Ski oncogene

Overview
NameSki oncogene
Smed IDSMED30011091
Length (bp)1662
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ski oncogene (SMED30011091) t-SNE clustered cells

Violin plots show distribution of expression levels for Ski oncogene (SMED30011091) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ski oncogene (SMED30011091) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ski oncogene (SMED30011091) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011091

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30011091SMESG000044463.1 SmedASXL_006842SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30011091SMESG000044463.1 dd_Smed_v4_10394_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30011091SMESG000044463.1 dd_Smed_v4_10394_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30011091SMESG000044463.1 dd_Smed_v4_10394_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
posterior region of the whole animalSMED30011091SMESG000044463.1 dd_Smed_v4_10394_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30011091SMESG000044463.1 dd_Smed_v6_10394_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30011091SMESG000044463.1 SMED30011091smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ski oncogene vs. Ensembl Human
Match: SKI (SKI proto-oncogene [Source:HGNC Symbol;Acc:HGNC:10896])

HSP 1 Score: 146.362 bits (368), Expect = 1.294e-36
Identity = 77/214 (35.98%), Postives = 125/214 (58.41%), Query Frame = 2
Query:  281 TILQNSQVACFDSGGEKLLCLPQVL-ELFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERL-SKIFRSPEYKSS--ENLVKTFYIPLKYRHQ-IRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRLAEDPSRTTEEERSLNDYLTEIKNRF 907
            T+L+   ++CF  GGEK LCLPQ+L  +  D    +I A  ++L I    C   +LEIL+   ++   +  CGLI++++AERL + +     Y     + L  +  + L+   + +RV H+CFG+ KG+L+P+L ++  A CI+C DC + + P +FV H+H +     E  TCHWGF S+NWR Y+ L++D +   EE+  L   L ++K +F
Sbjct:  103 TVLEGETISCFVVGGEKRLCLPQILNSVLRDFSLQQINAVCDELHIYCSRCTADQLEILKVMGILPFSAPSCGLITKTDAERLCNALLYGGAYPPPCKKELAASLALGLELSERSVRVYHECFGKCKGLLVPELYSSPSAACIQCLDCRLMYPPHKFVVHSHKA----LENRTCHWGFDSANWRAYILLSQDYT-GKEEQARLGRCLDDVKEKF 311          
BLAST of Ski oncogene vs. Ensembl Human
Match: SKIL (SKI like proto-oncogene [Source:HGNC Symbol;Acc:HGNC:10897])

HSP 1 Score: 124.02 bits (310), Expect = 3.180e-29
Identity = 72/215 (33.49%), Postives = 107/215 (49.77%), Query Frame = 2
Query:  281 TILQNSQVACFDSGGEKLLCLPQVL-ELFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERLSKIFRSPEYKSSENLV---KTFYIPLK-YRHQIRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRLAEDPSRTTEEERSLNDYLTEIKNRFT 910
            T+L+   ++CF  GGEK LCLPQVL  +  +    +I    ++L I    C   +L IL+   ++   +  CGLI+ ++A+RL      P        V   K+    LK       V H+C G+ +G+  PQ     DA CI+C +C   F+P  FV H+H S     +  TCHWGF S+ W  YL + +     T EE+ L   L E+K +F+
Sbjct:  147 TVLEGESISCFQVGGEKRLCLPQVLNSVLREFTLQQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLGKCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRS----PDKRTCHWGFESAKWHCYLHVNQK-YLGTPEEKKLKIILEEMKEKFS 356          
BLAST of Ski oncogene vs. Ensembl Human
Match: SKIL (SKI like proto-oncogene [Source:HGNC Symbol;Acc:HGNC:10897])

HSP 1 Score: 124.02 bits (310), Expect = 3.417e-29
Identity = 72/215 (33.49%), Postives = 107/215 (49.77%), Query Frame = 2
Query:  281 TILQNSQVACFDSGGEKLLCLPQVL-ELFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERLSKIFRSPEYKSSENLV---KTFYIPLK-YRHQIRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRLAEDPSRTTEEERSLNDYLTEIKNRFT 910
            T+L+   ++CF  GGEK LCLPQVL  +  +    +I    ++L I    C   +L IL+   ++   +  CGLI+ ++A+RL      P        V   K+    LK       V H+C G+ +G+  PQ     DA CI+C +C   F+P  FV H+H S     +  TCHWGF S+ W  YL + +     T EE+ L   L E+K +F+
Sbjct:  127 TVLEGESISCFQVGGEKRLCLPQVLNSVLREFTLQQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLGKCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRS----PDKRTCHWGFESAKWHCYLHVNQK-YLGTPEEKKLKIILEEMKEKFS 336          
BLAST of Ski oncogene vs. Ensembl Human
Match: SKIL (SKI like proto-oncogene [Source:HGNC Symbol;Acc:HGNC:10897])

HSP 1 Score: 124.02 bits (310), Expect = 3.516e-29
Identity = 72/215 (33.49%), Postives = 107/215 (49.77%), Query Frame = 2
Query:  281 TILQNSQVACFDSGGEKLLCLPQVL-ELFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERLSKIFRSPEYKSSENLV---KTFYIPLK-YRHQIRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRLAEDPSRTTEEERSLNDYLTEIKNRFT 910
            T+L+   ++CF  GGEK LCLPQVL  +  +    +I    ++L I    C   +L IL+   ++   +  CGLI+ ++A+RL      P        V   K+    LK       V H+C G+ +G+  PQ     DA CI+C +C   F+P  FV H+H S     +  TCHWGF S+ W  YL + +     T EE+ L   L E+K +F+
Sbjct:  147 TVLEGESISCFQVGGEKRLCLPQVLNSVLREFTLQQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLGKCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRS----PDKRTCHWGFESAKWHCYLHVNQK-YLGTPEEKKLKIILEEMKEKFS 356          
BLAST of Ski oncogene vs. Ensembl Human
Match: SKIL (SKI like proto-oncogene [Source:HGNC Symbol;Acc:HGNC:10897])

HSP 1 Score: 124.02 bits (310), Expect = 3.516e-29
Identity = 72/215 (33.49%), Postives = 107/215 (49.77%), Query Frame = 2
Query:  281 TILQNSQVACFDSGGEKLLCLPQVL-ELFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERLSKIFRSPEYKSSENLV---KTFYIPLK-YRHQIRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRLAEDPSRTTEEERSLNDYLTEIKNRFT 910
            T+L+   ++CF  GGEK LCLPQVL  +  +    +I    ++L I    C   +L IL+   ++   +  CGLI+ ++A+RL      P        V   K+    LK       V H+C G+ +G+  PQ     DA CI+C +C   F+P  FV H+H S     +  TCHWGF S+ W  YL + +     T EE+ L   L E+K +F+
Sbjct:  147 TVLEGESISCFQVGGEKRLCLPQVLNSVLREFTLQQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLGKCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRS----PDKRTCHWGFESAKWHCYLHVNQK-YLGTPEEKKLKIILEEMKEKFS 356          
BLAST of Ski oncogene vs. Ensembl Celegans
Match: dac-1 (DAChsund transcription factor homolog [Source:UniProtKB/TrEMBL;Acc:Q86GT3])

HSP 1 Score: 48.9062 bits (115), Expect = 6.778e-6
Identity = 26/78 (33.33%), Postives = 43/78 (55.13%), Query Frame = 2
Query:  302 VACFDSGGEKLLCLPQVLELFAD---VGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERL 526
            VA FD  G++++CLPQV E+F      G + +   +++L I  + CN+ ++  LR    I     RC L+  S+ E+L
Sbjct:   94 VAAFDINGKEMICLPQVYEVFLKNMVGGLHTVYTKLKRLYIHPMVCNVEQVRALRSLGAIQPGVNRCKLLKTSDFEKL 171          
BLAST of Ski oncogene vs. Ensembl Fly
Match: Snoo (gene:FBgn0085450 transcript:FBtr0343409)

HSP 1 Score: 120.939 bits (302), Expect = 2.383e-28
Identity = 68/192 (35.42%), Postives = 96/192 (50.00%), Query Frame = 2
Query:  281 TILQNSQVACFDSGGEKLLCLPQVLE-LFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERLSKIFRSPEYKSSENLVKTFYIPL----KYRHQIRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRLAED 841
            T L+   + CF  GGE  LCLPQ L  +  D    +I    ++LGI   +C   +L   +   ++ S     GLI++++AERL        ++S  N     Y+P+    K      V H CFG+ +GI  P + +     CI+C +C  WFSP +FVGH H     + E  TCHWGF S NW  YL +A D
Sbjct:  119 TKLEGKTIGCFSVGGEMRLCLPQFLNNVLNDFSLEQINRIFDELGIYCSQCTHDQLVEFKAAKILPSDVKASGLITRTDAERLCAALL---HRSDRN----SYVPIESLAKGALSFHVYHKCFGKCEGICTPDMYSYQKPTCIKCLECDGWFSPQKFVGHVHR----KFENHTCHWGFDSRNWHDYLHVALD 299          
BLAST of Ski oncogene vs. Ensembl Fly
Match: Snoo (gene:FBgn0085450 transcript:FBtr0112717)

HSP 1 Score: 120.939 bits (302), Expect = 2.383e-28
Identity = 68/192 (35.42%), Postives = 96/192 (50.00%), Query Frame = 2
Query:  281 TILQNSQVACFDSGGEKLLCLPQVLE-LFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERLSKIFRSPEYKSSENLVKTFYIPL----KYRHQIRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRLAED 841
            T L+   + CF  GGE  LCLPQ L  +  D    +I    ++LGI   +C   +L   +   ++ S     GLI++++AERL        ++S  N     Y+P+    K      V H CFG+ +GI  P + +     CI+C +C  WFSP +FVGH H     + E  TCHWGF S NW  YL +A D
Sbjct:  119 TKLEGKTIGCFSVGGEMRLCLPQFLNNVLNDFSLEQINRIFDELGIYCSQCTHDQLVEFKAAKILPSDVKASGLITRTDAERLCAALL---HRSDRN----SYVPIESLAKGALSFHVYHKCFGKCEGICTPDMYSYQKPTCIKCLECDGWFSPQKFVGHVHR----KFENHTCHWGFDSRNWHDYLHVALD 299          
BLAST of Ski oncogene vs. Ensembl Fly
Match: Snoo (gene:FBgn0085450 transcript:FBtr0112719)

