G_PROTEIN_RECEP_F1_2 domain-containing protein

Overview
NameG_PROTEIN_RECEP_F1_2 domain-containing protein
Smed IDSMED30011094
Length (bp)1457
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30011094) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30011094) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011094

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30011094SMESG000007702.1 SmedASXL_010030SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30011094SMESG000007702.1 dd_Smed_v4_19671_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30011094SMESG000007702.1 dd_Smed_v6_19671_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30011094SMESG000007702.1 OX_Smed_1.0.06952ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: frpr-18 (FLP-2 receptor; FMRFamide Peptide Receptor family [Source:UniProtKB/TrEMBL;Acc:G5EEB1])

HSP 1 Score: 53.1434 bits (126), Expect = 2.987e-7
Identity = 38/137 (27.74%), Postives = 72/137 (52.55%), Query Frame = 1
Query:  202 VLLFTGLIGNSVSFIIWTNPRIRRNNXXXXXXXXXXXXXXXXXXTHFMHYLK----FAWRIKVFDY-AGVCEMFQMIYLMFQYNSTPLVLAFTLERWIAVCYPFKRERWCTSKRAYLAITLIFIIMLLIGVVQAFAW 597
            V++  G+ GNS+SFI+++ P +R ++ +    +       +L L+  +  +     +A  + +  Y A + ++   I LM Q  S  +++  TLERW+AVC P +   WCT +++  AI +I +   L   V+ F +
Sbjct:   13 VIVLVGIFGNSLSFILFSRPHMRSSSVNVLLCALSFFDFSLLTLSIPIFVIPNLDLWANDLSLSTYMAYILKLIYPINLMMQTCSVYIMVMITLERWVAVCRPLQVRVWCTPRKSRNAILVIIVSAFLYNFVRFFEY 149          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: frpr-18 (FLP-2 receptor; FMRFamide Peptide Receptor family [Source:UniProtKB/TrEMBL;Acc:G5EEB1])

HSP 1 Score: 52.7582 bits (125), Expect = 3.677e-7
Identity = 38/137 (27.74%), Postives = 72/137 (52.55%), Query Frame = 1
Query:  202 VLLFTGLIGNSVSFIIWTNPRIRRNNXXXXXXXXXXXXXXXXXXTHFMHYLK----FAWRIKVFDY-AGVCEMFQMIYLMFQYNSTPLVLAFTLERWIAVCYPFKRERWCTSKRAYLAITLIFIIMLLIGVVQAFAW 597
            V++  G+ GNS+SFI+++ P +R ++ +    +       +L L+  +  +     +A  + +  Y A + ++   I LM Q  S  +++  TLERW+AVC P +   WCT +++  AI +I +   L   V+ F +
Sbjct:   13 VIVLVGIFGNSLSFILFSRPHMRSSSVNVLLCALSFFDFSLLTLSIPIFVIPNLDLWANDLSLSTYMAYILKLIYPINLMMQTCSVYIMVMITLERWVAVCRPLQVRVWCTPRKSRNAILVIIVSAFLYNFVRFFEY 149          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: frpr-18 (FLP-2 receptor; FMRFamide Peptide Receptor family [Source:UniProtKB/TrEMBL;Acc:G5EEB1])

HSP 1 Score: 51.9878 bits (123), Expect = 5.257e-7
Identity = 38/137 (27.74%), Postives = 72/137 (52.55%), Query Frame = 1
Query:  202 VLLFTGLIGNSVSFIIWTNPRIRRNNXXXXXXXXXXXXXXXXXXTHFMHYLK----FAWRIKVFDY-AGVCEMFQMIYLMFQYNSTPLVLAFTLERWIAVCYPFKRERWCTSKRAYLAITLIFIIMLLIGVVQAFAW 597
            V++  G+ GNS+SFI+++ P +R ++ +    +       +L L+  +  +     +A  + +  Y A + ++   I LM Q  S  +++  TLERW+AVC P +   WCT +++  AI +I +   L   V+ F +
Sbjct:   13 VIVLVGIFGNSLSFILFSRPHMRSSSVNVLLCALSFFDFSLLTLSIPIFVIPNLDLWANDLSLSTYMAYILKLIYPINLMMQTCSVYIMVMITLERWVAVCRPLQVRVWCTPRKSRNAILVIIVSAFLYNFVRFFEY 149          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: CNMaR (gene:FBgn0053696 transcript:FBtr0091684)

HSP 1 Score: 56.9954 bits (136), Expect = 2.306e-8
Identity = 42/154 (27.27%), Postives = 74/154 (48.05%), Query Frame = 1
Query:  148 FRLKFLVLASLCHRWITPVLLFTGLIGNSVSFIIWTNPRIRRNNXXXXXXXXXXXXXXXXXXTHFMHYLKFAW----RIKVFDYAGVCEMFQMIYLMFQYNSTPLVLAFTLERWIAVCYPFKRERWCTSKRAYLAITLIFIIMLLIGVVQAFAW 597
             R+ F +     H++  PVL  TG IGN +S  ++   ++R+        S+  L+ L +  T F+  L   W     + +++    C+ F     +  + S   V+AFT+ER+IAV YP KR+  CT +RA     ++   + L+G +    +
Sbjct:   51 LRIAFFI-GHFVHQYYIPVLCCTGSIGNILSVFVFFRTKLRK------LSSSFYLAALAVSDTCFLAGLFAQWLNFLNVDIYNQNYFCQFFTFFSYLASFCSVWFVVAFTVERFIAVIYPLKRQTMCTVRRA----KIVLFCLTLVGCLHCLPY 193          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: Proc-R (gene:FBgn0029723 transcript:FBtr0100552)

HSP 1 Score: 51.6026 bits (122), Expect = 1.261e-6
Identity = 44/162 (27.16%), Postives = 69/162 (42.59%), Query Frame = 1
Query:  184 HRWITPVLLFTGLIGNSVSFIIWTNPRIR--RNNXXXXXXXXXXXXXXXXXXTHFMHY------LKFAWRIKVFDYAGVCEMFQMIYLMFQYNSTPLVLAFTLERWIAVCYPFKRERWCTSKRAYLAITLIFIIMLLIGVVQAFAWSTNNEQRVCKFRDSWQ 645
             R + P +   GL+GNSVS  + T  R+R   N                 L+    HY       K  W++  + +  +C+ F  I       S  + + FT+ER+IA+ YP KR+ +CT   A   I  + I  LL  +  AF  +     R  +  D++Q
Sbjct:   43 QRILVPCVFVIGLLGNSVSIYVLTRKRMRCTTNIYLTALAITDIAYLTCQLILSLQHYDYPKYHFKLYWQLYGY-FVWLCDSFGYI-------SIYIAVCFTIERFIAIRYPLKRQTFCTESLAKKVIAAVAIFCLLSTLSTAFEHTITIGTR--QIDDAYQ 194          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: Proc-R (gene:FBgn0029723 transcript:FBtr0070713)

