIRELERSESNMQQRYNEMKERLTEVEGELSRQRSLLRQKETQQQDSEQTLTRLQEERGKVADIIRQEFADRLVTTDEDNKRLKTELSEMRAR-------HRLELERITREKEEEMEQVHTRVKQAISKKEETMKVLREQQQ-----------AAMKRADHLEMLLQQQRKKLL 1080          
BLAST of Centrosomal protein 131 vs. Ensembl Nematostella
Match: EDO38532 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCK1])

HSP 1 Score: 65.4698 bits (158), Expect = 1.417e-10
Identity = 30/50 (60.00%), Postives = 41/50 (82.00%), Query Frame = 3
Query: 2160 LAAEKLRREKWEAEKTKLIKEMTIKGMETEIAQLIANHKQELRKMKQYYE 2309
            LAAEKLRREKW  EKT+ IKE+T+KG+E +I +LIA HK E++K+K  ++
Sbjct: 1038 LAAEKLRREKWITEKTQQIKEVTVKGLEPDIQKLIAKHKAEVKKIKSVHQ 1087          
BLAST of Centrosomal protein 131 vs. Ensembl Medaka
Match: cep131 (centrosomal protein 131 [Source:NCBI gene;Acc:101162716])

HSP 1 Score: 412.92 bits (1060), Expect = 2.233e-123
Identity = 271/699 (38.77%), Postives = 436/699 (62.37%), Query Frame = 3
Query: 1341 TTIDDILSTIKELESVDCLTDRSSKFDMKSNQANKCRWSAITEDIDKLLKPEQFKSISNAPSNPFIDNPLTSKALKMHNNNIGRQSQSEINLAPTKPTQSAI-SDSKMNSILQFLNASEVVDDISELEGRRFTDFPTKHWNVYDVKELEENTQTAVNEVSTKVMTMKLELEERQRSVEMLQKALQQQRELTVRQVKETQKDMEKRMEVQKDEYESALQRNHTFIDQLISKNELLQDKCNKLVVEMKEKTQKYXXXXXXXXXXXXXXLKKVEAKHLAAEKLRREKWEAEKTKLIKEMTIKGMETEIAQLIANHKQELRKMKQYYENEIIQTGENSYEKYNRQVEELRKQLYKEKEEALQKENSIIKERFDQEMQRQIQILESQRKQLYQEISDERDRLNIMGNKQKAEIENLRKQLEYKEDKVGVSMKLEHQHKLEEMQRKFDTEVRELKTQTELEKQIWIETNNKRNEAWMLSKEQEIKNEMKKNRDSEIEKVILKLEDDNTQSKQEIESSFGNKLKRAKDKYEAEIKELELSERQTKEKYNQIRGXXXXXXXXXXXXKIMIRQKEKEMDEVKQLYETLNRERDHVSDIIRQEFADRLVTTEEENRKLKREISELRAKINLMQTNHNEDLERIQLNHQSDITEVHNKVKEAIKRKEENMAELKSQYQNETSLWQQKLAAAEKRSNHLESLLEQQRKHLL 3434
            TT++++L T+K LE  +       KF    +  +K  W  I +D D                     N LT+  L+ H          ++N   + P   A+ S++K+ SI+ FL+  E     SE E  R     ++   +    EL   T+ A  EV+  +M +K+ELEE++RSV MLQ AL QQRELT R VKE ++++ +  ++QK++YE+ +QR+  FIDQLIS  + L ++C  +V E+K+   KY +KI  +Q+ + +E+KK++    A+EK+RRE+W  EKTK IKE+T+KG+E EI +L++ HKQEL+K++  +E E++Q  E + ++Y RQ EELR QL KEKEE  Q+E  + K+R+++++Q +   L+ QR++LY+E+SD+++RL  +  +Q++E+E+LR+QLE        +++ E +   EE +++   EV+ L+ + ++EKQ W E+   + EAWMLS+E+E+K E+++ RD EIE  I  LE++ ++ K E E +  N+++R ++KYEAE++ELE SER   EK  ++R + LE+E +   L+ + RQ+E EM+ VKQ  + L  ER  ++++IRQEFA+RLV  EEENR+LK E+SE+RA++ L       +++R+    + ++ EVH +VK AI +KEE +  L+ QY+           AA KR++HLE+L EQQRK LL
Sbjct:  564 TTLNELLDTLKLLEEEEPQRLPGPKF----HHNDKYAW--IDKDAD--------------------SNSLTTDNLERHG---------QMNHQTSLPDGGALLSEAKLQSIMSFLDEMET----SEQERPRSITSGSQREALLSEDELL-GTEQASAEVTGSMMRLKMELEEKRRSVSMLQTALAQQRELTARHVKEMERELSRSFQLQKEQYEATIQRHLAFIDQLISDKKALSERCEGVVTELKQVDLKYTQKIAQMQQQHEMEIKKLKDLMSASEKIRRERWIDEKTKKIKEITVKGLEPEIQKLLSKHKQELKKLRTLHEAELLQADERAAQRYVRQCEELRLQLEKEKEEQCQRERDLAKQRYEKQLQEEELSLQQQRRRLYKEVSDDKERLTQLAARQRSELEDLRRQLEENSRLAERALREELEKSREEQEKRHQMEVKVLQERLDMEKQTWEESFKNKEEAWMLSREREMKEELRRERDKEIELAIWTLEEETSKDKAECERAADNRVRRLREKYEAELRELESSERAAVEKQQELRRKQLEMEEQLVRLQTLFRQQEAEMEGVKQTRDKLAEERCSLTEVIRQEFAERLVAAEEENRRLKLEVSEVRARLRL-------EVDRVHQEKEEELAEVHQRVKSAILKKEETVKNLRGQYE-----------AALKRADHLEALWEQQRKQLL 1204          
BLAST of Centrosomal protein 131 vs. Ensembl Medaka
Match: cep131 (centrosomal protein 131 [Source:NCBI gene;Acc:101162716])

HSP 1 Score: 404.445 bits (1038), Expect = 2.619e-120
Identity = 271/709 (38.22%), Postives = 435/709 (61.35%), Query Frame = 3