HSP 1 Score: 120.939 bits (302), Expect = 2.383e-28
Identity = 68/192 (35.42%), Postives = 96/192 (50.00%), Query Frame = 2
Query:  281 TILQNSQVACFDSGGEKLLCLPQVLE-LFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERLSKIFRSPEYKSSENLVKTFYIPL----KYRHQIRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRLAED 841
            T L+   + CF  GGE  LCLPQ L  +  D    +I    ++LGI   +C   +L   +   ++ S     GLI++++AERL        ++S  N     Y+P+    K      V H CFG+ +GI  P + +     CI+C +C  WFSP +FVGH H     + E  TCHWGF S NW  YL +A D
Sbjct:  119 TKLEGKTIGCFSVGGEMRLCLPQFLNNVLNDFSLEQINRIFDELGIYCSQCTHDQLVEFKAAKILPSDVKASGLITRTDAERLCAALL---HRSDRN----SYVPIESLAKGALSFHVYHKCFGKCEGICTPDMYSYQKPTCIKCLECDGWFSPQKFVGHVHR----KFENHTCHWGFDSRNWHDYLHVALD 299          
BLAST of Ski oncogene vs. Ensembl Fly
Match: Snoo (gene:FBgn0085450 transcript:FBtr0112718)

HSP 1 Score: 120.939 bits (302), Expect = 2.383e-28
Identity = 68/192 (35.42%), Postives = 96/192 (50.00%), Query Frame = 2
Query:  281 TILQNSQVACFDSGGEKLLCLPQVLE-LFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERLSKIFRSPEYKSSENLVKTFYIPL----KYRHQIRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRLAED 841
            T L+   + CF  GGE  LCLPQ L  +  D    +I    ++LGI   +C   +L   +   ++ S     GLI++++AERL        ++S  N     Y+P+    K      V H CFG+ +GI  P + +     CI+C +C  WFSP +FVGH H     + E  TCHWGF S NW  YL +A D
Sbjct:  119 TKLEGKTIGCFSVGGEMRLCLPQFLNNVLNDFSLEQINRIFDELGIYCSQCTHDQLVEFKAAKILPSDVKASGLITRTDAERLCAALL---HRSDRN----SYVPIESLAKGALSFHVYHKCFGKCEGICTPDMYSYQKPTCIKCLECDGWFSPQKFVGHVHR----KFENHTCHWGFDSRNWHDYLHVALD 299          
BLAST of Ski oncogene vs. Ensembl Fly
Match: fuss (gene:FBgn0039932 transcript:FBtr0301336)

HSP 1 Score: 81.6481 bits (200), Expect = 7.659e-16
Identity = 50/163 (30.67%), Postives = 78/163 (47.85%), Query Frame = 2
Query:  266 ETFGYTILQNSQVACFDSGGEKLLCLPQVLE-LFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERLSKIFRSPEYKSSENLVKTFYIPLKYRHQIRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTH 751
            E     +L   Q+      G++ LCL Q+   L     +N+I      LGI  ++C   +LEILR+   +   S RCG+I++  AERL K F      +   L   F           V H C    +G  +P    ++ A+CI+C  CG++FSP++F+ H+H
Sbjct:   24 EKVSSVLLYGVQIVSLHIEGQERLCLAQISNTLLKQFSYNEIHNRRVALGITCVQCTPVQLEILRRAGAMPVSSRRCGMITRREAERLCKSFLGDN--TPPRLPDDF--------AFNVQHKCAWGCRGSFLPSRYNSSRAKCIKCSYCGMFFSPNKFIFHSH 176          
BLAST of Ski oncogene vs. Ensembl Zebrafish
Match: skib (v-ski avian sarcoma viral oncogene homolog b [Source:ZFIN;Acc:ZDB-GENE-990715-10])

HSP 1 Score: 142.51 bits (358), Expect = 1.404e-35
Identity = 79/212 (37.26%), Postives = 119/212 (56.13%), Query Frame = 2
Query:  281 TILQNSQVACFDSGGEKLLCLPQVL-ELFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERL-SKIFRSPEYKSSENLVKTFYIPL-KYRHQIRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRLAEDPSRTTEEERSLNDYLTEIKNRF 907
            T+L+   ++CF  GGEK LCLPQ+L  +  D    +I +  + L I    C   +LEIL+   ++   +  CGLI+Q++AERL + +     +    +   +  I L +     +V H+CFG+ KG+ +P+L T+ +A CI+C DC + F   +FV H+H       E  TCHWGF SSNWR Y+ L +D S   EE  +L   LTE+K +F
Sbjct:   82 TVLERETISCFVVGGEKRLCLPQILNSVLRDFSLQQINSVCDDLHIYCSRCTADQLEILKVMGILPFSAPSCGLITQTDAERLCNALIYGGTFPPHADKELSCSIELERTEKSFKVYHECFGKCKGLFVPELYTSPNAACIQCLDCRLMFPTHKFVVHSHK----RLENRTCHWGFDSSNWRAYILLDQDYSE-KEENSTLQQLLTELKGKF 288          
BLAST of Ski oncogene vs. Ensembl Zebrafish
Match: skia (v-ski avian sarcoma viral oncogene homolog a [Source:ZFIN;Acc:ZDB-GENE-990715-9])

HSP 1 Score: 140.969 bits (354), Expect = 6.612e-35
Identity = 84/249 (33.73%), Postives = 135/249 (54.22%), Query Frame = 2
Query:  281 TILQNSQVACFDSGGEKLLCLPQVLE-LFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERL-SKIFRSPEYK--SSENLVKTFYIPLKYRHQIRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRLAEDPSRTTEEERS-LNDYLTEIKNRF-------------TQPIYDSLTIYNDHDQQTPSDN 973
            T+L+   ++CF  GGEK LCLPQ+L  +  D    +I +  + L I    C   +LEIL+   ++   +  CGLI++++AERL + +     Y   S + L  +  + L  +   ++ H+CFG+ KG+L+P+L T+ +A CI+C DC + +   +FV H+H S     E  TCHWGF S+NWR Y+ L+  P  T +EE++ L   L +IK +F             + PI      ++D   Q+PS +
Sbjct:   86 TVLEGETISCFVVGGEKRLCLPQILNTVLRDFSLQQINSVCDDLHIYCSRCTADQLEILKVMGILPFAAPSCGLITKTDAERLCNALIYGGTYPPHSKKELYGSIELELTEK-SFKIYHECFGKCKGLLVPELYTSPNAPCIQCMDCRLMYPTHKFVVHSHKS----LENRTCHWGFDSANWRAYVLLS--PDYTGKEEKARLEQLLDDIKEKFDFSNKYKRKASQASDPIPAKKPKHDDFPAQSPSGD 327          
BLAST of Ski oncogene vs. Ensembl Zebrafish
Match: skila (SKI-like proto-oncogene a [Source:ZFIN;Acc:ZDB-GENE-070912-548])

HSP 1 Score: 129.028 bits (323), Expect = 5.252e-32
Identity = 76/250 (30.40%), Postives = 122/250 (48.80%), Query Frame = 2
Query:  278 YTILQNSQVACFDSGGEKLLCLPQVL-ELFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERLSKIFRSPEYKSS---------ENLVKTFYIPLKYRHQIRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRLAEDPSRTTEEERSLNDYLTEIKNRF----TQPIYDSLTIYNDHDQQTPSDNCSFN 985
            +++L+   ++CF  GGEK LCLPQVL  +  D    +I A  ++L +    C+  +L IL+   ++   +  CGLI+ ++A+RL      P    S         + L+K      +     +V H C G+ +G+ +P      DA CI+C +C + FSP  FV H+H S     +  TCHWGF S+ W  YL+L       T+EE  L   L E+K +F     +P+   +   + H +++    C  N
Sbjct:  156 HSLLEGESISCFVVGGEKRLCLPQVLNSVLRDFSLQQINAVCDELYVYCSRCDAEQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPGANISADPNSKLPGQGLLK------ESDASFQVEHQCLGKCQGLFVPHFYVQPDAPCIQCMECQLLFSPQNFVMHSHKS----PDKRTCHWGFDSAKWPCYLQLGRK-HEGTQEEPQLKQLLDEMKEKFHYQLKRPLDKKVVDDDGHGRKSSPAPCPPN 394          
BLAST of Ski oncogene vs. Ensembl Zebrafish
Match: skila (SKI-like proto-oncogene a [Source:ZFIN;Acc:ZDB-GENE-070912-548])

HSP 1 Score: 127.487 bits (319), Expect = 1.876e-31
Identity = 73/225 (32.44%), Postives = 112/225 (49.78%), Query Frame = 2
Query:  263 SETFGYTILQNSQVACFDSGGEKLLCLPQVL-ELFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERLSKIFRSPEYKSS---------ENLVKTFYIPLKYRHQIRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRLAEDPSRTTEEERSLNDYLTEIKNRF 907
            S    +++L+   ++CF  GGEK LCLPQVL  +  D    +I A  ++L +    C+  +L IL+   ++   +  CGLI+ ++A+RL      P    S         + L+K      +     +V H C G+ +G+ +P      DA CI+C +C + FSP  FV H+H S     +  TCHWGF S+ W  YL+L       T+EE  L   L E+K +F
Sbjct:  130 STELTHSLLEGESISCFVVGGEKRLCLPQVLNSVLRDFSLQQINAVCDELYVYCSRCDAEQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPGANISADPNSKLPGQGLLK------ESDASFQVEHQCLGKCQGLFVPHFYVQPDAPCIQCMECQLLFSPQNFVMHSHKS----PDKRTCHWGFDSAKWPCYLQLGRK-HEGTQEEPQLKQLLDEMKEKF 343          
BLAST of Ski oncogene vs. Ensembl Zebrafish
Match: skila (SKI-like proto-oncogene a [Source:ZFIN;Acc:ZDB-GENE-070912-548])

HSP 1 Score: 128.257 bits (321), Expect = 7.322e-31
Identity = 73/225 (32.44%), Postives = 112/225 (49.78%), Query Frame = 2
Query:  263 SETFGYTILQNSQVACFDSGGEKLLCLPQVL-ELFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERLSKIFRSPEYKSS---------ENLVKTFYIPLKYRHQIRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRLAEDPSRTTEEERSLNDYLTEIKNRF 907
            S    +++L+   ++CF  GGEK LCLPQVL  +  D    +I A  ++L +    C+  +L IL+   ++   +  CGLI+ ++A+RL      P    S         + L+K      +     +V H C G+ +G+ +P      DA CI+C +C + FSP  FV H+H S     +  TCHWGF S+ W  YL+L       T+EE  L   L E+K +F
Sbjct:  105 STELTHSLLEGESISCFVVGGEKRLCLPQVLNSVLRDFSLQQINAVCDELYVYCSRCDAEQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPGANISADPNSKLPGQGLLK------ESDASFQVEHQCLGKCQGLFVPHFYVQPDAPCIQCMECQLLFSPQNFVMHSHKS----PDKRTCHWGFDSAKWPCYLQLGRK-HEGTQEEPQLKQLLDEMKEKF 318          
BLAST of Ski oncogene vs. Ensembl Xenopus
Match: SKI (SKI proto-oncogene [Source:NCBI gene;Acc:100486949])