HSP 1 Score: 51.6026 bits (122), Expect = 1.261e-6
Identity = 44/162 (27.16%), Postives = 69/162 (42.59%), Query Frame = 1
Query:  184 HRWITPVLLFTGLIGNSVSFIIWTNPRIR--RNNXXXXXXXXXXXXXXXXXXTHFMHY------LKFAWRIKVFDYAGVCEMFQMIYLMFQYNSTPLVLAFTLERWIAVCYPFKRERWCTSKRAYLAITLIFIIMLLIGVVQAFAWSTNNEQRVCKFRDSWQ 645
             R + P +   GL+GNSVS  + T  R+R   N                 L+    HY       K  W++  + +  +C+ F  I       S  + + FT+ER+IA+ YP KR+ +CT   A   I  + I  LL  +  AF  +     R  +  D++Q
Sbjct:   43 QRILVPCVFVIGLLGNSVSIYVLTRKRMRCTTNIYLTALAITDIAYLTCQLILSLQHYDYPKYHFKLYWQLYGY-FVWLCDSFGYI-------SIYIAVCFTIERFIAIRYPLKRQTFCTESLAKKVIAAVAIFCLLSTLSTAFEHTITIGTR--QIDDAYQ 194          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: Proc-R (gene:FBgn0029723 transcript:FBtr0100551)

HSP 1 Score: 51.6026 bits (122), Expect = 1.261e-6
Identity = 44/162 (27.16%), Postives = 69/162 (42.59%), Query Frame = 1
Query:  184 HRWITPVLLFTGLIGNSVSFIIWTNPRIR--RNNXXXXXXXXXXXXXXXXXXTHFMHY------LKFAWRIKVFDYAGVCEMFQMIYLMFQYNSTPLVLAFTLERWIAVCYPFKRERWCTSKRAYLAITLIFIIMLLIGVVQAFAWSTNNEQRVCKFRDSWQ 645
             R + P +   GL+GNSVS  + T  R+R   N                 L+    HY       K  W++  + +  +C+ F  I       S  + + FT+ER+IA+ YP KR+ +CT   A   I  + I  LL  +  AF  +     R  +  D++Q
Sbjct:   43 QRILVPCVFVIGLLGNSVSIYVLTRKRMRCTTNIYLTALAITDIAYLTCQLILSLQHYDYPKYHFKLYWQLYGY-FVWLCDSFGYI-------SIYIAVCFTIERFIAIRYPLKRQTFCTESLAKKVIAAVAIFCLLSTLSTAFEHTITIGTR--QIDDAYQ 194          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: Proc-R (gene:FBgn0029723 transcript:FBtr0070714)

HSP 1 Score: 51.6026 bits (122), Expect = 1.261e-6
Identity = 44/162 (27.16%), Postives = 69/162 (42.59%), Query Frame = 1
Query:  184 HRWITPVLLFTGLIGNSVSFIIWTNPRIR--RNNXXXXXXXXXXXXXXXXXXTHFMHY------LKFAWRIKVFDYAGVCEMFQMIYLMFQYNSTPLVLAFTLERWIAVCYPFKRERWCTSKRAYLAITLIFIIMLLIGVVQAFAWSTNNEQRVCKFRDSWQ 645
             R + P +   GL+GNSVS  + T  R+R   N                 L+    HY       K  W++  + +  +C+ F  I       S  + + FT+ER+IA+ YP KR+ +CT   A   I  + I  LL  +  AF  +     R  +  D++Q
Sbjct:   43 QRILVPCVFVIGLLGNSVSIYVLTRKRMRCTTNIYLTALAITDIAYLTCQLILSLQHYDYPKYHFKLYWQLYGY-FVWLCDSFGYI-------SIYIAVCFTIERFIAIRYPLKRQTFCTESLAKKVIAAVAIFCLLSTLSTAFEHTITIGTR--QIDDAYQ 194          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: trhra (thyrotropin-releasing hormone receptor a [Source:ZFIN;Acc:ZDB-GENE-100922-18])

HSP 1 Score: 50.0618 bits (118), Expect = 4.064e-6
Identity = 47/162 (29.01%), Postives = 77/162 (47.53%), Query Frame = 1
Query:  376 VFDYAGVCEMFQMIYLMFQYNSTPLVLAFTLERWIAVCYPFKRERWCTSKRAYLAITLIFIIMLLIGVVQAFAWST------NNEQRVCKFRDSWQRSMLNQGFTTTVEFLMSGGVPICTLIFNILVIYELRSIVLNPLKQDPNKVNKKNRENKSQLSVSEK 843
            V+ YAG   +    YL    +S  +  AFT+ER+IA+C+P K +  CT  RA   I L++++  L  V+  +   T      N     C ++ S +   L   FT    F +   +P+  L+  +L     R + LNPL  DP K +++N + +S    S +
Sbjct:   87 VYGYAGCLSITYFQYLGINASSCSIT-AFTIERYIAICHPIKAQFMCTLSRAKKIIVLVWVLTSLYCVMWFYLLDTREKVYDNAVLVTCGYKVS-RELYLPIYFTDYAVFYV---IPL--LLATVLYGLIARILFLNPLPSDP-KESRRNWKKESTTVASRR 240          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: trhra (thyrotropin-releasing hormone receptor a [Source:ZFIN;Acc:ZDB-GENE-100922-18])

HSP 1 Score: 49.6766 bits (117), Expect = 5.320e-6
Identity = 46/157 (29.30%), Postives = 76/157 (48.41%), Query Frame = 1
Query:  376 VFDYAGVCEMFQMIYLMFQYNSTPLVLAFTLERWIAVCYPFKRERWCTSKRAYLAITLIFIIMLLIGVVQAFAWST------NNEQRVCKFRDSWQRSMLNQGFTTTVEFLMSGGVPICTLIFNILVIYELRSIVLNPLKQDPNKVNKKNRENKSQL 828
            V+ YAG   +    YL    +S  +  AFT+ER+IA+C+P K +  CT  RA   I L++++  L  V+  +   T      N     C ++ S +   L   FT    F +   +P+  L+  +L     R + LNPL  DP K +++N + +S +
Sbjct:   87 VYGYAGCLSITYFQYLGINASSCSIT-AFTIERYIAICHPIKAQFMCTLSRAKKIIVLVWVLTSLYCVMWFYLLDTREKVYDNAVLVTCGYKVS-RELYLPIYFTDYAVFYV---IPL--LLATVLYGLIARILFLNPLPSDP-KESRRNWKKESSV 235          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: trhra (thyrotropin-releasing hormone receptor a [Source:ZFIN;Acc:ZDB-GENE-100922-18])