Query: 1341 TTIDDILSTIKELESVDCLTDRSSKFDMKSNQANKCRWSAITEDIDKLLKPEQFKSISNAPSNPFIDNPLTSKALKMHNNNIGRQSQSEINLAPTKPTQSAI-SDSKMNSILQFLNASEVVDDISELEGRRFTDFPTKHWNVYDVKELEENTQTAVNEVSTKVMTMKLELEERQRSVEMLQKALQQQRELTVRQVKETQKDMEKRMEVQKDEYESALQRNHTFIDQLISKNELLQDKCNKLVVEMKEKTQKYXXXXXXXXXXXX----------XXLKKVEAKHLAAEKLRREKWEAEKTKLIKEMTIKGMETEIAQLIANHKQELRKMKQYYENEIIQTGENSYEKYNRQVEELRKQLYKEKEEALQKENSIIKERFDQEMQRQIQILESQRKQLYQEISDERDRLNIMGNKQKAEIENLRKQLEYKEDKVGVSMKLEHQHKLEEMQRKFDTEVRELKTQTELEKQIWIETNNKRNEAWMLSKEQEIKNEMKKNRDSEIEKVILKLEDDNTQSKQEIESSFGNKLKRAKDKYEAEIKELELSERQTKEKYNQIRGXXXXXXXXXXXXKIMIRQKEKEMDEVKQLYETLNRERDHVSDIIRQEFADRLVTTEEENRKLKREISELRAKINLMQTNHNEDLERIQLNHQSDITEVHNKVKEAIKRKEENMAELKSQYQNETSLWQQKLAAAEKRSNHLESLLEQQRKHLL 3434
            TT++++L T+K LE  +       KF    +  +K  W  I +D D                     N LT+  L+ H          ++N   + P   A+ S++K+ SI+ FL+  E     SE E  R     ++   +    EL   T+ A  EV+  +M +K+ELEE++RSV MLQ AL QQRELT R VKE ++++ +  ++QK++YE+ +QR+  FIDQLIS  + L ++C  +V E+K+   KY +KI  +Q+ +            E+KK++    A+EK+RRE+W  EKTK IKE+T+KG+E EI +L++ HKQEL+K++  +E E++Q  E + ++Y RQ EELR QL KEKEE  Q+E  + K+R+++++Q +   L+ QR++LY+E+SD+++RL  +  +Q++E+E+LR+QLE        +++ E +   EE +++   EV+ L+ + ++EKQ W E+   + EAWMLS+E+E+K E+++ RD EIE  I  LE++ ++ K E E +  N+++R ++KYEAE++ELE SER   EK  ++R + LE+E +   L+ + RQ+E EM+ VKQ  + L  ER  ++++IRQEFA+RLV  EEENR+LK E+SE+RA++ L       +++R+    + ++ EVH +VK AI +KEE +  L+ QY+           AA KR++HLE+L EQQRK LL
Sbjct:  564 TTLNELLDTLKLLEEEEPQRLPGPKF----HHNDKYAW--IDKDAD--------------------SNSLTTDNLERHG---------QMNHQTSLPDGGALLSEAKLQSIMSFLDEMET----SEQERPRSITSGSQREALLSEDELL-GTEQASAEVTGSMMRLKMELEEKRRSVSMLQTALAQQRELTARHVKEMERELSRSFQLQKEQYEATIQRHLAFIDQLISDKKALSERCEGVVTELKQVDLKYTQKIAQMQQQHEMVWHILGPLCEEIKKLKDLMSASEKIRRERWIDEKTKKIKEITVKGLEPEIQKLLSKHKQELKKLRTLHEAELLQADERAAQRYVRQCEELRLQLEKEKEEQCQRERDLAKQRYEKQLQEEELSLQQQRRRLYKEVSDDKERLTQLAARQRSELEDLRRQLEENSRLAERALREELEKSREEQEKRHQMEVKVLQERLDMEKQTWEESFKNKEEAWMLSREREMKEELRRERDKEIELAIWTLEEETSKDKAECERAADNRVRRLREKYEAELRELESSERAAVEKQQELRRKQLEMEEQLVRLQTLFRQQEAEMEGVKQTRDKLAEERCSLTEVIRQEFAERLVAAEEENRRLKLEVSEVRARLRL-------EVDRVHQEKEEELAEVHQRVKSAILKKEETVKNLRGQYE-----------AALKRADHLEALWEQQRKQLL 1214          
BLAST of Centrosomal protein 131 vs. Planmine SMEST
Match: SMESG000051138.1 (SMESG000051138.1)

HSP 1 Score: 2028.06 bits (5253), Expect = 0.000e+0
Identity = 1108/1112 (99.64%), Postives = 1110/1112 (99.82%), Query Frame = 3
Query:  108 MNFTIYGSQPIKDKGKTSSFQNSSENDLNFKTKDRTNSVSSSYKGRLNSNMSLQVTPLSTGRKHEERNSFTKANDNESARTKFSTKSGSTKLSLNTNKISSNSAARSRKGNLDTFLDLKQMSNDFPDNDGVEKWLKEQDLKDWDEXXXXXXXXXXXXATGSKFSHMIPINKHAFESQNYSQNFEEESISYSSERTLSPIVNSNRKGLENSKDDLIKESLFNSNIINEQLKQKSAKIIQVWYRRHLKRQRLAQAAMKRMLTNXXXXXXXXXXXXXXIENVRKCFSAERKSNYMSKGYKISSQNKTGDLKDSKRLTDKAVAXXXXXXXXXXXXIHXXXXXXXXXXXXXXXXXXXQTAKQPKSSMTNKTQELKGIENVIEERKSVEVNSKNTSPVEEKSICENDGKSTNRGSEITTIDDILSTIKELESVDCLTDRSSKFDMKSNQANKCRWSAITEDIDKLLKPEQFKSISNAPSNPFIDNPLTSKALKMHNNNIGRQSQSEINLAPTKPTQSAISDSKMNSILQFLNASEVVDDISELEGRRFTDFPTKHWNVYDVKELEENTQTAVNEVSTKVMTMKLELEERQRSVEMLQKALQQQRELTVRQVKETQKDMEKRMEVQKDEYESALQRNHTFIDQLISKNELLQDKCNKLVVEMKEKTQKYXXXXXXXXXXXXXXLKKVEAKHLAAEKLRREKWEAEKTKLIKEMTIKGMETEIAQLIANHKQELRKMKQYYENEIIQTGENSYEKYNRQVEELRKQLYKEKEEALQKENSIIKERFDQEMQRQIQILESQRKQLYQEISDERDRLNIMGNKQKAEIENLRKQLEYKEDKVGVSMKLEHQHKLEEMQRKFDTEVRELKTQTELEKQIWIETNNKRNEAWMLSKEQEIKNEMKKNRDSEIEKVILKLEDDNTQSKQEIESSFGNKLKRAKDKYEAEIKELELSERQTKEKYNQIRGXXXXXXXXXXXXKIMIRQKEKEMDEVKQLYETLNRERDHVSDIIRQEFADRLVTTEEENRKLKREISELRAKINLMQTNHNEDLERIQLNHQSDITEVHNKVKEAIKRKEENMAELKSQYQNETSLWQQKLAAAEKRSNHLESLLEQQRKHLLNLK 3443