HSP 1 Score: 144.05 bits (362), Expect = 8.153e-36
Identity = 78/217 (35.94%), Postives = 120/217 (55.30%), Query Frame = 2
Query:  281 TILQNSQVACFDSGGEKLLCLPQVL-ELFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERLSKIFRSPEYKSSENLVKTFYIPLKYRHQI-----RVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRLAED-PSRTTEEERS-LNDYLTEIKNRF 907
            TIL+   ++CF  GGEK LCLPQ+L  +  D    +I A  ++L +    C   +LEIL+   ++   +  CGLI++++AERL                K+ + P     ++     RV H+CFG+ +G+ +P+L  +  A CI+C DC + + P +FV H+H +     E  TCHWGF S+NWR Y+ LA D P    EEE++ L+  L E+K +F
Sbjct:   86 TILEGETISCFVVGGEKRLCLPQILNSVLRDFSLQQINAVCDELHVYCSRCTADQLEILKVMGILPFSAPSCGLITKTDAERLCNALLYGGSYPPRCAKKSDFPPGPLELELTESSFRVYHECFGKCRGLFVPELYGHPSAPCIQCLDCRLMYPPHKFVVHSHKA----LENRTCHWGFDSANWRAYILLARDNPGAGGEEEQARLSRLLEEMKEKF 298          
BLAST of Ski oncogene vs. Ensembl Xenopus
Match: ENSXETT00000042147.1 (SKI-like proto-oncogene [Source:NCBI gene;Acc:100492636])

HSP 1 Score: 120.553 bits (301), Expect = 3.623e-28
Identity = 72/214 (33.64%), Postives = 109/214 (50.93%), Query Frame = 2
Query:  281 TILQNSQVACFDSGGEKLLCLPQVL-ELFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERLSKIFRSPE-YKSSENLV--KTFYIPLK-YRHQIRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRLAEDPSRTTEEERSLNDYLTEIKNRF 907
            T L+   ++CF  GGEK LCLPQVL  +  D    +I    +++ I    C   +L IL+   ++   +  CGLI+ ++A+RL      P+ +  + +L+  K     LK       V HDC G+ +G+  P L +  DA CI+C +C   FS   FV H+H S     +  TCHWGF S+ W  Y+ L+      T E + +N  L E+K +F
Sbjct:  129 TELEGESISCFMVGGEKRLCLPQVLNSVLRDFSLQQINIVCDEMYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPQTFPQNGSLLPAKNSLAQLKETGSAFEVEHDCLGKCQGLFAPHLFSQPDAPCIQCLECYGMFSTQTFVMHSHRS----PDKRTCHWGFDSAKWHCYVHLSPK-YLDTPEGKKMNALLKEMKEKF 337          
BLAST of Ski oncogene vs. Ensembl Xenopus
Match: SKOR1 (SKI family transcriptional corepressor 1 [Source:NCBI gene;Acc:100491438])

HSP 1 Score: 87.8113 bits (216), Expect = 1.433e-17
Identity = 60/191 (31.41%), Postives = 93/191 (48.69%), Query Frame = 2
Query:  275 GYTILQNSQVACFDSGGEKLLCLPQVLE-LFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERLSKIF----RSPEYKSSENLVKTFYIPLKYRHQIRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRL 832
            G T L    +      G++ LCL Q+   L     +N+I      LGI  ++C   +LEILR+   +   S RCG+I++  AERL K F    R P  K  EN                V H+C    +G  +P    ++ A+CI+C  CG++FSP++F+ H+H +   +S+ +       +S WR +LRL
Sbjct:   38 GETCLYGVPIVSLVIDGQERLCLAQISNTLLKSYSYNEIHNRRVALGITCVQCTPVQLEILRRAGAMPISSRRCGMITKREAERLCKSFLGEHRPP--KLPENFA------------FDVAHECAWGCRGSFIPARYNSSRAKCIKCAYCGLYFSPNKFIFHSHRT--PDSKYTQPDAANFNS-WRRHLRL 211          
BLAST of Ski oncogene vs. Ensembl Xenopus
Match: SKOR1 (SKI family transcriptional corepressor 1 [Source:NCBI gene;Acc:100491438])

HSP 1 Score: 87.8113 bits (216), Expect = 1.562e-17
Identity = 60/191 (31.41%), Postives = 93/191 (48.69%), Query Frame = 2
Query:  275 GYTILQNSQVACFDSGGEKLLCLPQVLE-LFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERLSKIF----RSPEYKSSENLVKTFYIPLKYRHQIRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRL 832
            G T L    +      G++ LCL Q+   L     +N+I      LGI  ++C   +LEILR+   +   S RCG+I++  AERL K F    R P  K  EN                V H+C    +G  +P    ++ A+CI+C  CG++FSP++F+ H+H +   +S+ +       +S WR +LRL
Sbjct:   38 GETCLYGVPIVSLVIDGQERLCLAQISNTLLKSYSYNEIHNRRVALGITCVQCTPVQLEILRRAGAMPISSRRCGMITKREAERLCKSFLGEHRPP--KLPENFA------------FDVAHECAWGCRGSFIPARYNSSRAKCIKCAYCGLYFSPNKFIFHSHRT--PDSKYTQPDAANFNS-WRRHLRL 211          
BLAST of Ski oncogene vs. Ensembl Xenopus
Match: SKOR1 (SKI family transcriptional corepressor 1 [Source:NCBI gene;Acc:100491438])

HSP 1 Score: 87.8113 bits (216), Expect = 1.588e-17
Identity = 60/191 (31.41%), Postives = 93/191 (48.69%), Query Frame = 2
Query:  275 GYTILQNSQVACFDSGGEKLLCLPQVLE-LFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERLSKIF----RSPEYKSSENLVKTFYIPLKYRHQIRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRL 832
            G T L    +      G++ LCL Q+   L     +N+I      LGI  ++C   +LEILR+   +   S RCG+I++  AERL K F    R P  K  EN                V H+C    +G  +P    ++ A+CI+C  CG++FSP++F+ H+H +   +S+ +       +S WR +LRL
Sbjct:   38 GETCLYGVPIVSLVIDGQERLCLAQISNTLLKSYSYNEIHNRRVALGITCVQCTPVQLEILRRAGAMPISSRRCGMITKREAERLCKSFLGEHRPP--KLPENFA------------FDVAHECAWGCRGSFIPARYNSSRAKCIKCAYCGLYFSPNKFIFHSHRT--PDSKYTQPDAANFNS-WRRHLRL 211          
BLAST of Ski oncogene vs. Ensembl Mouse
Match: Ski (ski sarcoma viral oncogene homolog (avian) [Source:MGI Symbol;Acc:MGI:98310])

HSP 1 Score: 145.591 bits (366), Expect = 1.974e-36
Identity = 76/214 (35.51%), Postives = 125/214 (58.41%), Query Frame = 2
Query:  281 TILQNSQVACFDSGGEKLLCLPQVL-ELFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERL-SKIFRSPEYKSS--ENLVKTFYIPLKYRHQ-IRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRLAEDPSRTTEEERSLNDYLTEIKNRF 907
            T+L+   ++CF  GGEK LCLPQ+L  +  D    +I +  ++L I    C   +LEIL+   ++   +  CGLI++++AERL + +     Y     + L  +  + L+   + +RV H+CFG+ KG+L+P+L ++  A CI+C DC + + P +FV H+H +     E  TCHWGF S+NWR Y+ L++D +   E+ R L   L ++K +F
Sbjct:  103 TVLEGETISCFVVGGEKRLCLPQILNSVLRDFSLQQINSVCDELHIYCSRCTADQLEILKVMGILPFSAPSCGLITKTDAERLCNALLYGGAYPPPCKKELAASLALGLELSERSVRVYHECFGKCKGLLVPELYSSPSAACIQCLDCRLMYPPHKFVVHSHKA----LENRTCHWGFDSANWRAYILLSQDYTGKEEQAR-LGRCLDDVKEKF 311          
BLAST of Ski oncogene vs. Ensembl Mouse
Match: Ski (ski sarcoma viral oncogene homolog (avian) [Source:MGI Symbol;Acc:MGI:98310])

HSP 1 Score: 140.198 bits (352), Expect = 8.384e-35
Identity = 74/207 (35.75%), Postives = 121/207 (58.45%), Query Frame = 2
Query:  302 VACFDSGGEKLLCLPQVL-ELFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERL-SKIFRSPEYKSS--ENLVKTFYIPLKYRHQ-IRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRLAEDPSRTTEEERSLNDYLTEIKNRF 907
            ++CF  GGEK LCLPQ+L  +  D    +I +  ++L I    C   +LEIL+   ++   +  CGLI++++AERL + +     Y     + L  +  + L+   + +RV H+CFG+ KG+L+P+L ++  A CI+C DC + + P +FV H+H +     E  TCHWGF S+NWR Y+ L++D +   EE+  L   L ++K +F
Sbjct:   58 ISCFVVGGEKRLCLPQILNSVLRDFSLQQINSVCDELHIYCSRCTADQLEILKVMGILPFSAPSCGLITKTDAERLCNALLYGGAYPPPCKKELAASLALGLELSERSVRVYHECFGKCKGLLVPELYSSPSAACIQCLDCRLMYPPHKFVVHSHKA----LENRTCHWGFDSANWRAYILLSQDYT-GKEEQARLGRCLDDVKEKF 259          
BLAST of Ski oncogene vs. Ensembl Mouse
Match: Skil (SKI-like [Source:MGI Symbol;Acc:MGI:106203])