HSP 1 Score: 49.6766 bits (117), Expect = 5.887e-6
Identity = 46/157 (29.30%), Postives = 76/157 (48.41%), Query Frame = 1
Query:  376 VFDYAGVCEMFQMIYLMFQYNSTPLVLAFTLERWIAVCYPFKRERWCTSKRAYLAITLIFIIMLLIGVVQAFAWST------NNEQRVCKFRDSWQRSMLNQGFTTTVEFLMSGGVPICTLIFNILVIYELRSIVLNPLKQDPNKVNKKNRENKSQL 828
            V+ YAG   +    YL    +S  +  AFT+ER+IA+C+P K +  CT  RA   I L++++  L  V+  +   T      N     C ++ S +   L   FT    F +   +P+  L+  +L     R + LNPL  DP K +++N + +S +
Sbjct:   87 VYGYAGCLSITYFQYLGINASSCSIT-AFTIERYIAICHPIKAQFMCTLSRAKKIIVLVWVLTSLYCVMWFYLLDTREKVYDNAVLVTCGYKVS-RELYLPIYFTDYAVFYV---IPL--LLATVLYGLIARILFLNPLPSDP-KESRRNWKKESSV 235          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: trhra (thyrotropin-releasing hormone receptor a [Source:ZFIN;Acc:ZDB-GENE-100922-18])