            MNFTIYGSQPIKDKGKTSSFQNSSENDLNFKTKD TNSVSSSYKGRLNSNMSLQVTPLSTGRKHEERNSFTKANDNESARTKFSTKSGSTKLSLNTNKISSNSAARSRKGNLDTFLDLKQMSNDFPDNDGVEKWLKEQDLKDWDEISISSNKKSVKSATGSKFSHMIPINKHAFESQNYSQNFEEESISYSSERTLSPIVNSNRKGLENS+DDLIKESLFNSNIINEQLKQKSAKIIQVWYRRHLKRQRLAQAAMKRMLTNKQLELKQQQSSLEQIENVRKCFSAERKSNYMSKGYKISSQNKTGDLKDSKRLTDKAVAENEVEKLKLENKIHSRPNSSRTLSSRSKGSNSNQTAKQPKSSMTNKTQELKGIENVIEERKSVEVNSKNTSPVEEKSICENDGKSTNRGSEITTIDDILSTIKELESVDCLTDRSSKFDMKSNQANKCRWSAITEDIDKLLKPEQFKSISNAPSNPFIDNPLTSKALKMHNNNIGRQSQSEINLAPTKPTQSAISDSKMNSILQFLNASEVVDDISELEGRRFTDFPTKHWNVYDVKELEENTQTAVNEVSTKVMTMKLELEERQRSVEMLQKALQQQRELTVRQVKETQKDMEKRMEVQKDEYESALQRNHTFIDQLISKNELLQDKCNKLVVEMKEKTQKYEEKIKNIQENNNVELKKVEAKHLAAEKLRREKWEAEKTKLIKEMTIKGMETEIAQLIANHKQELRKMKQYYENEIIQTGENSYEKYNRQVEELRKQLYKEKEEALQKENSIIKERFDQEMQRQIQILESQRKQLYQEISDERDRLNIMGNKQKAEIENLRKQLEYKEDKVGVSMKLEHQHKLEEMQRKFDTEVRELKTQTELEKQIW+ETNNKRNEAWMLSKEQEIKNEMKKNRDSEIEKVILKLEDDNTQSKQEIESSFGNKLKRAKDKYEAEIKELELSERQ KEKYNQIRGEFLELESEHESLKIMIRQKEKEMDEVKQLYETLNRERDHVSDIIRQEFADRLVTTEEENRKLKREISELRAKINLMQTNHNEDLERIQLNHQSDITEVHNKVKEAIKRKEENMAELKSQYQNETSLWQQKLAAAEKRSNHLESLLEQQRKHLLNLK
Sbjct:    1 MNFTIYGSQPIKDKGKTSSFQNSSENDLNFKTKDTTNSVSSSYKGRLNSNMSLQVTPLSTGRKHEERNSFTKANDNESARTKFSTKSGSTKLSLNTNKISSNSAARSRKGNLDTFLDLKQMSNDFPDNDGVEKWLKEQDLKDWDEISISSNKKSVKSATGSKFSHMIPINKHAFESQNYSQNFEEESISYSSERTLSPIVNSNRKGLENSQDDLIKESLFNSNIINEQLKQKSAKIIQVWYRRHLKRQRLAQAAMKRMLTNKQLELKQQQSSLEQIENVRKCFSAERKSNYMSKGYKISSQNKTGDLKDSKRLTDKAVAENEVEKLKLENKIHSRPNSSRTLSSRSKGSNSNQTAKQPKSSMTNKTQELKGIENVIEERKSVEVNSKNTSPVEEKSICENDGKSTNRGSEITTIDDILSTIKELESVDCLTDRSSKFDMKSNQANKCRWSAITEDIDKLLKPEQFKSISNAPSNPFIDNPLTSKALKMHNNNIGRQSQSEINLAPTKPTQSAISDSKMNSILQFLNASEVVDDISELEGRRFTDFPTKHWNVYDVKELEENTQTAVNEVSTKVMTMKLELEERQRSVEMLQKALQQQRELTVRQVKETQKDMEKRMEVQKDEYESALQRNHTFIDQLISKNELLQDKCNKLVVEMKEKTQKYEEKIKNIQENNNVELKKVEAKHLAAEKLRREKWEAEKTKLIKEMTIKGMETEIAQLIANHKQELRKMKQYYENEIIQTGENSYEKYNRQVEELRKQLYKEKEEALQKENSIIKERFDQEMQRQIQILESQRKQLYQEISDERDRLNIMGNKQKAEIENLRKQLEYKEDKVGVSMKLEHQHKLEEMQRKFDTEVRELKTQTELEKQIWVETNNKRNEAWMLSKEQEIKNEMKKNRDSEIEKVILKLEDDNTQSKQEIESSFGNKLKRAKDKYEAEIKELELSERQMKEKYNQIRGEFLELESEHESLKIMIRQKEKEMDEVKQLYETLNRERDHVSDIIRQEFADRLVTTEEENRKLKREISELRAKINLMQTNHNEDLERIQLNHQSDITEVHNKVKEAIKRKEENMAELKSQYQNETSLWQQKLAAAEKRSNHLESLLEQQRKHLLNLK 1112          
BLAST of Centrosomal protein 131 vs. Planmine SMEST
Match: SMESG000051138.1 (SMESG000051138.1)

HSP 1 Score: 1553.88 bits (4022), Expect = 0.000e+0
Identity = 856/858 (99.77%), Postives = 857/858 (99.88%), Query Frame = 3
Query:  870 MKRMLTNXXXXXXXXXXXXXXIENVRKCFSAERKSNYMSKGYKISSQNKTGDLKDSKRLTDKAVAXXXXXXXXXXXXIHXXXXXXXXXXXXXXXXXXXQTAKQPKSSMTNKTQELKGIENVIEERKSVEVNSKNTSPVEEKSICENDGKSTNRGSEITTIDDILSTIKELESVDCLTDRSSKFDMKSNQANKCRWSAITEDIDKLLKPEQFKSISNAPSNPFIDNPLTSKALKMHNNNIGRQSQSEINLAPTKPTQSAISDSKMNSILQFLNASEVVDDISELEGRRFTDFPTKHWNVYDVKELEENTQTAVNEVSTKVMTMKLELEERQRSVEMLQKALQQQRELTVRQVKETQKDMEKRMEVQKDEYESALQRNHTFIDQLISKNELLQDKCNKLVVEMKEKTQKYXXXXXXXXXXXXXXLKKVEAKHLAAEKLRREKWEAEKTKLIKEMTIKGMETEIAQLIANHKQELRKMKQYYENEIIQTGENSYEKYNRQVEELRKQLYKEKEEALQKENSIIKERFDQEMQRQIQILESQRKQLYQEISDERDRLNIMGNKQKAEIENLRKQLEYKEDKVGVSMKLEHQHKLEEMQRKFDTEVRELKTQTELEKQIWIETNNKRNEAWMLSKEQEIKNEMKKNRDSEIEKVILKLEDDNTQSKQEIESSFGNKLKRAKDKYEAEIKELELSERQTKEKYNQIRGXXXXXXXXXXXXKIMIRQKEKEMDEVKQLYETLNRERDHVSDIIRQEFADRLVTTEEENRKLKREISELRAKINLMQTNHNEDLERIQLNHQSDITEVHNKVKEAIKRKEENMAELKSQYQNETSLWQQKLAAAEKRSNHLESLLEQQRKHLLNLK 3443