HSP 1 Score: 123.25 bits (308), Expect = 1.956e-29
Identity = 71/215 (33.02%), Postives = 113/215 (52.56%), Query Frame = 2
Query:  281 TILQNSQVACFDSGGEKLLCLPQVL-ELFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERL-SKIFRSPEYKSSENLV--KTFYIPLK-YRHQIRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRLAEDPSRTTEEERSLNDYLTEIKNRFT 910
            T+L+   ++CF  GGEK LCLPQVL  +  +    +I    ++L I    C   +L IL+   ++   +  CGLI+ ++A+RL + + R   +  + +++  K+    LK       V H+C G+ +G+  PQ     DA CI+C +C   F+P  FV H+H S     +  TCHWGF S+ W  YL + +     T EE+ L   L E+K +F+
Sbjct:   64 TLLEGESISCFQVGGEKRLCLPQVLNSVLREFSLQQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSILPAKSSLAQLKETGSAFEVEHECLGKCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRS----PDKRTCHWGFESAKWHCYLHVNQK-YLGTPEEKKLKIILEEMKEKFS 273          
BLAST of Ski oncogene vs. Ensembl Mouse
Match: Skil (SKI-like [Source:MGI Symbol;Acc:MGI:106203])

HSP 1 Score: 123.635 bits (309), Expect = 2.323e-29
Identity = 71/215 (33.02%), Postives = 113/215 (52.56%), Query Frame = 2
Query:  281 TILQNSQVACFDSGGEKLLCLPQVL-ELFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERL-SKIFRSPEYKSSENLV--KTFYIPLK-YRHQIRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRLAEDPSRTTEEERSLNDYLTEIKNRFT 910
            T+L+   ++CF  GGEK LCLPQVL  +  +    +I    ++L I    C   +L IL+   ++   +  CGLI+ ++A+RL + + R   +  + +++  K+    LK       V H+C G+ +G+  PQ     DA CI+C +C   F+P  FV H+H S     +  TCHWGF S+ W  YL + +     T EE+ L   L E+K +F+
Sbjct:  144 TLLEGESISCFQVGGEKRLCLPQVLNSVLREFSLQQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSILPAKSSLAQLKETGSAFEVEHECLGKCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRS----PDKRTCHWGFESAKWHCYLHVNQK-YLGTPEEKKLKIILEEMKEKFS 353          
BLAST of Ski oncogene vs. Ensembl Mouse
Match: Skil (SKI-like [Source:MGI Symbol;Acc:MGI:106203])

HSP 1 Score: 123.635 bits (309), Expect = 2.740e-29
Identity = 71/215 (33.02%), Postives = 113/215 (52.56%), Query Frame = 2
Query:  281 TILQNSQVACFDSGGEKLLCLPQVL-ELFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERL-SKIFRSPEYKSSENLV--KTFYIPLK-YRHQIRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRLAEDPSRTTEEERSLNDYLTEIKNRFT 910
            T+L+   ++CF  GGEK LCLPQVL  +  +    +I    ++L I    C   +L IL+   ++   +  CGLI+ ++A+RL + + R   +  + +++  K+    LK       V H+C G+ +G+  PQ     DA CI+C +C   F+P  FV H+H S     +  TCHWGF S+ W  YL + +     T EE+ L   L E+K +F+
Sbjct:  144 TLLEGESISCFQVGGEKRLCLPQVLNSVLREFSLQQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSILPAKSSLAQLKETGSAFEVEHECLGKCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRS----PDKRTCHWGFESAKWHCYLHVNQK-YLGTPEEKKLKIILEEMKEKFS 353          
BLAST of Ski oncogene vs. UniProt/SwissProt
Match: sp|P17863|SKI_AVIES (Transforming protein Ski OS=Avian erythroblastosis virus (strain Sloan-Kettering) OX=11862 GN=V-SKI PE=1 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 4.233e-36
Identity = 79/213 (37.09%), Postives = 122/213 (57.28%), Query Frame = 2
Query:  281 TILQNSQVACFDSGGEKLLCLPQVL-ELFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERL-SKIFRSPEYKS--SENLVKTFYIPLKYRHQIRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRLAEDPSRTTEEERSLNDYLTEIKNRF 907
            TIL+   ++CF  GGEK LCLPQ+L  +  D    +I +  ++L I    C   +LEIL+   ++   +  CGLI++++AERL + +     Y     +    T  + L  +   +V H+CFG+ KG+L+P+L +N  A CI+C DC + + P +FV H+H S     E  TCHWGF S+NWR Y+ L++D +   E+ R L   L E+K +F
Sbjct:   65 TILEGETISCFVVGGEKRLCLPQILNSVLRDFSLQQINSVCDELHIYCSRCTADQLEILKVMGILPFSAPSCGLITKTDAERLCNALLYGGTYPPHCKKEFSSTIELELTEK-SFKVYHECFGKCKGLLVPELYSNPSAACIQCLDCRLMYPPHKFVVHSHKS----LENRTCHWGFDSANWRSYILLSQDYTGKEEKAR-LGQLLDEMKEKF 271          
BLAST of Ski oncogene vs. UniProt/SwissProt
Match: sp|P12755|SKI_HUMAN (Ski oncogene OS=Homo sapiens OX=9606 GN=SKI PE=1 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 6.216e-36
Identity = 77/214 (35.98%), Postives = 125/214 (58.41%), Query Frame = 2
Query:  281 TILQNSQVACFDSGGEKLLCLPQVL-ELFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERL-SKIFRSPEYKSS--ENLVKTFYIPLKYRHQ-IRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRLAEDPSRTTEEERSLNDYLTEIKNRF 907
            T+L+   ++CF  GGEK LCLPQ+L  +  D    +I A  ++L I    C   +LEIL+   ++   +  CGLI++++AERL + +     Y     + L  +  + L+   + +RV H+CFG+ KG+L+P+L ++  A CI+C DC + + P +FV H+H +     E  TCHWGF S+NWR Y+ L++D +   EE+  L   L ++K +F
Sbjct:  103 TVLEGETISCFVVGGEKRLCLPQILNSVLRDFSLQQINAVCDELHIYCSRCTADQLEILKVMGILPFSAPSCGLITKTDAERLCNALLYGGAYPPPCKKELAASLALGLELSERSVRVYHECFGKCKGLLVPELYSSPSAACIQCLDCRLMYPPHKFVVHSHKA----LENRTCHWGFDSANWRAYILLSQDYT-GKEEQARLGRCLDDVKEKF 311          
BLAST of Ski oncogene vs. UniProt/SwissProt
Match: sp|Q60698|SKI_MOUSE (Ski oncogene OS=Mus musculus OX=10090 GN=Ski PE=1 SV=2)