HSP 1 Score: 49.2914 bits (116), Expect = 6.259e-6
Identity = 46/157 (29.30%), Postives = 76/157 (48.41%), Query Frame = 1
Query:  376 VFDYAGVCEMFQMIYLMFQYNSTPLVLAFTLERWIAVCYPFKRERWCTSKRAYLAITLIFIIMLLIGVVQAFAWST------NNEQRVCKFRDSWQRSMLNQGFTTTVEFLMSGGVPICTLIFNILVIYELRSIVLNPLKQDPNKVNKKNRENKSQL 828
            V+ YAG   +    YL    +S  +  AFT+ER+IA+C+P K +  CT  RA   I L++++  L  V+  +   T      N     C ++ S +   L   FT    F +   +P+  L+  +L     R + LNPL  DP K +++N + +S +
Sbjct:   91 VYGYAGCLSITYFQYLGINASSCSIT-AFTIERYIAICHPIKAQFMCTLSRAKKIIVLVWVLTSLYCVMWFYLLDTREKVYDNAVLVTCGYKVS-RELYLPIYFTDYAVFYV---IPL--LLATVLYGLIARILFLNPLPSDP-KESRRNWKKESSV 239          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A193KUK6 (GCR079 OS=Schmidtea mediterranea OX=79327 GN=gcr079 PE=2 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 5.782e-61
Identity = 139/379 (36.68%), Postives = 208/379 (54.88%), Query Frame = 1
Query:  184 HRWITPVLLFTGLIGNSVSFIIWTNPRIRRNNXXXXXXXXXXXXXXXXXXTHFMHYLKFAWRIKVFDYAGVCEMFQMIYLMFQYNSTPLVLAFTLERWIAVCYPFKRERWCTSKRAYLAITLIFIIMLLIGVVQAFAWSTNNEQRVCKFRDSWQRSMLNQGFTTTVEFLMSGGVPICTLIFNILVIYELRSIVLNPLKQDPNKVNKKNRENKSQLSVSEKISFSSKNEKGLESFDVNAENSNLLSQPVGKSVIKRYTFVNNAHKMQRFQSSGGVNFRSTTIMLLTVSFYQIITTLPSGAVYVSQFFISGGNEFLSDNEIENDPNWRTFFRHQTMKEFVDLFSLTHYCFNVLIYLLTGRQFRKYLLQILKLDKCIYGADS 1320
            HR+ + + L +GL+ N+++FIIWT PR+RR+N+SA YL+ +++SD I  L + +HY++ +W I V D    CEMFQ +++  QY S PLVL F+LER+IAVC+PFKRE+ CT ++A +   +  +  L++G  Q+ +   N+  + C  R S   +     F T  E L+S  +P  TLI NILVI EL+SI        P+          S  S SE+     +N+   E  ++   +   +SQ                      Q+     F+S+TI+LL+VSF  I+TTLP+G VY  QF    GNE LS  +++ DP+W  F  +Q +KE VD FS+ H+  N +IY +TG  FR     + +  K   G D 
Sbjct:   32 HRYGSLLWLMSGLVLNTLAFIIWTRPRLRRSNTSANYLAGIAMSDTIFWLLYILHYMQTSWDICVQDIPVWCEMFQGLFISSQYFSVPLVLIFSLERYIAVCHPFKREKLCTHRKALVNTIVCGVTALILGCSQSISREYNDVSKKCDIRGSVVNTRNWFIFATGTEILISALLPFATLIVNILVIIELKSITSKTTLIKPSVTAPLT----SSTSTSEQHLQIQRNQGSTEKLNIKKHS---ISQ----------------------QNKEKSAFKSSTILLLSVSFLLIVTTLPTGFVYALQFVCPVGNETLSVEQMKVDPDWIKFINYQILKEVVDFFSMIHFSINFVIYYITGESFRTEFYLLFQNAKRFKGPDD 381          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A3P7L2X2 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS7516 PE=4 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 2.278e-54
Identity = 136/396 (34.34%), Postives = 201/396 (50.76%), Query Frame = 1
Query:  112 TTVFIRYPTNIEFRLKFLVLASLCHRWITPVLLFTGLIGNSVSFIIWTNPRIRRNNXXXXXXXXXXXXXXXXXXTHFMHYLK-FAWRIKVFDYAGVCEMFQMIYLMFQYNSTPLVLAFTLERWIAVCYPFKRERWCTSKRAYLAITLIFIIMLLIGVVQAFAWSTNNEQRVCKFRDSWQRSMLNQGFTTTVEFLMSGGVPICTLIFNILVIYELRSIVLNPLKQDPNKVNKKNRENKSQLSVSEKISFSSKNEKGLESFDVNAENSNLLSQ---PVGKSVIKRYTFVNNAHKMQRFQSSGGVNFRSTTIMLLTVSFYQIITTLPSGAVYVSQFFISGGNEFLSDNEIENDPNWRTFFRHQTMKEFVDLFSLTHYCFNVLIYLLTGRQFRKYLLQIL 1287
            T+++ RYP     + +F+  A     + +PV  F GLIGN++SF+IW + R R  NSSA YL+AL+LSD  L+L  F  YL+ F +        G+C++FQ ++L  QY S  L   FTLERWIA+CYPFKR + C+S+RA + ++ + +I++   V  A AW   + +  C     WQ       + +TVE + S  VP+ TL+FNILV+ E+  +V + +                                      V  +NS+L  Q        V +    +   H      +    NF + T+ML+ +SFY I+ TLP G V+V Q   +  +EFL+D E+   P WR +F     KE VD    +HY  N +IYL+TG+ FR  LL  L
Sbjct:   11 TSIYQRYPGGHLLK-RFVPDAFYLKLYASPVWFFVGLIGNAISFLIWVSHRQRGKNSSAIYLAALALSDFFLILLLFSDYLRRFLFFESPITVNGLCQLFQGVFLFLQYYSIALTFGFTLERWIAICYPFKRHKLCSSRRALIGVSALAVIVISFNVFYAAAWEIVDHE--CVLAARWQDDSSFYIYLSTVECVFSLLVPLATLVFNILVLREIGKLVRSKII-------------------------------------VKGQNSSLFRQRSSTKSAHVPEHQLILGAKHSGHSASAKEQSNFHAATVMLVILSFYLILCTLPVGIVFVVQMRFTSFSEFLTDEEVLQHPQWREYFGFLRAKEIVDFLCSSHYACNFIIYLITGKSFRSQLLDTL 366          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A0R3SRL8 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS7827 PE=4 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 1.232e-53
Identity = 128/370 (34.59%), Postives = 196/370 (52.97%), Query Frame = 1
Query:  190 WITPVLLFTGLIGNSVSFIIWTNPRIRRNNXXXXXXXXXXXXXXXXXXTHFMHYLKFAWRIKVF-DYAGVCEMFQMIYLMFQYNSTPLVLAFTLERWIAVCYPFKRERWCTSKRAYLAITLIFIIMLLIGVVQAFAWSTNNEQRVCKFRDSWQRSMLNQGFTTTVEFLMSGGVPICTLIFNILVIYELRSIVLNPLKQDPNKVNKKNRENKSQLSVSEKISFSSKNEKGLESFDVNAENSNLLSQPVGKSVIKRYT---FVNNAHKMQRFQSSGGVNFRSTTIMLLTVSFYQIITTLPSGAVYVSQFFISGGNEFLSDNEIENDPNWRTFFRHQTMKEFVDLFSLTHYCFNVLIYLLTGRQFRKYLLQIL 1287
            + +P+    G +GN +SF IW +PR R  NSSA YL+ L+L+DL+L++  F  YL+    I  F    G+C++FQ I+L  QY S  L   FTLERWIA+CYPFKR+  C++KRA + ++++ +I+    +  A  W   N   +C     WQ       + +T E + S  +PI TL+FN LV+ E+  +V                  KS++ VS     SS     +     + + ++  ++P G  + +  T    +   H      +    NF++ T+ML+ +SFY II TLP G VYV Q   SG NE ++D E+  +P  + F R  T KE +D    +HY  N +IY+LTG+ FR+ L  I+
Sbjct:   27 YASPIWFVVGFVGNLISFYIWASPRQRGKNSSAIYLATLALTDLLLIICLFTEYLRLYLFISSFLSVNGICQLFQGIFLFLQYYSIVLTFGFTLERWIAICYPFKRQELCSTKRALVGVSVLAMIVACFSIFFASTWEVTNG--ICTLSKRWQMDAYFSIYLSTTECIFSLIIPIATLVFNCLVLREIGHLV------------------KSKILVSRG---SSHRNTSIARRLHHNQAAHQRNRPTGDRLNETSTEPLVLGAKHSSAHASAKEQANFQAVTLMLVILSFYLIICTLPVGIVYVVQMRFSGINEEIADEEVPVNPELQQFLRFLTAKEIIDFLCSSHYACNFIIYVLTGKSFRQQLQDII 373          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A0R3UN11 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS9156 PE=4 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 1.625e-53
Identity = 129/391 (32.99%), Postives = 203/391 (51.92%), Query Frame = 1
Query:  118 VFIRYPTNIEFRLKFLVLASLCHRWITPVLLFTGLIGNSVSFIIWTNPRIRRNNXXXXXXXXXXXXXXXXXXTHFMHYLKFAWRIK-VFDYAGVCEMFQMIYLMFQYNSTPLVLAFTLERWIAVCYPFKRERWCTSKRAYLAITLIFIIMLLIGVVQAFAWSTNNEQRVCKFRDSWQRSMLNQGFTTTVEFLMSGGVPICTLIFNILVIYELRSIVLNPLKQDPNKVNKKNRENKSQLSVSEKISFSSKNEKGLESFDVNAENSNLLSQPVGKSVIKRYTFVNNAHKMQRFQSSGGVNFRSTTIMLLTVSFYQIITTLPSGAVYVSQFFISGGNEFLSDNEIENDPNWRTFFRHQTMKEFVDLFSLTHYCFNVLIYLLTGRQFRKYLLQIL 1287
            V++RYP  + F+ +F+        + +P+    G+IGN +SF+IW + R R  NSSA YL+ L+L+D +L +  F  YL+  + +       G+C++FQ ++L  QY S  L   FTLERWIA+CYPFKR++ C++ RA + ++++ II+    +  A  W  N  Q  C   D WQ       + +  E + S  VPI TL+FNILV+ E+ ++V                  KS++ VS     S +  +      V    +N   Q  G  ++     +   H      +    NF++ T+ML+ +SFY I+ TLP G V+V Q   +G  + L D EI  +P W  + +    KE +D    +HY  N +IY+LTG+ FR++L  IL
Sbjct:   10 VYLRYPGGLLFK-RFIPDVFKLKLYASPIWFIVGIIGNLISFLIWVSRRQRGKNSSAVYLATLALTDFLLTICLFTEYLRIYFFLSSPLSVNGICQLFQGVFLFLQYYSIVLTFGFTLERWIAICYPFKRQKLCSTTRALVGVSVLAIIVSGFSMFFAATWEVN--QGACILADRWQEDRAFAIYLSATECIFSLIVPIATLVFNILVLREISNVV------------------KSKMFVSHADLLSRRTNQA----PVPRAEAN---QTAGAPLV-----IGAKHSSVHASAKEQANFQAVTLMLVVLSFYLILCTLPVGIVFVVQMRFTGIPDDLDDEEILANPAWLQYLQFMKAKEIIDFVCSSHYACNFIIYILTGKSFRQHLKDIL 367          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: H2KNM7 (Growth hormone secretagogue receptor OS=Clonorchis sinensis OX=79923 GN=CLF_100438 PE=3 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 6.520e-52
Identity = 135/367 (36.78%), Postives = 202/367 (55.04%), Query Frame = 1
Query:  208 LFTGLIGNSVSFIIWTNPRIRRNNXXXXXXXXXXXXXXXXXXTHFMHYLKFAWRIK-VFDYAGVCEMFQMIYLMFQYNSTPLVLAFTLERWIAVCYPFKRERWCTSKRAYLAITLIFIIMLLIGVVQAFAWSTNNEQRVCKFRDSWQRSMLNQGFTTTVEFLMSGGVPICTLIFNILVIYELRSIVLNPLKQDPNKVNKKNRENKSQLSVSEKISFSSKNEKGLESFDVNAENSNLLSQPVGKSVIKRYTFVNNAHKMQRFQSSGGVNFRSTTIMLLTVSFYQIITTLPSGAVYVSQFFISGGNEFLSDNEIENDPNWRTFFRHQTMKEFVDLFSLTHYCFNVLIYLLTGRQFRKYLLQIL--KLDK 1299
            L  GL GN++SF IW     RR ++SA YLSAL+L+DLIL+LT   ++++  W +  V    G+C+++Q + L  QY ST LV  FTLER++AVCYPF+R + C+ +RA LAI ++ +I  +  + Q   W+  N   VCK R  W R    Q   T  E + S  VP+  L+FNILV+ E+R ++ N  +  P       R+ + Q     K+    +    L S  V A  S     P  K+  +  TF+                  +TTIML+ +SFY I   +P G VY++QF  +  ++ ++D+ I  DP W  FF +   KE++DLF  +HY  NV+IYLLT + FR++ + IL  ++DK
Sbjct:   57 LTIGLFGNTLSFAIWVTKHQRRKSTSAIYLSALALADLILILTLVNYHVERYWGLPGVTSVNGLCQIYQCLTLFAQYYSTTLVFGFTLERYLAVCYPFRRHKLCSPQRAVLAIVILLLICAVPMLFQTVLWTYENG--VCKMRMEWLRDPRIQWILTDQEIIFSLIVPLAALVFNILVLREMRRLIRN--RAAPKTPLLVRRQTRKQ----SKLFLKLRKGSTLSSNSVCAGES-----PEDKAQQESSTFI------------------ATTIMLVILSFYLIACAVPPGVVYLAQFTWAQPDDCMNDDSIRTDPKWNRFFGNLMSKEYIDLFCASHYALNVVIYLLTSKGFREHAIWILTCQVDK 392          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: TRHR (thyrotropin-releasing hormone receptor [Source:NCBI gene;Acc:103040459])