            MKRMLTNKQLELKQQQSSLEQIENVRKCFSAERKSNYMSKGYKISSQNKTGDLKDSKRLTDKAVAENEVEKLKLENKIHSRPNSSRTLSSRSKGSNSNQTAKQPKSSMTNKTQELKGIENVIEERKSVEVNSKNTSPVEEKSICENDGKSTNRGSEITTIDDILSTIKELESVDCLTDRSSKFDMKSNQANKCRWSAITEDIDKLLKPEQFKSISNAPSNPFIDNPLTSKALKMHNNNIGRQSQSEINLAPTKPTQSAISDSKMNSILQFLNASEVVDDISELEGRRFTDFPTKHWNVYDVKELEENTQTAVNEVSTKVMTMKLELEERQRSVEMLQKALQQQRELTVRQVKETQKDMEKRMEVQKDEYESALQRNHTFIDQLISKNELLQDKCNKLVVEMKEKTQKYEEKIKNIQENNNVELKKVEAKHLAAEKLRREKWEAEKTKLIKEMTIKGMETEIAQLIANHKQELRKMKQYYENEIIQTGENSYEKYNRQVEELRKQLYKEKEEALQKENSIIKERFDQEMQRQIQILESQRKQLYQEISDERDRLNIMGNKQKAEIENLRKQLEYKEDKVGVSMKLEHQHKLEEMQRKFDTEVRELKTQTELEKQIW+ETNNKRNEAWMLSKEQEIKNEMKKNRDSEIEKVILKLEDDNTQSKQEIESSFGNKLKRAKDKYEAEIKELELSERQ KEKYNQIRGEFLELESEHESLKIMIRQKEKEMDEVKQLYETLNRERDHVSDIIRQEFADRLVTTEEENRKLKREISELRAKINLMQTNHNEDLERIQLNHQSDITEVHNKVKEAIKRKEENMAELKSQYQNETSLWQQKLAAAEKRSNHLESLLEQQRKHLLNLK
Sbjct:    1 MKRMLTNKQLELKQQQSSLEQIENVRKCFSAERKSNYMSKGYKISSQNKTGDLKDSKRLTDKAVAENEVEKLKLENKIHSRPNSSRTLSSRSKGSNSNQTAKQPKSSMTNKTQELKGIENVIEERKSVEVNSKNTSPVEEKSICENDGKSTNRGSEITTIDDILSTIKELESVDCLTDRSSKFDMKSNQANKCRWSAITEDIDKLLKPEQFKSISNAPSNPFIDNPLTSKALKMHNNNIGRQSQSEINLAPTKPTQSAISDSKMNSILQFLNASEVVDDISELEGRRFTDFPTKHWNVYDVKELEENTQTAVNEVSTKVMTMKLELEERQRSVEMLQKALQQQRELTVRQVKETQKDMEKRMEVQKDEYESALQRNHTFIDQLISKNELLQDKCNKLVVEMKEKTQKYEEKIKNIQENNNVELKKVEAKHLAAEKLRREKWEAEKTKLIKEMTIKGMETEIAQLIANHKQELRKMKQYYENEIIQTGENSYEKYNRQVEELRKQLYKEKEEALQKENSIIKERFDQEMQRQIQILESQRKQLYQEISDERDRLNIMGNKQKAEIENLRKQLEYKEDKVGVSMKLEHQHKLEEMQRKFDTEVRELKTQTELEKQIWVETNNKRNEAWMLSKEQEIKNEMKKNRDSEIEKVILKLEDDNTQSKQEIESSFGNKLKRAKDKYEAEIKELELSERQMKEKYNQIRGEFLELESEHESLKIMIRQKEKEMDEVKQLYETLNRERDHVSDIIRQEFADRLVTTEEENRKLKREISELRAKINLMQTNHNEDLERIQLNHQSDITEVHNKVKEAIKRKEENMAELKSQYQNETSLWQQKLAAAEKRSNHLESLLEQQRKHLLNLK 858          
BLAST of Centrosomal protein 131 vs. Planmine SMEST
Match: SMESG000051138.1 (SMESG000051138.1)

HSP 1 Score: 1546.95 bits (4004), Expect = 0.000e+0
Identity = 853/855 (99.77%), Postives = 854/855 (99.88%), Query Frame = 3
Query:  879 MLTNXXXXXXXXXXXXXXIENVRKCFSAERKSNYMSKGYKISSQNKTGDLKDSKRLTDKAVAXXXXXXXXXXXXIHXXXXXXXXXXXXXXXXXXXQTAKQPKSSMTNKTQELKGIENVIEERKSVEVNSKNTSPVEEKSICENDGKSTNRGSEITTIDDILSTIKELESVDCLTDRSSKFDMKSNQANKCRWSAITEDIDKLLKPEQFKSISNAPSNPFIDNPLTSKALKMHNNNIGRQSQSEINLAPTKPTQSAISDSKMNSILQFLNASEVVDDISELEGRRFTDFPTKHWNVYDVKELEENTQTAVNEVSTKVMTMKLELEERQRSVEMLQKALQQQRELTVRQVKETQKDMEKRMEVQKDEYESALQRNHTFIDQLISKNELLQDKCNKLVVEMKEKTQKYXXXXXXXXXXXXXXLKKVEAKHLAAEKLRREKWEAEKTKLIKEMTIKGMETEIAQLIANHKQELRKMKQYYENEIIQTGENSYEKYNRQVEELRKQLYKEKEEALQKENSIIKERFDQEMQRQIQILESQRKQLYQEISDERDRLNIMGNKQKAEIENLRKQLEYKEDKVGVSMKLEHQHKLEEMQRKFDTEVRELKTQTELEKQIWIETNNKRNEAWMLSKEQEIKNEMKKNRDSEIEKVILKLEDDNTQSKQEIESSFGNKLKRAKDKYEAEIKELELSERQTKEKYNQIRGXXXXXXXXXXXXKIMIRQKEKEMDEVKQLYETLNRERDHVSDIIRQEFADRLVTTEEENRKLKREISELRAKINLMQTNHNEDLERIQLNHQSDITEVHNKVKEAIKRKEENMAELKSQYQNETSLWQQKLAAAEKRSNHLESLLEQQRKHLLNLK 3443
            MLTNKQLELKQQQSSLEQIENVRKCFSAERKSNYMSKGYKISSQNKTGDLKDSKRLTDKAVAENEVEKLKLENKIHSRPNSSRTLSSRSKGSNSNQTAKQPKSSMTNKTQELKGIENVIEERKSVEVNSKNTSPVEEKSICENDGKSTNRGSEITTIDDILSTIKELESVDCLTDRSSKFDMKSNQANKCRWSAITEDIDKLLKPEQFKSISNAPSNPFIDNPLTSKALKMHNNNIGRQSQSEINLAPTKPTQSAISDSKMNSILQFLNASEVVDDISELEGRRFTDFPTKHWNVYDVKELEENTQTAVNEVSTKVMTMKLELEERQRSVEMLQKALQQQRELTVRQVKETQKDMEKRMEVQKDEYESALQRNHTFIDQLISKNELLQDKCNKLVVEMKEKTQKYEEKIKNIQENNNVELKKVEAKHLAAEKLRREKWEAEKTKLIKEMTIKGMETEIAQLIANHKQELRKMKQYYENEIIQTGENSYEKYNRQVEELRKQLYKEKEEALQKENSIIKERFDQEMQRQIQILESQRKQLYQEISDERDRLNIMGNKQKAEIENLRKQLEYKEDKVGVSMKLEHQHKLEEMQRKFDTEVRELKTQTELEKQIW+ETNNKRNEAWMLSKEQEIKNEMKKNRDSEIEKVILKLEDDNTQSKQEIESSFGNKLKRAKDKYEAEIKELELSERQ KEKYNQIRGEFLELESEHESLKIMIRQKEKEMDEVKQLYETLNRERDHVSDIIRQEFADRLVTTEEENRKLKREISELRAKINLMQTNHNEDLERIQLNHQSDITEVHNKVKEAIKRKEENMAELKSQYQNETSLWQQKLAAAEKRSNHLESLLEQQRKHLLNLK