HSP 1 Score: 145.591 bits (366), Expect = 1.259e-35
Identity = 76/214 (35.51%), Postives = 125/214 (58.41%), Query Frame = 2
Query:  281 TILQNSQVACFDSGGEKLLCLPQVL-ELFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERL-SKIFRSPEYKSS--ENLVKTFYIPLKYRHQ-IRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRLAEDPSRTTEEERSLNDYLTEIKNRF 907
            T+L+   ++CF  GGEK LCLPQ+L  +  D    +I +  ++L I    C   +LEIL+   ++   +  CGLI++++AERL + +     Y     + L  +  + L+   + +RV H+CFG+ KG+L+P+L ++  A CI+C DC + + P +FV H+H +     E  TCHWGF S+NWR Y+ L++D +   EE+  L   L ++K +F
Sbjct:  101 TVLEGETISCFVVGGEKRLCLPQILNSVLRDFSLQQINSVCDELHIYCSRCTADQLEILKVMGILPFSAPSCGLITKTDAERLCNALLYGGAYPPPCKKELAASLALGLELSERSVRVYHECFGKCKGLLVPELYSSPSAACIQCLDCRLMYPPHKFVVHSHKA----LENRTCHWGFDSANWRAYILLSQDYT-GKEEQARLGRCLDDVKEKF 309          
BLAST of Ski oncogene vs. UniProt/SwissProt
Match: sp|P49140|SKI_CHICK (Ski oncogene OS=Gallus gallus OX=9031 GN=SKI PE=1 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 3.207e-35
Identity = 79/213 (37.09%), Postives = 122/213 (57.28%), Query Frame = 2
Query:  281 TILQNSQVACFDSGGEKLLCLPQVL-ELFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERL-SKIFRSPEYKS--SENLVKTFYIPLKYRHQIRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRLAEDPSRTTEEERSLNDYLTEIKNRF 907
            TIL+   ++CF  GGEK LCLPQ+L  +  D    +I +  ++L I    C   +LEIL+   ++   +  CGLI++++AERL + +     Y     +    T  + L  +   +V H+CFG+ KG+L+P+L +N  A CI+C DC + + P +FV H+H S     E  TCHWGF S+NWR Y+ L++D +   E+ R L   L E+K +F
Sbjct:   86 TILEGETISCFVVGGEKRLCLPQILNSVLRDFSLQQINSVCDELHIYCSRCTADQLEILKVMGILPFSAPSCGLITKTDAERLCNALLYGGTYPPHCKKEFSSTIELELTEK-SFKVYHECFGKCKGLLVPELYSNPSAACIQCLDCRLMYPPHKFVVHSHKS----LENRTCHWGFDSANWRSYILLSQDYTGKEEKAR-LGQLLDEMKEKF 292          
BLAST of Ski oncogene vs. UniProt/SwissProt
Match: sp|Q9TUG2|SKI_HORSE (Ski oncogene OS=Equus caballus OX=9796 GN=SKI PE=2 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 1.353e-34
Identity = 75/214 (35.05%), Postives = 124/214 (57.94%), Query Frame = 2
Query:  281 TILQNSQVACFDSGGEKLLCLPQVL-ELFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERL-SKIFRSPEYKSS--ENLVKTFYIPLKYRHQ-IRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRLAEDPSRTTEEERSLNDYLTEIKNRF 907
            T+L+   ++CF  GGEK LCLPQ+L  +  D    +I +  ++L      C   +LEIL+   ++   +  CGLI++++AERL + +     Y     + L  +  + L+   + +RV H+CFG+ KG+L+P+L ++  A CI+C DC + + P +FV H+H +     E  TCHWGF S+NWR Y+ L++D +   EE+  L   L ++K +F
Sbjct:  103 TVLEGETISCFVVGGEKRLCLPQILNSVLRDFSLQQINSVCDELHTYCSRCTADQLEILKVMGILPFSAPSCGLITKTDAERLCNALLYGGAYPPPCKKELAASLALGLELSERSVRVYHECFGKCKGLLVPELYSSPSAACIQCLDCRLMYPPHKFVVHSHKA----LENRTCHWGFDSANWRAYILLSQDYT-GKEEQTRLGRCLDDVKEKF 311          
BLAST of Ski oncogene vs. TrEMBL
Match: A0A1S6KMI8 (c-SKI_SMAD_bind domain-containing protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 259.225 bits (661), Expect = 7.522e-76
Identity = 175/409 (42.79%), Postives = 237/409 (57.95%), Query Frame = 2
Query:  263 SETFGYTILQNSQVACFDSGGEKLLCLPQVLELFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERLSKIFRS--PEYKSSE----NLVKTFYIP--LKYRHQIRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLE-SEMSTCHWGFISSNWRLYLRLAEDPSRTTEEERSLNDYLTEIKNRFTQPIYDSLTIYNDHDQQTPSDNCSFNXXXXXXXXXXXXXXDGYNKIDLHNSSSMFQQCIMRICNN-HLENFDDRNQLINTLFMLRQEHHQQISTLISERQELIKAL-KKSPVANHNQWRTLELDEEKITTTQENSSDLTLLSIKDKIAILKRS-NAVKRKYSSGIENSDQRNEKE--SKTINPKE 1447
            +E F YT+L  + +A F++ GEKLLCLPQ+L L  ++  + I   I  +GII  EC+  +L +L +++++  + T CGLISQSNAER+ K F S   +  SSE    N + +  I       HQIRV HDCFGQQKGI+ P   T+ +AQCIEC +C    SPS+FVGHTH   G + SE   CHWGF SSNWR YLRL+ED +RT  EE SLNDYL EIK RF   + +     + H   T +++ SF+                     LH S ++FQQCI +I NN +L + D++ QL+N LF+LRQEH QQI+ LI+ERQ+LI+ L KK P                  + ++N +D  L  IK K AILK+  N+ KR  S   +N     +K+  S  INP +
Sbjct:  110 TENFTYTLLNKTYIASFNNDGEKLLCLPQILNLLKNIDISDINEAINSMGIICTECDEERLSVLHKHNILPKQVTCCGLISQSNAERMLKFFTSIGIDINSSEMNNNNTITSDKITSDSAAYHQIRVTHDCFGQQKGIIFPLKYTHANAQCIECLECSKMMSPSDFVGHTHQEFGSKWSETEVCHWGFDSSNWRWYLRLSEDCTRTKLEEESLNDYLDEIKKRFCTSVSELPPKRSIH---TSTNSPSFSEVHFKS---------------LHLSGAVFQQCISKINNNTNLSSRDEKLQLLNALFLLRQEHLQQINNLITERQQLIEGLMKKGPQK----------------SVEDNQTDQLLQIIKLKTAILKKEHNSRKRPASVNSDNVRDECQKKRVSSNINPSD 484          
BLAST of Ski oncogene vs. TrEMBL
Match: A0A0K2T1G2 (c-SKI_SMAD_bind domain-containing protein (Fragment) OS=Lepeophtheirus salmonis OX=72036 PE=4 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 5.808e-37
Identity = 87/220 (39.55%), Postives = 123/220 (55.91%), Query Frame = 2
Query:  260 YSETFGYTILQNSQVACFDSGGEKLLCLPQVLELFAD-VGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERLSKIF--RSPEYKSSENLVKTFYIPLKYRHQIRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRLAEDP-SRTTEEERSLNDYLTEIKNRF 907
            Y ETF    L   ++ACF+ GGE+  CLPQ+L    D +    I A  + L I    C   +LE+L+   VI   +++CGLI++S+AER+  +   R P           F +P      ++VVHDCFG+  G+L+PQL T+  A C++C DCG  F+P  FV H H+     SE  T HWGF SS+WR YLRL E   ++ + E+      LTE+K+RF
Sbjct:  155 YKETF----LWGERIACFNVGGEQRCCLPQILNSILDSISLQAIHAVCDDLRIYCPTCTPDQLELLKSFKVIPLTASQCGLITKSDAERIFSVLLDRQP---------PRFLLPSSVTLYLKVVHDCFGRNYGLLIPQLYTHQFANCVQCIDCGGAFNPQRFVCHVHS---YSSEKRTVHWGFDSSHWRTYLRLCESSYTQGSREKEEGERCLTEVKSRF 358          
BLAST of Ski oncogene vs. TrEMBL
Match: A0A2P8ZFA8 (Transforming protein Ski OS=Blattella germanica OX=6973 GN=V-SKI PE=4 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 2.385e-35
Identity = 83/209 (39.71%), Postives = 116/209 (55.50%), Query Frame = 2
Query:  281 TILQNSQVACFDSGGEKLLCLPQVL-ELFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERLSKIFRSPEYKSSENLVKTFYIPLKYRHQIRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRLAEDPSRTTEEERSLNDYLTEIKNR 904
            T+L+   ++CF  GGEK LCLPQVL  +  +    +I    E+L I    CN  +LE+L+   ++   +  CGLI++++AERLS       ++S  ++ K      K     +V H+CFG+ KGI  P+L T+N+A CIEC +C   FSP +FV H H       E  TCHWGF SSNWR YL +A+D     EE   L   L E K +
Sbjct:  119 TVLEGETISCFVVGGEKRLCLPQVLNSVLREFSLYQINQVCEELQIFCSRCNPEQLEVLKVTGILPMTAPSCGLITKTDAERLSSALL---HRSGVHVAKAPSGGHKGALSFKVYHECFGKCKGICTPELYTDNNAHCIECVECHGMFSPQKFVCHVHQF----LENRTCHWGFDSSNWRSYLLIAKD----QEEHEKLAKVLDEFKEQ 316          
BLAST of Ski oncogene vs. TrEMBL
Match: A0A1B6GH89 (c-SKI_SMAD_bind domain-containing protein (Fragment) OS=Cuerna arida OX=1464854 GN=g.22114 PE=4 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 2.987e-35
Identity = 85/214 (39.72%), Postives = 118/214 (55.14%), Query Frame = 2
Query:  281 TILQNSQVACFDSGGEKLLCLPQVL-ELFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERLSKIFRSPEYKSSENLVKTFYIPLKYRHQIRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRLAEDPSRTTEEERS-LNDYLTEIKNRFTQP 916
            T+L+   ++CF  GGEK LCLP +L  +  D    +I    ++L I    CN  +LE L+ + ++ S +  CGLI++++AERL          S+  L K   I      QI+V H+CFG+ +G+ MP+L T+  AQCIEC +C   F+P  FV H H       E  TCHWGF SSNWR YL L ED  +   E R+ L D+    K +FT P
Sbjct:   87 TVLEGESISCFVVGGEKRLCLPHILNSVLRDFSLPQINQVCDELQIFCSRCNPEQLEELKVSGILPSTAPSCGLITKTDAERLCSALLHRNAPSARLLDKAVTI------QIKVYHECFGKCRGVCMPELYTDTSAQCIECTECHGLFTPQTFVCHAHRY----LENRTCHWGFDSSNWRAYLLLVED--QPDHERRAKLLDFF---KEQFTDP 285          
BLAST of Ski oncogene vs. TrEMBL
Match: A0A3Q0DQX6 (ski oncogene OS=Tarsius syrichta OX=1868482 GN=LOC103251443 PE=4 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 4.358e-35
Identity = 77/214 (35.98%), Postives = 124/214 (57.94%), Query Frame = 2
Query:  281 TILQNSQVACFDSGGEKLLCLPQVL-ELFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERLS-KIFRSPEYKSS--ENLVKTFYIPLKYRHQ-IRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRLAEDPSRTTEEERSLNDYLTEIKNRF 907
            T+L+   ++CF  GGEK LCLPQ+L  +  D    +I +  ++L I    C   +LEIL+   V+   +  CGLI++++AERL   +     Y     + L  +  + L+   + +RV H+CFG+ KG+L+P+L ++  A CI+C DC + + P +FV H+H +     E  TCHWGF S+NWR Y+ L++D +   E+ R L   L ++K +F
Sbjct:   20 TVLEGETISCFVVGGEKRLCLPQILNSVLRDFSLQQINSVCDELHIYCSRCTADQLEILKVMGVLPFSAPSCGLITKTDAERLCNALLYGGAYPPPCKKELAASLALGLELSERSVRVYHECFGKCKGLLVPELYSSPSAACIQCLDCRLMYPPHKFVVHSHKA----LENRTCHWGFDSANWRAYILLSQDYTGKEEQAR-LGRCLDDVKEKF 228          
BLAST of Ski oncogene vs. Ensembl Cavefish
Match: skia (ski oncogene [Source:NCBI gene;Acc:103046211])

HSP 1 Score: 134.806 bits (338), Expect = 5.598e-33
Identity = 70/189 (37.04%), Postives = 103/189 (54.50%), Query Frame = 2
Query:  281 TILQNSQVACFDSGGEKLLCLPQVLE-LFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERLSKIF----RSPEYKSSENLVKTFYIPLKYRHQIRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRL 832
            T+L+   ++CF  GGEK LCLPQ+L  +  ++   +I +  ++L I    C   +LEIL+   V+   +  CGLI++++AERL          P   + E  V+      K    I+V H+CFG+  G+L+P+L T+  A CI C  CG+  +P  FV H H +     E  TCHWGF S NWR Y+ L
Sbjct:  108 TVLEGETISCFVVGGEKRLCLPQILNTVLRELSLQQINSVCDQLHIYCSRCTAEQLEILKVVGVLPFSAPSCGLITKTDAERLCNALVHGAGYPGKLAQEQEVEAEVHEGKAEAGIKVYHECFGRCAGVLLPELYTSPSAPCIRCAHCGLLLAPRRFVAHAHGT----PENRTCHWGFDSDNWRAYVLL 292          
BLAST of Ski oncogene vs. Ensembl Cavefish
Match: skib (ski oncogene-like [Source:NCBI gene;Acc:103031474])

HSP 1 Score: 134.806 bits (338), Expect = 7.959e-33
Identity = 76/226 (33.63%), Postives = 115/226 (50.88%), Query Frame = 2
Query:  281 TILQNSQVACFDSGGEKLLCLPQVLE-LFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERLSKIFRSPEYKSSENLVKTFYIPLKYRHQIRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRLAED---PSRTTEEERSLNDYLTEIKNRFTQPIYDSLTIYND 946
            T+L+   ++CF  GGEK LCLPQ+L  +  D    +I A  ++L +    C   +LE+L+   V+   +  CGLI+Q++AERL           S        +    +  + V H+CFG+  G+ +P+L +   A C++C DCG+ F    FV H+H       E  TCHWGF S+NWR Y+ L  D   P+  TE +R L+    + +     PI  +L I  D
Sbjct:   83 TVLERETISCFVVGGEKRLCLPQILNTVLRDFSLQQINAVCDELHVYCSRCTAEQLEVLKVVGVLPFSAPSCGLITQTDAERLCNALVHGGALPSRGGPAALELATTDK-SVPVYHECFGRCDGVFVPELYSGPGAACVQCADCGLMFPARRFVVHSHR----RRENRTCHWGFDSANWRAYILLDRDRAPPTEHTELQRRLDRLKEKFQPTKPTPITCTLGIQLD 303          
BLAST of Ski oncogene vs. Ensembl Cavefish
Match: skib (ski oncogene-like [Source:NCBI gene;Acc:103031474])