HSP 1 Score: 50.0618 bits (118), Expect = 3.071e-6
Identity = 44/165 (26.67%), Postives = 82/165 (49.70%), Query Frame = 1
Query:  376 VFDYAGVCEMFQMIYLMFQYNSTPLVLAFTLERWIAVCYPFKRERWCTSKRAYLAITLIFIIMLLIGVVQAFAWSTNNEQR-------VCKFRDSWQRSMLNQGFTTTVEFLMSGGVPICTLIFNILVIYELRSIVLNPLKQDPNKVNKKNRENKSQLSVSEKIS 849
            V+ YAG   +  + Y+    +S  +  AFT+ER+IA+C+P + +  CT  RA   I L++    L  V+  F  +   +Q        +C ++ S +   L   FT   +F +   +P+  L+  +L     R ++LNPL  DP + +K  R++ +  S +++ +
Sbjct:   97 VYGYAGCLSITYLQYVGINASSCSIT-AFTVERYIAICHPIRAQSLCTLSRAKKIIALVWTFTGLYCVMW-FCLADLEQQTHGNTTVVICAYKVS-RTQYLPIYFT---DFALFYVLPL--LLATVLYGLIARILILNPLPSDPKENSKAWRKSTNTSSSTQRAA 253          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000007702.1 (SMESG000007702.1)

HSP 1 Score: 837.795 bits (2163), Expect = 0.000e+0
Identity = 442/443 (99.77%), Postives = 443/443 (100.00%), Query Frame = 1
Query:  106 MNTTVFIRYPTNIEFRLKFLVLASLCHRWITPVLLFTGLIGNSVSFIIWTNPRIRRNNXXXXXXXXXXXXXXXXXXTHFMHYLKFAWRIKVFDYAGVCEMFQMIYLMFQYNSTPLVLAFTLERWIAVCYPFKRERWCTSKRAYLAITLIFIIMLLIGVVQAFAWSTNNEQRVCKFRDSWQRSMLNQGFTTTVEFLMSGGVPICTLIFNILVIYELRSIVLNPLKQDPNKVNKKNRENKSQLSVSEKISFSSKNEKGLESFDVNAENSNLLSQPVGKSVIKRYTFVNNAHKMQRFQSSGGVNFRSTTIMLLTVSFYQIITTLPSGAVYVSQFFISGGNEFLSDNEIENDPNWRTFFRHQTMKEFVDLFSLTHYCFNVLIYLLTGRQFRKYLLQILKLDKCIYGADSNKTVSNVRSSIYXXXXXXXXXXXXXNNTIITNAHSKKS 1434
            MNTTVFIRYPTNIEFRLKFLVLASLCHRWITPVLLFTGLIGNSVSFIIWTNPRIRRNNSSATYLSALSLSDLILLLTHFMHYLKFAWRIKVFDYAGVCEMFQMIYLMFQYNSTPLVLAFTLERWIAVCYPFKRERWCTSKRAYLAITLIFIIMLLIGVVQAFAWSTNNEQRVCKFRDSWQRSMLNQGFTTTVEFLMSGGVPICTLIFNILVIYELRSIVLNPLKQDPNKVNKKNRENKSQLSVSEKISFSSKNEKGLESFDVNAENSNLLSQPVGKSVIKRYTFVNNAHKMQRFQSSGGVNFRSTTIMLLTVSFYQIITTLPSGAVYVSQFFISGGNEFLSD+EIENDPNWRTFFRHQTMKEFVDLFSLTHYCFNVLIYLLTGRQFRKYLLQILKLDKCIYGADSNKTVSNVRSSIYGGGAGGGCGGGGCNNTIITNAHSKKS
Sbjct:    1 MNTTVFIRYPTNIEFRLKFLVLASLCHRWITPVLLFTGLIGNSVSFIIWTNPRIRRNNSSATYLSALSLSDLILLLTHFMHYLKFAWRIKVFDYAGVCEMFQMIYLMFQYNSTPLVLAFTLERWIAVCYPFKRERWCTSKRAYLAITLIFIIMLLIGVVQAFAWSTNNEQRVCKFRDSWQRSMLNQGFTTTVEFLMSGGVPICTLIFNILVIYELRSIVLNPLKQDPNKVNKKNRENKSQLSVSEKISFSSKNEKGLESFDVNAENSNLLSQPVGKSVIKRYTFVNNAHKMQRFQSSGGVNFRSTTIMLLTVSFYQIITTLPSGAVYVSQFFISGGNEFLSDDEIENDPNWRTFFRHQTMKEFVDLFSLTHYCFNVLIYLLTGRQFRKYLLQILKLDKCIYGADSNKTVSNVRSSIYGGGAGGGCGGGGCNNTIITNAHSKKS 443          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000014330.1 (SMESG000014330.1)