Sbjct:    1 MLTNKQLELKQQQSSLEQIENVRKCFSAERKSNYMSKGYKISSQNKTGDLKDSKRLTDKAVAENEVEKLKLENKIHSRPNSSRTLSSRSKGSNSNQTAKQPKSSMTNKTQELKGIENVIEERKSVEVNSKNTSPVEEKSICENDGKSTNRGSEITTIDDILSTIKELESVDCLTDRSSKFDMKSNQANKCRWSAITEDIDKLLKPEQFKSISNAPSNPFIDNPLTSKALKMHNNNIGRQSQSEINLAPTKPTQSAISDSKMNSILQFLNASEVVDDISELEGRRFTDFPTKHWNVYDVKELEENTQTAVNEVSTKVMTMKLELEERQRSVEMLQKALQQQRELTVRQVKETQKDMEKRMEVQKDEYESALQRNHTFIDQLISKNELLQDKCNKLVVEMKEKTQKYEEKIKNIQENNNVELKKVEAKHLAAEKLRREKWEAEKTKLIKEMTIKGMETEIAQLIANHKQELRKMKQYYENEIIQTGENSYEKYNRQVEELRKQLYKEKEEALQKENSIIKERFDQEMQRQIQILESQRKQLYQEISDERDRLNIMGNKQKAEIENLRKQLEYKEDKVGVSMKLEHQHKLEEMQRKFDTEVRELKTQTELEKQIWVETNNKRNEAWMLSKEQEIKNEMKKNRDSEIEKVILKLEDDNTQSKQEIESSFGNKLKRAKDKYEAEIKELELSERQMKEKYNQIRGEFLELESEHESLKIMIRQKEKEMDEVKQLYETLNRERDHVSDIIRQEFADRLVTTEEENRKLKREISELRAKINLMQTNHNEDLERIQLNHQSDITEVHNKVKEAIKRKEENMAELKSQYQNETSLWQQKLAAAEKRSNHLESLLEQQRKHLLNLK 855          
The following BLAST results are available for this feature:
BLAST of Centrosomal protein 131 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CEP1315.822e-10939.39centrosomal protein 131 [Source:HGNC Symbol;Acc:HG... [more]
CEP1316.459e-10939.39centrosomal protein 131 [Source:HGNC Symbol;Acc:HG... [more]
CEP1315.411e-10740.55centrosomal protein 131 [Source:HGNC Symbol;Acc:HG... [more]
CEP1315.061e-8837.37centrosomal protein 131 [Source:HGNC Symbol;Acc:HG... [more]
CEP1315.184e-8837.37centrosomal protein 131 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Centrosomal protein 131 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosomal protein 131 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
dila1.363e-3122.63gene:FBgn0033447 transcript:FBtr0309880[more]
dila1.567e-3122.63gene:FBgn0033447 transcript:FBtr0339409[more]
dila1.726e-3122.63gene:FBgn0033447 transcript:FBtr0309879[more]
back to top
BLAST of Centrosomal protein 131 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cep1315.881e-12639.64Danio rerio centrosomal protein 131 (cep131), mRNA... [more]
cep1311.486e-12239.09Danio rerio centrosomal protein 131 (cep131), mRNA... [more]
cep1313.874e-12239.12centrosomal protein 131 [Source:NCBI gene;Acc:5630... [more]
cep1315.673e-9835.91Danio rerio centrosomal protein 131 (cep131), mRNA... [more]
back to top
BLAST of Centrosomal protein 131 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptger29.322e-12240.27prostaglandin E receptor 2 [Source:Xenbase;Acc:XB-... [more]
ptger29.412e-11939.68prostaglandin E receptor 2 [Source:Xenbase;Acc:XB-... [more]
ptger24.042e-11239.25prostaglandin E receptor 2 [Source:Xenbase;Acc:XB-... [more]
ptger21.162e-11139.26prostaglandin E receptor 2 [Source:Xenbase;Acc:XB-... [more]
ptger29.604e-11039.77prostaglandin E receptor 2 [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of Centrosomal protein 131 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Cep1312.231e-10738.17centrosomal protein 131 [Source:MGI Symbol;Acc:MGI... [more]
Cep1312.534e-10738.17centrosomal protein 131 [Source:MGI Symbol;Acc:MGI... [more]