HSP 1 Score: 134.42 bits (337), Expect = 1.002e-32
Identity = 77/222 (34.68%), Postives = 113/222 (50.90%), Query Frame = 2
Query:  281 TILQNSQVACFDSGGEKLLCLPQVLE-LFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERLSKIFRSPEYKSSENLVKTFYIPLKYRHQIRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRLAEDPSRTTEEERSLNDYLTEIKNRFTQPIYDSLTIYN 943
            T+L+   ++CF  GGEK LCLPQ+L  +  D    +I A  ++L +    C   +LE+L+   V+   +  CGLI+Q++AERL           S        +    +  + V H+CFG+  G+ +P+L +   A C++C DCG+ F    FV H+H       E  TCHWGF S+NWR Y+ L  D +  TE    L   L  +K +F QP     T YN
Sbjct:   83 TVLERETISCFVVGGEKRLCLPQILNTVLRDFSLQQINAVCDELHVYCSRCTAEQLEVLKVVGVLPFSAPSCGLITQTDAERLCNALVHGGALPSRGGPAALELATTDK-SVPVYHECFGRCDGVFVPELYSGPGAACVQCADCGLMFPARRFVVHSHR----RRENRTCHWGFDSANWRAYILLDRDRAPPTEHT-ELQRRLDRLKEKF-QPTKP--TAYN 295          
BLAST of Ski oncogene vs. Ensembl Cavefish
Match: skila (SKI like proto-oncogene [Source:NCBI gene;Acc:103032490])

HSP 1 Score: 133.65 bits (335), Expect = 1.058e-32
Identity = 73/219 (33.33%), Postives = 114/219 (52.05%), Query Frame = 2
Query:  263 SETFGYTILQNSQVACFDSGGEKLLCLPQVL-ELFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERLSKIFRSPEYKSSENLVKTFYIPLKYRHQIRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRLAEDPSRTTEEERSLNDYLTEIKNRFTQP 916
            S    ++IL+   ++CF  GGEK LCLPQVL  +  D    +I A  ++L +    C+  +L IL+   ++   +  CGLI+ ++A+RL      P   ++ ++ ++           +V H C G+ +G+ +PQ     DA CI C +C + FSP  FV H+H S     +  TCHWGF S+ W  YL+L+       EE + L   L E+KN+F  P
Sbjct:  146 STELTHSILEGESISCFVVGGEKRLCLPQVLNSVLRDFSLQQINAVCDELYVYCSRCDAEQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRP--GTAIHVEQSMLKAKDSEAGFQVEHQCLGKCQGLFVPQFYVQPDAPCIRCMECQLLFSPQNFVMHSHCS----PDKRTCHWGFDSAKWACYLQLSRRYQGAAEEPK-LRQLLDEMKNKFHSP 357          
BLAST of Ski oncogene vs. Ensembl Cavefish
Match: skilb (ski-like protein [Source:NCBI gene;Acc:103027845])

HSP 1 Score: 112.464 bits (280), Expect = 1.102e-25
Identity = 66/215 (30.70%), Postives = 106/215 (49.30%), Query Frame = 2
Query:  287 LQNSQVACFDSGGEKLLCLPQVLE-LFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERLSKIFRSP-EYKSSENLVKTFYIPLKYRHQIR------VVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRLAEDPSRTTEEERSLNDYLTEIKNRF 907
            L+   ++CF  GGE  LCLPQVL  +  D   ++I +  ++L +    C+ S+L++L+   V+   +  CGLI+ ++A+RL      P E  +   ++K   +      +        V H C G+ +G+ +P+   +  + CI C  C   F P  FV H+H     + +  TCHWGF S+ W  YL+L       TEE R L   L  +K +F
Sbjct:  162 LEGETISCFSVGGELRLCLPQVLNTVLRDFSLHQINSVCDQLYLYCSRCDASQLQVLKILGVLPPGAPSCGLITLTDAQRLCNTLLHPGESNAPAGVLKGHSVGEDEEKEAEEGGAFWVEHQCLGKCQGLFVPRFYASPGSPCIRCSQCRRLFCPERFVMHSH----WQPDKRTCHWGFDSAKWACYLQLGRRYQGATEEAR-LKQLLETMKMKF 371          
BLAST of Ski oncogene vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001301.1 (pep scaffold:Pmarinus_7.0:GL481803:9978:11426:-1 gene:ENSPMAG00000001172.1 transcript:ENSPMAT00000001301.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 79.337 bits (194), Expect = 4.865e-16
Identity = 48/162 (29.63%), Postives = 80/162 (49.38%), Query Frame = 2
Query:  275 GYTILQNSQVACFDSGGEKLLCLPQVLE-LFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERLSKIFRSPEYKSSENLVKTFYIPLKYRHQIRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNS 757
            G  +L  + +      G++ LCL Q+   L     +N+I      LGI  ++C   +LE+LR+   +   S RCG+I++  AERL K F          L + F           V H+C    +G  +P    ++ A+CI+C  CG++FSP++F+ H+H +
Sbjct:    9 GEVLLYGAPIVSLVIDGQERLCLAQISNTLLKSYSYNEIHNRRVALGITCVQCTPVQLELLRRAGAMPVSSRRCGMITRREAERLCKSFLG--DHEPPRLPENF--------AFDVTHECAWGCRGSFVPARYNSSRAKCIKCSLCGLFFSPNKFIFHSHRA 160          
BLAST of Ski oncogene vs. Ensembl Nematostella
Match: EDO41836 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S373])

HSP 1 Score: 95.5153 bits (236), Expect = 4.563e-23
Identity = 61/174 (35.06%), Postives = 86/174 (49.43%), Query Frame = 2
Query:  323 GEKLLCLPQVLE-LFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERLSKIFRSPEYKSSENLVKTFYIPLKYRHQIRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRLAED 841
            GEK LC  +++E +        I AT ++L I    C   +LE+L+   V+       GLI++S+A RL             +  + F +       + V H+CFG   G L  +L T+  A+C+ C  C   FSP  FV H H SG    E+ TCHWGF S+NW+LYL L  D
Sbjct:    1 GEKRLCYKELVEKILKGFSSQVINATRDRLQIFCPRCTPQQLEVLKLAGVLPWSCASAGLIAKSDAFRLIGALTGSNVPHRNS--RLFSV-----DSLEVYHECFGGCVGTLEIELYTDPYAECVTCSQCDGVFSPRTFVTHHHTSG----EVHTCHWGFDSANWKLYLMLCND 163          
BLAST of Ski oncogene vs. Ensembl Medaka
Match: skia (SKI proto-oncogene [Source:NCBI gene;Acc:101164645])

HSP 1 Score: 139.813 bits (351), Expect = 1.182e-34
Identity = 78/216 (36.11%), Postives = 119/216 (55.09%), Query Frame = 2
Query:  281 TILQNSQVACFDSGGEKLLCLPQVLE-LFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERLSKIF-----RSPEYKSSENLVKTFYIPLKYRHQIRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRLAEDPSRTTEEERS-LNDYLTEIKNRF 907
            T+L+   ++CF  GGEK LCLPQ+L  +  D    +I +  ++L I    C   +LEIL+   ++   +  CGLI++++AERL           P  K          + L  R   +V H+CFG+ KG+L+P+L  +  A CI+C DC + +   +FV H+H +     E  TCHWGF S+NWR Y+ L++D   T +EE++ L   L EIK +F
Sbjct:   82 TVLEGETISCFVVGGEKRLCLPQILNTVLRDFSLQQINSVCDELHIYCSRCTADQLEILKVMGILPFSAPSCGLITKTDAERLCNALIYGGAFPPRAKKELGGAGALELQLTDR-SFKVYHECFGKCKGLLVPELYGSPSAACIQCLDCRLMYPTHKFVVHSHKA----QENRTCHWGFDSANWRAYILLSQD--YTGKEEKARLEQILDEIKEKF 290          
BLAST of Ski oncogene vs. Ensembl Medaka
Match: skia (SKI proto-oncogene [Source:NCBI gene;Acc:101164645])

HSP 1 Score: 139.428 bits (350), Expect = 1.576e-34
Identity = 78/216 (36.11%), Postives = 119/216 (55.09%), Query Frame = 2
Query:  281 TILQNSQVACFDSGGEKLLCLPQVLE-LFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERLSKIF-----RSPEYKSSENLVKTFYIPLKYRHQIRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRLAEDPSRTTEEERS-LNDYLTEIKNRF 907
            T+L+   ++CF  GGEK LCLPQ+L  +  D    +I +  ++L I    C   +LEIL+   ++   +  CGLI++++AERL           P  K          + L  R   +V H+CFG+ KG+L+P+L  +  A CI+C DC + +   +FV H+H +     E  TCHWGF S+NWR Y+ L++D   T +EE++ L   L EIK +F
Sbjct:   82 TVLEGETISCFVVGGEKRLCLPQILNTVLRDFSLQQINSVCDELHIYCSRCTADQLEILKVMGILPFSAPSCGLITKTDAERLCNALIYGGAFPPRAKKELGGAGALELQLTDR-SFKVYHECFGKCKGLLVPELYGSPSAACIQCLDCRLMYPTHKFVVHSHKA----QENRTCHWGFDSANWRAYILLSQD--YTGKEEKARLEQILDEIKEKF 290          
BLAST of Ski oncogene vs. Ensembl Medaka
Match: skib (ski oncogene [Source:NCBI gene;Acc:101171238])