HSP 1 Score: 214.927 bits (546), Expect = 1.608e-64
Identity = 139/379 (36.68%), Postives = 208/379 (54.88%), Query Frame = 1
Query:  184 HRWITPVLLFTGLIGNSVSFIIWTNPRIRRNNXXXXXXXXXXXXXXXXXXTHFMHYLKFAWRIKVFDYAGVCEMFQMIYLMFQYNSTPLVLAFTLERWIAVCYPFKRERWCTSKRAYLAITLIFIIMLLIGVVQAFAWSTNNEQRVCKFRDSWQRSMLNQGFTTTVEFLMSGGVPICTLIFNILVIYELRSIVLNPLKQDPNKVNKKNRENKSQLSVSEKISFSSKNEKGLESFDVNAENSNLLSQPVGKSVIKRYTFVNNAHKMQRFQSSGGVNFRSTTIMLLTVSFYQIITTLPSGAVYVSQFFISGGNEFLSDNEIENDPNWRTFFRHQTMKEFVDLFSLTHYCFNVLIYLLTGRQFRKYLLQILKLDKCIYGADS 1320
            HR+ + + L +GL+ N+++FIIWT PR+RR+N+SA YL+ +++SD I  L + +HY++ +W I V D    CEMFQ +++  QY S PLVL F+LER+IAVC+PFKRE+ CT ++A +   +  +  L++G  Q+ +   N+  + C  R S   +     F T  E L+S  +P  TLI NILVI EL+SI        P+          S  S SE+     +N+   E  ++   +   +SQ                      Q+     F+S+TI+LL+VSF  I+TTLP+G VY  QF    GNE LS  +++ DP+W  F  +Q +KE VD FS+ H+  N +IY +TG  FR     + +  K   G D 
Sbjct:   32 HRYGSLLWLMSGLVLNTLAFIIWTRPRLRRSNTSANYLAGIAMSDTIFWLLYILHYMQTSWDICVQDIPVWCEMFQGLFISSQYFSVPLVLIFSLERYIAVCHPFKREKLCTHRKALVNTIVCGVTALILGCSQSISREYNDVSKKCDIRGSVVNTRNWFIFATGTEILISALLPFATLIVNILVIIELKSITSKTTLIKPSVTAPLT----SSTSTSEQHLQIQRNQGSTEKLNIKKHS---ISQ----------------------QNKEKSAFKSSTILLLSVSFLLIVTTLPTGFVYALQFVCPVGNETLSVEQMKVDPDWIKFINYQILKEVVDFFSMIHFSINFVIYYITGESFRTEFYLLFQNAKRFKGPDD 381          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000018637.1 (SMESG000018637.1)

HSP 1 Score: 215.312 bits (547), Expect = 2.268e-64
Identity = 133/402 (33.08%), Postives = 212/402 (52.74%), Query Frame = 1
Query:   88 NKSFQSMNTTVFIRYPTNIEFRLKFLVLASLCHRWITPVLLFTGLIGNSVSFIIWTNPRIRRNNXXXXXXXXXXXXXXXXXXTHFMHYLKFAWRIKVFDYAGVCEMFQMIYLMFQYNSTPLVLAFTLERWIAVCYPFKRERWCTSKRAYLAITLIFIIMLLIGVVQAFAWSTNNEQRVCKFRDSWQRSMLNQGFTTTVEFLMSGGVPICTLIFNILVIYELRSIVLNPLKQDPNKVNKKNRENKSQLSVSEKISFSSKNEKGLESFDVNAENSNLLSQPVGKSVIKRYTFVNNAHKMQRFQSSGGVNFRSTTIMLLTVSFYQIITTLPSGAVYVSQFFISGGNEFLSDNEIENDPNWRTFFRHQTMKEFVDLFSLTHYCFNVLIYLLTGRQFRKYLLQILKL 1293
            N+ +Q   T+      T +E R  FL ++     +  P+ L  G++GN +SF++W + ++RRNNSSA Y++ L+++D  +++   ++YL+ +W   + D  G+C+ + +I+   QYNS  LV  FT+ERWIAVCYPF+RER CT  RA++A  +IF  + +      F W   + Q +C     W  +     ++ T+E L S  +P+ TL  NI V+ E+  I                         SE I    K     ++F++ ++ S   S+                       +   ++F+STTI LL VSF+QI+TTLP GAVY+ Q F   GN   S  +++NDP W+  F+    K+ +DL SL+HYCFN++IYL +   FR +L+  +KL
Sbjct:   41 NQYYQMNETSATSNEKTLLEIRQIFLPISYQLQLYSIPIFLTVGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVICSIIYYLRHSWGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLFFVW---HYQPLCSVPKHWIENTYFVTYSLTLEILFSALLPVITLAVNIRVVVEMYRI-------------------------SETIVTFPKLSAVNQNFEIPSQKSRKHSK----------------------NTENSISFKSTTITLLLVSFFQILTTLPLGAVYICQIFYPEGNA-TSVKQMQNDPIWKKHFQMHGAKDIIDLLSLSHYCFNIVIYLASSHLFRNHLMGFVKL 391          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000018637.1 (SMESG000018637.1)