Cep1312.855e-10738.17centrosomal protein 131 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Centrosomal protein 131 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|U3JAG9|CP131_DANRE2.925e-12139.12Centrosomal protein of 131 kDa OS=Danio rerio OX=7... [more]
sp|Q9UPN4|CP131_HUMAN3.102e-10839.39Centrosomal protein of 131 kDa OS=Homo sapiens OX=... [more]
sp|Q62036|CP131_MOUSE1.997e-10638.17Centrosomal protein of 131 kDa OS=Mus musculus OX=... [more]
sp|A1Z7Z9|CP131_DROME1.730e-3022.63Centrosomal protein of 131 kDa OS=Drosophila melan... [more]
back to top
BLAST of Centrosomal protein 131 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7PW041.630e-12941.02Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A2C9M5K12.028e-12940.54Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A3B3U0Z03.958e-12738.65Centrosomal protein 131 OS=Poecilia latipinna OX=4... [more]
A0A3P9PH672.022e-12638.93Centrosomal protein 131 OS=Poecilia reticulata OX=... [more]
I3KNP93.218e-12639.89Centrosomal protein 131 OS=Oreochromis niloticus O... [more]
back to top
BLAST of Centrosomal protein 131 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cep1316.597e-11937.26Danio rerio centrosomal protein 131 (cep131), mRNA... [more]
back to top
BLAST of Centrosomal protein 131 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cep1311.100e-7736.13Danio rerio centrosomal protein 131 (cep131), mRNA... [more]
back to top
BLAST of Centrosomal protein 131 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosomal protein 131 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO368233.296e-10035.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO385321.417e-1060.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Centrosomal protein 131 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cep1312.233e-12338.77centrosomal protein 131 [Source:NCBI gene;Acc:1011... [more]
cep1312.619e-12038.22centrosomal protein 131 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Centrosomal protein 131 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000051138.10.000e+099.64SMESG000051138.1[more]
SMESG000051138.10.000e+099.77SMESG000051138.1[more]
SMESG000051138.10.000e+099.77SMESG000051138.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011096 ID=SMED30011096|Name=Centrosomal protein 131|organism=Schmidtea mediterranea sexual|type=transcript|length=3847bp
AACCCAAGGTTGTTTAATGTGTTGATATTAGGAACCTCATATTCAAATTT
TTTACATTGTTAATATTCTTAATTGTATTTTCAATATATTTTATTTTACT
CTGTACAATGAATTTCACCATTTATGGATCTCAGCCAATAAAAGATAAAG
GCAAAACATCATCTTTTCAAAATAGCTCTGAAAATGATTTAAATTTTAAA
ACAAAAGATAGAACAAATTCTGTTAGTTCAAGCTACAAAGGGAGACTCAA
CTCTAATATGTCATTACAAGTGACACCATTATCAACGGGTCGTAAACATG
AAGAAAGAAATTCATTCACAAAAGCAAATGACAATGAGAGTGCTCGAACG
AAATTTAGCACGAAATCCGGAAGTACGAAACTATCACTAAACACCAACAA
AATATCTTCCAATAGCGCTGCCAGGTCCAGAAAAGGAAATCTCGACACAT
TTTTGGATCTGAAGCAAATGAGTAACGATTTTCCGGACAACGATGGTGTT
GAAAAATGGTTAAAAGAACAAGATTTGAAAGACTGGGATGAGATCAGTAT
TTCATCGAATAAGAAATCAGTAAAATCTGCTACTGGATCCAAATTTTCTC
ACATGATTCCCATAAACAAGCACGCTTTCGAGAGTCAAAACTACTCACAA
AATTTCGAAGAGGAAAGTATATCATATTCCAGTGAAAGGACGCTGAGTCC
TATTGTAAATTCAAATCGTAAAGGTCTGGAAAATTCAAAAGATGATTTAA
TTAAGGAAAGTCTTTTCAATTCAAATATAATAAACGAGCAATTAAAACAA
AAATCAGCAAAAATTATTCAAGTATGGTATCGACGTCACCTAAAACGACA
GAGGTTAGCTCAAGCAGCAATGAAACGAATGTTGACCAATAAACAGTTAG
AATTAAAACAACAACAATCATCTTTGGAACAAATTGAAAATGTCAGAAAA
TGCTTTTCAGCCGAACGAAAATCGAATTATATGTCTAAAGGATATAAAAT
AAGTTCACAAAATAAAACCGGCGATTTAAAGGATAGTAAAAGATTGACTG