HSP 1 Score: 136.346 bits (342), Expect = 1.359e-33
Identity = 78/212 (36.79%), Postives = 116/212 (54.72%), Query Frame = 2
Query:  281 TILQNSQVACFDSGGEKLLCLPQVL-ELFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERL-SKIFRSPEYKSSENLVKTFYIPLKYRHQIRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRLAEDPSRTTEEERS-LNDYLTEIKNRF 907
            T+L+   ++CF  GGEK LCLPQ+L  +  D    +I +  + L I    C   +LEIL+   ++   +  CGLI+Q++AERL + +     Y    N         +     +V H+CFG+ KG+ +P+L ++  A CI+C DC + F P +FV H+H       E  T HWGF SSNWR+Y+ L  D   T +EE+S L   L E+K +F
Sbjct:   81 TVLEREPISCFVVGGEKRLCLPQILNSVLRDFSLQQINSVCDDLHIYCSRCTADQLEILKVVGILPFSAPSCGLITQTDAERLCNALIYGGTYPPHCNKDLGSLELERTERSFKVYHECFGRCKGLFVPELYSSPAAACIQCMDCRLMFPPHKFVVHSHK----RLENRTVHWGFDSSNWRVYVLL--DADYTDKEEKSHLEQLLKELKGKF 286          
BLAST of Ski oncogene vs. Ensembl Medaka
Match: skila (SKI like proto-oncogene [Source:NCBI gene;Acc:111949033])

HSP 1 Score: 130.183 bits (326), Expect = 2.020e-31
Identity = 69/211 (32.70%), Postives = 108/211 (51.18%), Query Frame = 2
Query:  278 YTILQNSQVACFDSGGEKLLCLPQVL-ELFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERLSKIFRSPEYKSSENLVKTFYIPLKYRHQIRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRLAEDPSRTTEEERSLNDYLTEIKNRF 907
            +++L+   ++CF  GGEK LCLPQVL  +  D    +I    ++L +    C+  +L IL+   ++   +  CGLI+ ++A+RL      P      +      +  +     +V H C G  +G+  PQ  +  +A CI+C +C + FSP  FV H+H S     +  TCHWGF S+ W  YL+LA    + T EE  L   L E+K +F
Sbjct:  149 HSLLEGESISCFVVGGEKRLCLPQVLNSVLRDFSLQQINTVCDELYVYCSRCDAEQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPGAVLPPDPSGKLSVLKESETSFQVEHQCLGMCQGLFAPQFYSQPEAPCIQCVECQLLFSPQTFVMHSHKS----PDKRTCHWGFDSAKWPCYLQLARK-YQGTAEEPKLKLLLDEVKEKF 354          
BLAST of Ski oncogene vs. Ensembl Medaka
Match: skor1b (SKI family transcriptional corepressor 1 [Source:NCBI gene;Acc:101171078])

HSP 1 Score: 88.5817 bits (218), Expect = 4.563e-18
Identity = 60/194 (30.93%), Postives = 96/194 (49.48%), Query Frame = 2
Query:  275 GYTILQNSQVACFDSGGEKLLCLPQVLE-LFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERLSKIFRSPEYKSSENLVKTFYIPLKYRHQIRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRLAEDPSRT 853
            G TIL    +      G++ LCL Q+   L  +  +N+I      LGI  ++C   +LEILR+   +   S RCG+I++  AERL K F      S   L + F           V H+C    +G  +P    ++ A+CI+C  C ++FSP++F+ H+H +   ES+ +       +S WR +L+L +  S T
Sbjct:   47 GETILYGIPIVSLVIDGQERLCLAQISNTLLKNYSYNEIHNRRVALGITCVQCTPVQLEILRRAGAMPISSRRCGMITKREAERLCKSFLG--AHSPPKLPENF--------AFDVSHECAWGSRGSFIPARYNSSRAKCIKCSYCNMYFSPNKFIFHSHRTP--ESKYTQPDAANFNS-WRRHLKLTDKSSST 227          
BLAST of Ski oncogene vs. Planmine SMEST
Match: SMESG000044463.1 (SMESG000044463.1)

HSP 1 Score: 613.609 bits (1581), Expect = 0.000e+0
Identity = 310/311 (99.68%), Postives = 311/311 (100.00%), Query Frame = 2
Query:  656 MPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRLAEDPSRTTEEERSLNDYLTEIKNRFTQPIYDSLTIYNDHDQQTPSDNCSFNXXXXXXXXXXXXXXDGYNKIDLHNSSSMFQQCIMRICNNHLENFDDRNQLINTLFMLRQEHHQQISTLISERQELIKALKKSPVANHNQWRTLELDEEKITTTQENSSDLTLLSIKDKIAILKRSNAVKRKYSSGIENSDQRNEKESKTINPKEMEFIEPELPSGDNNHSMKEIIDCDSSSIRGELTEIFSSDQRQEMKND 1588
            MPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRLAEDPSRTTEEERSLNDYLTEIKNRFTQPIYDSLTIYNDHDQQTPSDNCSFNTSPSMPTPTSLSPTDGYNKIDLHNSSSMFQQCIMRICNNHLENFDDRNQLINTLFMLRQEHHQQISTLISERQELIKALKKSPVANH+QWRTLELDEEKITTTQENSSDLTLLSIKDKIAILKRSNAVKRKYSSGIENSDQRNEKESKTINPKEMEFIEPELPSGDNNHSMKEIIDCDSSSIRGELTEIFSSDQRQEMKND
Sbjct:    1 MPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRLAEDPSRTTEEERSLNDYLTEIKNRFTQPIYDSLTIYNDHDQQTPSDNCSFNTSPSMPTPTSLSPTDGYNKIDLHNSSSMFQQCIMRICNNHLENFDDRNQLINTLFMLRQEHHQQISTLISERQELIKALKKSPVANHSQWRTLELDEEKITTTQENSSDLTLLSIKDKIAILKRSNAVKRKYSSGIENSDQRNEKESKTINPKEMEFIEPELPSGDNNHSMKEIIDCDSSSIRGELTEIFSSDQRQEMKND 311          
BLAST of Ski oncogene vs. Planmine SMEST
Match: SMESG000067290.1 (SMESG000067290.1)

HSP 1 Score: 259.225 bits (661), Expect = 2.092e-79
Identity = 175/409 (42.79%), Postives = 237/409 (57.95%), Query Frame = 2
Query:  263 SETFGYTILQNSQVACFDSGGEKLLCLPQVLELFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERLSKIFRS--PEYKSSE----NLVKTFYIP--LKYRHQIRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLE-SEMSTCHWGFISSNWRLYLRLAEDPSRTTEEERSLNDYLTEIKNRFTQPIYDSLTIYNDHDQQTPSDNCSFNXXXXXXXXXXXXXXDGYNKIDLHNSSSMFQQCIMRICNN-HLENFDDRNQLINTLFMLRQEHHQQISTLISERQELIKAL-KKSPVANHNQWRTLELDEEKITTTQENSSDLTLLSIKDKIAILKRS-NAVKRKYSSGIENSDQRNEKE--SKTINPKE 1447
            +E F YT+L  + +A F++ GEKLLCLPQ+L L  ++  + I   I  +GII  EC+  +L +L +++++  + T CGLISQSNAER+ K F S   +  SSE    N + +  I       HQIRV HDCFGQQKGI+ P   T+ +AQCIEC +C    SPS+FVGHTH   G + SE   CHWGF SSNWR YLRL+ED +RT  EE SLNDYL EIK RF   + +     + H   T +++ SF+                     LH S ++FQQCI +I NN +L + D++ QL+N LF+LRQEH QQI+ LI+ERQ+LI+ L KK P                  + ++N +D  L  IK K AILK+  N+ KR  S   +N     +K+  S  INP +
Sbjct:  110 TENFTYTLLNKTYIASFNNDGEKLLCLPQILNLLKNIDISDINEAINSMGIICTECDEERLSVLHKHNILPKQVTCCGLISQSNAERMLKFFTSIGIDINSSEMNNNNTITSDKITSDSAAYHQIRVTHDCFGQQKGIIFPLKYTHANAQCIECLECSKMMSPSDFVGHTHQEFGSKWSETEVCHWGFDSSNWRWYLRLSEDCTRTKLEEESLNDYLDEIKKRFCTSVSELPPKRSIH---TSTNSPSFSEVHFKS---------------LHLSGAVFQQCISKINNNTNLSSRDEKLQLLNALFLLRQEHLQQINNLITERQQLIEGLMKKGPQK----------------SVEDNQTDQLLQIIKLKTAILKKEHNSRKRPASVNSDNVRDECQKKRVSSNINPSD 484          
BLAST of Ski oncogene vs. Planmine SMEST
Match: SMESG000018825.1 (SMESG000018825.1)

HSP 1 Score: 137.117 bits (344), Expect = 4.053e-34
Identity = 77/200 (38.50%), Postives = 111/200 (55.50%), Query Frame = 2
Query:  284 ILQNSQVACFDSGGEKLLCLPQVLE-LFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERLSKIFRSPEYKSSENLVKTFYIPLKYRHQIRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRLAEDPSRTTEEERSLND 880
            +++N  +A F+  GE+ +CLPQ+L  +  +   N I   +  L I   +CN  ++++L  N +      RCGLI +S+AERL K    P    S   +      L  +  I+VVH CFG+Q+GIL P L  ++DA+CI+C  C  +F   EFVGHTH    L+   +T HWGF S+NWRL L++  DP     E   LND
Sbjct:    1 MIENELIAGFNVWGERRICLPQLLRFVLPEFDINVIDQAVTDLRINCFQCNNQQIKMLHDNEIFPKHIVRCGLIRKSDAERLCKYLFQPNQNYS--TISETNQKLSQQESIQVVHTCFGEQRGILYPVLYNSSDAKCIKCATCENFFKTFEFVGHTH---KLDEVSNTFHWGFDSNNWRLLLQIYTDPENGNVE--MLND 193          
BLAST of Ski oncogene vs. Planmine SMEST
Match: SMESG000070642.1 (SMESG000070642.1)

HSP 1 Score: 103.219 bits (256), Expect = 1.998e-23
Identity = 57/191 (29.84%), Postives = 93/191 (48.69%), Query Frame = 2
Query:  263 SETFGYTILQNSQVACFDSGGEKLLCLPQVLE-LFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERLSKIFRSPEYKSSENLVKTFYIPLKYRHQIRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRL 832
            S+    T L+N  +  F +G    + +P ++   F D+ +  I   +  L I   +C   +L IL    ++ S   +CGLI + +A+RL K   +    S  +    F IP        ++H CFG+Q+  L P L   ++++CI+C  C   F+  EFV HTH        ++T HWGF S NWR ++ +
Sbjct:    3 SKIIQLTELENHFLISFANGSNIKILMPHLIRSFFQDIDYPTINQLLTFLSIKCCQCTPEQLRILHTTKILSSDVNQCGLIDKVDAKRLCKFIHNTNLTSIRSTSSLFVIP--------IIHYCFGRQQAFLYPDLYVKSNSRCIKCASCSQIFTTCEFVKHTHLKIN---HINTVHWGFHSLNWRYFIYI 182          
BLAST of Ski oncogene vs. Planmine SMEST
Match: SMESG000073656.1 (SMESG000073656.1)