HSP 1 Score: 213.386 bits (542), Expect = 3.236e-64
Identity = 130/386 (33.68%), Postives = 206/386 (53.37%), Query Frame = 1
Query:  136 TNIEFRLKFLVLASLCHRWITPVLLFTGLIGNSVSFIIWTNPRIRRNNXXXXXXXXXXXXXXXXXXTHFMHYLKFAWRIKVFDYAGVCEMFQMIYLMFQYNSTPLVLAFTLERWIAVCYPFKRERWCTSKRAYLAITLIFIIMLLIGVVQAFAWSTNNEQRVCKFRDSWQRSMLNQGFTTTVEFLMSGGVPICTLIFNILVIYELRSIVLNPLKQDPNKVNKKNRENKSQLSVSEKISFSSKNEKGLESFDVNAENSNLLSQPVGKSVIKRYTFVNNAHKMQRFQSSGGVNFRSTTIMLLTVSFYQIITTLPSGAVYVSQFFISGGNEFLSDNEIENDPNWRTFFRHQTMKEFVDLFSLTHYCFNVLIYLLTGRQFRKYLLQILKL 1293
            T +E R  FL ++     +  P+ L  G++GN +SF++W + ++RRNNSSA Y++ L+++D  +++   ++YL+ +W   + D  G+C+ + +I+   QYNS  LV  FT+ERWIAVCYPF+RER CT  RA++A  +IF  + +      F W   + Q +C     W  +     ++ T+E L S  +P+ TL  NI V+ E+  I                         SE I    K     ++F++ ++ S   S+                       +   ++F+STTI LL VSF+QI+TTLP GAVY+ Q F   GN   S  +++NDP W+  F+    K+ +DL SL+HYCFN++IYL +   FR +L+  +KL
Sbjct:   12 TLLEIRQIFLPISYQLQLYSIPIFLTVGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVICSIIYYLRHSWGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLFFVW---HYQPLCSVPKHWIENTYFVTYSLTLEILFSALLPVITLAVNIRVVVEMYRI-------------------------SETIVTFPKLSAVNQNFEIPSQKSRKHSK----------------------NTENSISFKSTTITLLLVSFFQILTTLPLGAVYICQIFYPEGNA-TSVKQMQNDPIWKKHFQMHGAKDIIDLLSLSHYCFNIVIYLASSHLFRNHLMGFVKL 346          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000031888.1 (SMESG000031888.1)

HSP 1 Score: 161.77 bits (408), Expect = 1.134e-44
Identity = 125/379 (32.98%), Postives = 184/379 (48.55%), Query Frame = 1
Query:  136 TNIEFRLKFLVLASLCHRWITPVLLFTGLIGNSVSFIIWTNPRIRRNNXXXXXXXXXXXXXXXXXXTHFMHYLKFAWRIKVFDYAGVCEMFQMIYLMFQYNSTPLVLAFTLERWIAVCYPFKRERWCTSKRAYLAITLIFIIMLLIGVVQAFAWSTNNEQRVCKFRD-SWQRSMLNQGFTTTVEFLMSGGVPICTLIFNILVIYELRSIVLNPLKQDPNKVNKKNRENKSQLSVSEKISFSSKNEKGLESFDVNAENSNLLSQPVGKSVIKRYTFVNNAHKMQRFQSSGGVNFRSTTIMLLTVSFYQIITTLPSGAVYVSQFFISGGNEFLSDNEIENDPNWRTFFRHQTMKEFVDLFSLTHYCFNVLIYLLTGRQFRK 1269
            ++IE  L F        R++T + L  G IGN  SFIIW  P++RR NSSA YL+ALSL+D ++L+   +  L+++W   V  Y+  C ++ ++    Q  S  LVLAFT+ERW+A+CYPFKR+  CT KRA +    +++ +L   +   F W  N     C F       +   + +    E + SG VP+  L FNILVI E+             ++ K NR      S+     F   N                                      QRF +     F  TTIMLL VSFY   TTLP G ++  Q  I+  +E ++ ++I +DP W+ +FR   +K  +D   ++HY  N +IYL+TG+ FRK
Sbjct:   10 SSIELNLMFSPNRIYIDRYMTLIWLLIGYIGNIFSFIIWIEPKMRRENSSAIYLAALSLNDFLVLVFVMIQDLQYSWNKNVLRYS-FCSIYMVLSTCSQLFSPVLVLAFTIERWVAICYPFKRQSLCTPKRAIIVSFTLYLFVLCYNIYNGFMWIYNERFDSCVFNQLETNGTDFQKQYIFATEIVFSGCVPLLILGFNILVIKEMY------------RITKCNRTK----SMGNCPQFHDPN--------------------------------------QRFNNERS--FLFTTIMLLAVSFYLFFTTLPGGIMFALQQVITMPDENMNLSKIPSDPKWQFYFRVSIIKAVIDELCISHYALNFVIYLVTGKAFRK 331          
The following BLAST results are available for this feature:
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
frpr-182.987e-727.74FLP-2 receptor; FMRFamide Peptide Receptor family ... [more]
frpr-183.677e-727.74FLP-2 receptor; FMRFamide Peptide Receptor family ... [more]
frpr-185.257e-727.74FLP-2 receptor; FMRFamide Peptide Receptor family ... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CNMaR2.306e-827.27gene:FBgn0053696 transcript:FBtr0091684[more]
Proc-R1.261e-627.16gene:FBgn0029723 transcript:FBtr0100552[more]
Proc-R1.261e-627.16gene:FBgn0029723 transcript:FBtr0070713[more]
Proc-R1.261e-627.16gene:FBgn0029723 transcript:FBtr0100551[more]
Proc-R1.261e-627.16gene:FBgn0029723 transcript:FBtr0070714[more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
trhra4.064e-629.01thyrotropin-releasing hormone receptor a [Source:Z... [more]
trhra5.320e-629.30thyrotropin-releasing hormone receptor a [Source:Z... [more]
trhra5.887e-629.30thyrotropin-releasing hormone receptor a [Source:Z... [more]
trhra6.259e-629.30thyrotropin-releasing hormone receptor a [Source:Z... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KUK65.782e-6136.68GCR079 OS=Schmidtea mediterranea OX=79327 GN=gcr07... [more]
A0A3P7L2X22.278e-5434.34G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A0R3SRL81.232e-5334.59G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A0R3UN111.625e-5332.99G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
H2KNM76.520e-5236.78Growth hormone secretagogue receptor OS=Clonorchis... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
TRHR3.071e-626.67thyrotropin-releasing hormone receptor [Source:NCB... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000007702.10.000e+099.77SMESG000007702.1[more]
SMESG000014330.11.608e-6436.68SMESG000014330.1[more]
SMESG000018637.12.268e-6433.08SMESG000018637.1[more]
SMESG000018637.13.236e-6433.68SMESG000018637.1[more]
SMESG000031888.11.134e-4432.98SMESG000031888.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011094 ID=SMED30011094|Name=G_PROTEIN_RECEP_F1_2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1457bp
TTATCAGTAAATAATTTCAATTGACAATTATTTGTAAAATTTGAAAGTAT
TCGTCGGTTAATTATCAAATTCAAACGAGAGACTTCAAATAAATCATTCC
AATCAATGAACACAACTGTTTTTATCCGATATCCAACAAATATTGAATTC
CGACTAAAGTTCCTAGTTTTGGCATCTCTCTGCCATCGTTGGATAACTCC
AGTATTGCTATTCACTGGACTGATTGGGAATTCTGTATCATTTATCATTT
GGACTAATCCCAGAATCAGACGGAATAACTCTTCAGCGACGTATTTGTCT
GCGTTGTCTCTCAGTGATCTCATTTTATTGTTGACCCATTTTATGCATTA
CTTGAAATTCGCTTGGAGAATTAAAGTCTTCGATTACGCAGGAGTTTGTG
AAATGTTTCAAATGATTTATCTCATGTTTCAATATAATTCAACGCCTCTT
GTTTTAGCTTTTACTCTAGAAAGATGGATAGCTGTTTGTTATCCTTTTAA
AAGAGAACGTTGGTGTACATCTAAACGAGCATATTTAGCCATTACTTTAA
TTTTCATTATCATGCTCTTAATTGGTGTGGTTCAAGCATTTGCATGGTCG
ACAAACAACGAACAAAGGGTTTGTAAATTTAGAGATAGCTGGCAGAGAAG
TATGCTAAATCAAGGCTTTACTACGACAGTTGAATTTCTAATGTCCGGAG
GTGTTCCGATCTGTACATTAATTTTTAATATTCTCGTCATCTATGAATTG
AGGTCAATTGTGCTAAATCCCCTAAAACAAGACCCAAATAAAGTGAATAA
AAAGAATCGAGAAAATAAATCTCAATTGTCTGTTAGTGAAAAGATTTCGT
TTTCTAGTAAAAACGAAAAAGGATTAGAATCTTTTGACGTGAACGCGGAA
AATTCCAACCTTTTAAGTCAACCCGTCGGTAAATCAGTTATTAAACGCTA
TACGTTTGTCAACAATGCTCATAAAATGCAAAGATTCCAAAGTTCGGGCG
GGGTCAATTTTCGTTCCACCACAATCATGTTACTTACAGTTTCATTCTAT
CAGATTATAACAACTCTTCCATCTGGAGCTGTTTACGTGTCTCAGTTTTT
CATTTCCGGCGGAAATGAATTTTTGTCGGACAACGAAATTGAAAACGATC
CGAATTGGAGGACATTTTTCCGGCATCAAACAATGAAAGAATTCGTCGAT
TTATTTTCATTGACTCATTATTGTTTTAATGTTTTGATTTATTTACTAAC
TGGGAGACAATTTCGGAAATACCTTCTGCAAATTTTGAAACTGGATAAAT
GTATTTATGGAGCCGACTCTAACAAGACTGTGTCCAATGTTCGATCAAGT
ATTTATGGTGGAGGCGCAGGGGGAGGATGTGGAGGGGGAGGATGTAATAA
CACGATTATTACGAATGCGCATAGTAAAAAGAGTTAATATTATTAATATG
AGCTGAC
back to top