ACAAAGCAGTTGCTGAAAATGAGGTTGAGAAGTTGAAATTGGAAAATAAA
ATACACAGTCGACCCAATTCATCTAGGACTTTATCTTCAAGATCGAAAGG
TTCTAATTCAAATCAGACTGCCAAACAACCTAAAAGCTCAATGACAAACA
AAACACAAGAATTGAAAGGCATTGAAAATGTCATTGAAGAAAGGAAATCG
GTCGAAGTAAACTCAAAGAATACAAGTCCCGTGGAAGAAAAGTCAATATG
TGAAAATGATGGAAAATCTACTAATAGAGGTTCCGAAATTACAACTATTG
ATGATATCCTGTCAACTATCAAAGAACTGGAATCTGTAGATTGTTTGACA
GACAGGTCAAGTAAATTTGACATGAAATCCAATCAGGCCAATAAATGTCG
ATGGAGTGCAATTACAGAAGACATCGACAAATTATTGAAACCAGAACAAT
TCAAATCTATTTCTAATGCACCATCAAACCCTTTCATTGACAATCCGCTC
ACATCAAAAGCCTTGAAGATGCATAACAATAATATAGGTCGTCAAAGCCA
ATCTGAGATAAACTTAGCCCCAACCAAACCAACTCAATCAGCAATTTCAG
ATTCAAAAATGAATAGTATCCTACAATTTCTTAATGCATCAGAAGTGGTC
GACGACATTTCTGAATTGGAAGGCCGTCGGTTTACTGATTTCCCAACAAA
ACATTGGAATGTCTATGATGTTAAAGAATTAGAGGAAAACACGCAGACTG
CCGTGAATGAAGTTTCGACTAAAGTTATGACAATGAAATTGGAATTAGAG
GAAAGGCAGCGTTCCGTTGAAATGTTGCAAAAGGCATTGCAGCAACAGCG
AGAATTAACTGTTCGACAAGTTAAAGAAACTCAAAAAGACATGGAAAAGA
GAATGGAAGTGCAGAAAGATGAATATGAATCAGCTCTTCAGAGAAATCAT
ACTTTCATCGATCAGTTAATATCTAAAAACGAATTGCTTCAAGACAAATG
CAACAAATTAGTTGTAGAAATGAAAGAAAAAACTCAAAAATATGAAGAGA
AAATAAAAAATATTCAAGAAAATAATAATGTTGAGTTAAAAAAGGTTGAA
GCGAAGCATTTAGCAGCTGAGAAGTTAAGACGAGAAAAATGGGAAGCGGA
AAAAACAAAATTAATTAAGGAAATGACTATTAAAGGAATGGAAACCGAAA
TAGCTCAATTAATTGCTAATCATAAACAAGAACTGAGAAAAATGAAACAA
TATTATGAAAATGAAATCATTCAAACCGGCGAAAATTCGTACGAAAAATA
TAATCGACAAGTGGAAGAATTGAGAAAGCAATTATACAAAGAAAAAGAAG
AAGCATTGCAAAAGGAAAATTCCATAATTAAAGAAAGATTTGACCAAGAA
ATGCAAAGGCAAATACAAATTCTTGAATCTCAGCGAAAACAGCTATATCA
AGAAATATCGGATGAACGTGATCGTCTTAATATAATGGGAAACAAACAAA
AAGCTGAAATTGAAAATTTAAGAAAACAACTCGAATACAAAGAAGATAAA
GTAGGTGTATCAATGAAACTAGAACATCAGCATAAATTAGAGGAAATGCA
AAGAAAATTCGATACTGAAGTTCGTGAATTAAAAACTCAAACCGAGTTAG
AAAAACAAATCTGGATTGAAACAAATAACAAAAGAAATGAGGCCTGGATG
TTGAGTAAAGAACAAGAAATTAAAAATGAAATGAAAAAAAATAGAGATAG
TGAAATTGAAAAGGTTATTCTAAAGTTAGAAGATGACAATACGCAGTCTA
AGCAAGAAATTGAATCTTCTTTTGGAAACAAGTTAAAACGAGCCAAAGAC
AAGTACGAAGCCGAAATTAAGGAATTGGAGTTATCCGAGAGGCAAACGAA
GGAAAAATACAACCAAATAAGAGGTGAATTTTTAGAATTGGAAAGTGAAC
ACGAAAGTCTAAAAATAATGATAAGACAAAAAGAAAAAGAAATGGACGAA
GTCAAACAACTATATGAAACTCTCAATAGAGAGCGCGATCACGTATCTGA
TATAATAAGACAAGAGTTTGCCGACAGATTGGTAACCACAGAAGAAGAAA
ATAGAAAATTAAAACGAGAAATTTCTGAATTGAGAGCTAAAATTAATTTA
ATGCAAACCAATCACAACGAGGACTTAGAAAGAATTCAATTGAATCACCA
AAGTGACATAACCGAAGTTCATAACAAAGTCAAAGAAGCTATTAAAAGAA
AAGAAGAAAATATGGCAGAGTTGAAAAGTCAGTATCAGAACGAAACGAGT
CTGTGGCAACAGAAATTAGCAGCAGCCGAAAAAAGATCAAATCATCTCGA
ATCATTGTTAGAACAACAACGAAAGCATTTATTAAATTTAAAATGAATTA
TTAGTGCATAATTGTGATAAGGTCTTTTTGTCTACAAAATCAAGAATTTG
TATTTCAATAAATTTTGTTTTTCGAATGCTCCGTTTGTTTAACAAATTAT
ATGATAACGTTTTTCACATTTTGTCGTTCATTGCAATTAATCTGGTGACG
GAATGGGAGGCTGAATTTCTGGCTTTTCATTCAAAATATCGTCTCGCTTT
AGTGATATATTGCCTATTGGATATTGTGCGTGTATATTGCCACATGGGAT
ATTTAGTTTGTGCATTGCCCTATGGGATATTTGGCTTGTGTATTGGCCTA
TGGGATATTTGGTTTGTGTATTGGCCTATGGGATATTTGGTTTGTGTATT
GGCCTATGGGATATTTGGTTTGTGTATTGGCCTATGGGATATTTGGT
back to top

protein sequence of SMED30011096-orf-1

>SMED30011096-orf-1 ID=SMED30011096-orf-1|Name=SMED30011096-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=107bp
MLRLFNKLYDNVFHILSFIAINLVTEWEAEFLAFHSKYRLALVIYCLLDI
VRVYCHMGYLVCALPYGIFGLCIGLWDIWFVYWPMGYLVCVLAYGIFGLC
IGLWDIW
back to top

protein sequence of SMED30011096-orf-2

>SMED30011096-orf-2 ID=SMED30011096-orf-2|Name=SMED30011096-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1113bp
MNFTIYGSQPIKDKGKTSSFQNSSENDLNFKTKDRTNSVSSSYKGRLNSN