protein sequence of SMED30011094-orf-1

>SMED30011094-orf-1 ID=SMED30011094-orf-1|Name=SMED30011094-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=107bp
MRSLRDNADKYVAEELFRLILGLVQMINDTEFPISPVNSNTGVIQRWQRD
AKTRNFSRNSIFVGYRIKTVVFIDWNDLFEVSRLNLIINRRILSNFTNNC
QLKLFTD
back to top

protein sequence of SMED30011094-orf-2

>SMED30011094-orf-2 ID=SMED30011094-orf-2|Name=SMED30011094-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=444bp
MNTTVFIRYPTNIEFRLKFLVLASLCHRWITPVLLFTGLIGNSVSFIIWT
NPRIRRNNSSATYLSALSLSDLILLLTHFMHYLKFAWRIKVFDYAGVCEM
FQMIYLMFQYNSTPLVLAFTLERWIAVCYPFKRERWCTSKRAYLAITLIF
IIMLLIGVVQAFAWSTNNEQRVCKFRDSWQRSMLNQGFTTTVEFLMSGGV
PICTLIFNILVIYELRSIVLNPLKQDPNKVNKKNRENKSQLSVSEKISFS
SKNEKGLESFDVNAENSNLLSQPVGKSVIKRYTFVNNAHKMQRFQSSGGV
NFRSTTIMLLTVSFYQIITTLPSGAVYVSQFFISGGNEFLSDNEIENDPN
WRTFFRHQTMKEFVDLFSLTHYCFNVLIYLLTGRQFRKYLLQILKLDKCI
YGADSNKTVSNVRSSIYGGGAGGGCGGGGCNNTIITNAHSKKS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 113..135
score: 19.73
coord: 68..89
score: 23.02
coord: 369..395
score: 23.05
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 52..340
e-value: 3.5E-18
score: 65.9
NoneNo IPR availablePANTHERPTHR24243G-PROTEIN COUPLED RECEPTORcoord: 38..408
NoneNo IPR availableCDDcd149787tmA_FMRFamide_R-likecoord: 35..396
e-value: 6.04755E-18
score: 81.9104
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 7..421
NoneNo IPR availableTMHMMTMhelixcoord: 69..91
NoneNo IPR availableTMHMMTMhelixcoord: 111..129
NoneNo IPR availableTMHMMTMhelixcoord: 198..220
NoneNo IPR availableTMHMMTMhelixcoord: 319..341
NoneNo IPR availableTMHMMTMhelixcoord: 150..172
NoneNo IPR availableTMHMMTMhelixcoord: 35..57
NoneNo IPR availableTMHMMTMhelixcoord: 371..390
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 49..387
score: 18.967