MSLQVTPLSTGRKHEERNSFTKANDNESARTKFSTKSGSTKLSLNTNKIS
SNSAARSRKGNLDTFLDLKQMSNDFPDNDGVEKWLKEQDLKDWDEISISS
NKKSVKSATGSKFSHMIPINKHAFESQNYSQNFEEESISYSSERTLSPIV
NSNRKGLENSKDDLIKESLFNSNIINEQLKQKSAKIIQVWYRRHLKRQRL
AQAAMKRMLTNKQLELKQQQSSLEQIENVRKCFSAERKSNYMSKGYKISS
QNKTGDLKDSKRLTDKAVAENEVEKLKLENKIHSRPNSSRTLSSRSKGSN
SNQTAKQPKSSMTNKTQELKGIENVIEERKSVEVNSKNTSPVEEKSICEN
DGKSTNRGSEITTIDDILSTIKELESVDCLTDRSSKFDMKSNQANKCRWS
AITEDIDKLLKPEQFKSISNAPSNPFIDNPLTSKALKMHNNNIGRQSQSE
INLAPTKPTQSAISDSKMNSILQFLNASEVVDDISELEGRRFTDFPTKHW
NVYDVKELEENTQTAVNEVSTKVMTMKLELEERQRSVEMLQKALQQQREL
TVRQVKETQKDMEKRMEVQKDEYESALQRNHTFIDQLISKNELLQDKCNK
LVVEMKEKTQKYEEKIKNIQENNNVELKKVEAKHLAAEKLRREKWEAEKT
KLIKEMTIKGMETEIAQLIANHKQELRKMKQYYENEIIQTGENSYEKYNR
QVEELRKQLYKEKEEALQKENSIIKERFDQEMQRQIQILESQRKQLYQEI
SDERDRLNIMGNKQKAEIENLRKQLEYKEDKVGVSMKLEHQHKLEEMQRK
FDTEVRELKTQTELEKQIWIETNNKRNEAWMLSKEQEIKNEMKKNRDSEI
EKVILKLEDDNTQSKQEIESSFGNKLKRAKDKYEAEIKELELSERQTKEK
YNQIRGEFLELESEHESLKIMIRQKEKEMDEVKQLYETLNRERDHVSDII
RQEFADRLVTTEEENRKLKREISELRAKINLMQTNHNEDLERIQLNHQSD
ITEVHNKVKEAIKRKEENMAELKSQYQNETSLWQQKLAAAEKRSNHLESL
LEQQRKHLLNLK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005813centrosome
GO:0015630microtubule cytoskeleton
GO:0035869ciliary transition zone
GO:0036064ciliary basal body
GO:0043231intracellular membrane-bounded organelle
GO:0045171intercellular bridge
GO:0000775chromosome, centromeric region
GO:0005694chromosome
GO:0005929cilium
GO:0034451centriolar satellite
Vocabulary: biological process
TermDefinition
GO:0008284positive regulation of cell proliferation
GO:0071539protein localization to centrosome
GO:0090316positive regulation of intracellular protein transport
GO:0006810transport
GO:0010824regulation of centrosome duplication
GO:0030030cell projection organization
GO:0030154cell differentiation
GO:0032402melanosome transport
GO:0035721intraciliary retrograde transport
GO:0035735intraciliary transport involved in cilium assembly
GO:0050953sensory perception of light stimulus
GO:0060271cilium morphogenesis
GO:0060287epithelial cilium movement involved in determination of left/right asymmetry
GO:0070121Kupffer's vesicle development
GO:0090317negative regulation of intracellular protein transport
Vocabulary: molecular function
TermDefinition
GO:0042803protein homodimerization activity
GO:0044877macromolecular complex binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002056medial muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR030465CEP131
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 580..600
NoneNo IPR availableCOILSCoilCoilcoord: 708..735
NoneNo IPR availableCOILSCoilCoilcoord: 1055..1107
NoneNo IPR availableCOILSCoilCoilcoord: 685..705
NoneNo IPR availableCOILSCoilCoilcoord: 259..279
NoneNo IPR availableCOILSCoilCoilcoord: 1001..1035
NoneNo IPR availableCOILSCoilCoilcoord: 738..777
NoneNo IPR availableCOILSCoilCoilcoord: 779..831
NoneNo IPR availableCOILSCoilCoilcoord: 923..992
NoneNo IPR availableCOILSCoilCoilcoord: 634..679
NoneNo IPR availableCOILSCoilCoilcoord: 602..629
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 57..90
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 324..397
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..43
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 335..370
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 74..90
IPR030465Centrosomal protein of 131kDaPANTHERPTHR31540FAMILY NOT NAMEDcoord: 84..1109