HSP 1 Score: 78.5666 bits (192), Expect = 1.992e-15
Identity = 54/199 (27.14%), Postives = 93/199 (46.73%), Query Frame = 2
Query:  260 YSETFGYTILQNSQVACFDSGGEKLLCLPQVLE-LFADVGHNKIRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERLSKIFRSPEYKSSENLVKTFYIPLKYRHQIRVVHDCFGQQKGILMPQLCTNNDAQCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISS----NWRLYLRLAED 841
            +S T     L  S +      G++ LCL Q+   L +   +N+I      LGI  ++C   +L+ LR+   +   S RCG+I++  AERL K F   +  S   L   F   +K        H C     G  +P    ++ A+CI+C+ C ++FSP++F+ H H     E + S  ++    +     WR +L ++++
Sbjct:   16 FSNTIKMVSLYGSSIVSLIINGQERLCLAQISNTLLSKYSYNEIHNRRVALGITCVQCTPVQLDQLRRAGAMPISSRRCGMITKREAERLVKSFL--DEISPPKLPSNFAFNVK--------HSCGWGCYGSFIPTRYNSSRAKCIKCYQCQIFFSPNKFIFHCHKPDNDEIKKSNLNYHHPDAANFNAWRRHLVISDE 204          
The following BLAST results are available for this feature:
BLAST of Ski oncogene vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SKI1.294e-3635.98SKI proto-oncogene [Source:HGNC Symbol;Acc:HGNC:10... [more]
SKIL3.180e-2933.49SKI like proto-oncogene [Source:HGNC Symbol;Acc:HG... [more]
SKIL3.417e-2933.49SKI like proto-oncogene [Source:HGNC Symbol;Acc:HG... [more]
SKIL3.516e-2933.49SKI like proto-oncogene [Source:HGNC Symbol;Acc:HG... [more]
SKIL3.516e-2933.49SKI like proto-oncogene [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Ski oncogene vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dac-16.778e-633.33DAChsund transcription factor homolog [Source:Uni... [more]
back to top
BLAST of Ski oncogene vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Snoo2.383e-2835.42gene:FBgn0085450 transcript:FBtr0343409[more]
Snoo2.383e-2835.42gene:FBgn0085450 transcript:FBtr0112717[more]
Snoo2.383e-2835.42gene:FBgn0085450 transcript:FBtr0112719[more]
Snoo2.383e-2835.42gene:FBgn0085450 transcript:FBtr0112718[more]
fuss7.659e-1630.67gene:FBgn0039932 transcript:FBtr0301336[more]
back to top
BLAST of Ski oncogene vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
skib1.404e-3537.26v-ski avian sarcoma viral oncogene homolog b [Sour... [more]
skia6.612e-3533.73v-ski avian sarcoma viral oncogene homolog a [Sour... [more]
skila5.252e-3230.40SKI-like proto-oncogene a [Source:ZFIN;Acc:ZDB-GEN... [more]
skila1.876e-3132.44SKI-like proto-oncogene a [Source:ZFIN;Acc:ZDB-GEN... [more]
skila7.322e-3132.44SKI-like proto-oncogene a [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Ski oncogene vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SKI8.153e-3635.94SKI proto-oncogene [Source:NCBI gene;Acc:100486949... [more]
ENSXETT00000042147.13.623e-2833.64SKI-like proto-oncogene [Source:NCBI gene;Acc:1004... [more]
SKOR11.433e-1731.41SKI family transcriptional corepressor 1 [Source:N... [more]
SKOR11.562e-1731.41SKI family transcriptional corepressor 1 [Source:N... [more]
SKOR11.588e-1731.41SKI family transcriptional corepressor 1 [Source:N... [more]
back to top
BLAST of Ski oncogene vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ski1.974e-3635.51ski sarcoma viral oncogene homolog (avian) [Source... [more]
Ski8.384e-3535.75ski sarcoma viral oncogene homolog (avian) [Source... [more]
Skil1.956e-2933.02SKI-like [Source:MGI Symbol;Acc:MGI:106203][more]
Skil2.323e-2933.02SKI-like [Source:MGI Symbol;Acc:MGI:106203][more]
Skil2.740e-2933.02SKI-like [Source:MGI Symbol;Acc:MGI:106203][more]
back to top
BLAST of Ski oncogene vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P17863|SKI_AVIES4.233e-3637.09Transforming protein Ski OS=Avian erythroblastosis... [more]
sp|P12755|SKI_HUMAN6.216e-3635.98Ski oncogene OS=Homo sapiens OX=9606 GN=SKI PE=1 S... [more]
sp|Q60698|SKI_MOUSE1.259e-3535.51Ski oncogene OS=Mus musculus OX=10090 GN=Ski PE=1 ... [more]
sp|P49140|SKI_CHICK3.207e-3537.09Ski oncogene OS=Gallus gallus OX=9031 GN=SKI PE=1 ... [more]
sp|Q9TUG2|SKI_HORSE1.353e-3435.05Ski oncogene OS=Equus caballus OX=9796 GN=SKI PE=2... [more]
back to top
BLAST of Ski oncogene vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S6KMI87.522e-7642.79c-SKI_SMAD_bind domain-containing protein OS=Schmi... [more]
A0A0K2T1G25.808e-3739.55c-SKI_SMAD_bind domain-containing protein (Fragmen... [more]
A0A2P8ZFA82.385e-3539.71Transforming protein Ski OS=Blattella germanica OX... [more]
A0A1B6GH892.987e-3539.72c-SKI_SMAD_bind domain-containing protein (Fragmen... [more]
A0A3Q0DQX64.358e-3535.98ski oncogene OS=Tarsius syrichta OX=1868482 GN=LOC... [more]
back to top
BLAST of Ski oncogene vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
skia5.598e-3337.04ski oncogene [Source:NCBI gene;Acc:103046211][more]
skib7.959e-3333.63ski oncogene-like [Source:NCBI gene;Acc:103031474][more]
skib1.002e-3234.68ski oncogene-like [Source:NCBI gene;Acc:103031474][more]
skila1.058e-3233.33SKI like proto-oncogene [Source:NCBI gene;Acc:1030... [more]
skilb1.102e-2530.70ski-like protein [Source:NCBI gene;Acc:103027845][more]
back to top
BLAST of Ski oncogene vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000001301.14.865e-1629.63pep scaffold:Pmarinus_7.0:GL481803:9978:11426:-1 g... [more]
back to top
BLAST of Ski oncogene vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ski oncogene vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO418364.563e-2335.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ski oncogene vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
skia1.182e-3436.11SKI proto-oncogene [Source:NCBI gene;Acc:101164645... [more]
skia1.576e-3436.11SKI proto-oncogene [Source:NCBI gene;Acc:101164645... [more]
skib1.359e-3336.79ski oncogene [Source:NCBI gene;Acc:101171238][more]
skila2.020e-3132.70SKI like proto-oncogene [Source:NCBI gene;Acc:1119... [more]
skor1b4.563e-1830.93SKI family transcriptional corepressor 1 [Source:N... [more]
back to top
BLAST of Ski oncogene vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000044463.10.000e+099.68SMESG000044463.1[more]
SMESG000067290.12.092e-7942.79SMESG000067290.1[more]
SMESG000018825.14.053e-3438.50SMESG000018825.1[more]
SMESG000070642.11.998e-2329.84SMESG000070642.1[more]
SMESG000073656.11.992e-1527.14SMESG000073656.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011091 ID=SMED30011091|Name=Ski oncogene|organism=Schmidtea mediterranea sexual|type=transcript|length=1662bp
CTGATTGGCTAATCGTGAAAATGATTCTTGATAAAGCTCTTTTCCATTAT
TTATCAGCGTCGAAGTCAGTCATTAAATTGCGCTCATGAAAATCCGTGCA
ATAAACGACAACTGGTATGGGAAAATTATCGGCAATGCTGACATTATGAA
ATCGAGACCCCAAACAATGACAGAAGCTTACAAAGAAACCAACACTGAAA
CCGACGATTCAGAATCTGGATTCAGACGTTTTGAGTTTTTCCAAGACCGA
GATGAATTCTATTCCGAGACTTTTGGTTATACGATTCTTCAGAATTCTCA
AGTAGCTTGTTTCGACAGCGGCGGCGAGAAATTGCTCTGTCTTCCACAAG
TTCTCGAGTTATTCGCAGATGTTGGCCACAACAAAATTAGGGCAACAATT
GAAAAACTTGGTATAATTCTAATAGAGTGCAACCTAAGCAAGCTAGAGAT
CCTTCGCCAAAATCATGTCATTCACTCAAAATCCACTCGTTGTGGTCTAA
TATCACAATCCAACGCTGAAAGACTTTCAAAAATATTTCGATCTCCAGAA
TATAAATCCAGTGAAAATTTAGTGAAAACATTCTACATTCCCCTGAAGTA
TCGGCATCAAATCCGAGTGGTTCACGATTGCTTTGGGCAACAAAAGGGAA
TTCTAATGCCGCAATTATGTACAAATAACGATGCTCAATGTATTGAATGC
TTTGATTGTGGGGTCTGGTTTTCTCCATCAGAATTTGTGGGACACACTCA
CAATTCCGGGGGATTAGAATCTGAAATGTCTACATGCCACTGGGGATTTA
TATCTAGTAATTGGAGATTATATCTACGCCTTGCAGAAGATCCCAGTCGA
ACGACGGAAGAGGAAAGGAGTTTGAATGATTATCTAACCGAAATCAAAAA
TCGCTTCACTCAGCCCATTTATGATTCCCTCACAATATACAATGATCACG
ACCAGCAGACTCCCTCAGACAATTGCTCGTTTAACACGTCTCCTTCAATG
CCCACTCCTACTTCTCTCAGTCCGACAGATGGATACAATAAAATAGATTT
ACATAACTCGAGCTCCATGTTCCAACAATGTATTATGAGGATTTGCAACA
ACCATCTTGAAAATTTTGACGACCGGAACCAGTTGATCAACACCCTTTTC
ATGTTACGCCAAGAGCACCATCAACAGATATCAACATTGATATCAGAAAG
ACAGGAACTAATAAAAGCACTGAAAAAGAGTCCTGTGGCGAATCATAATC
AGTGGAGAACACTGGAATTGGACGAAGAGAAAATCACAACAACTCAAGAA
AATTCATCAGATTTGACGTTACTGTCGATCAAAGACAAAATTGCGATTCT
CAAGCGTTCAAATGCTGTAAAGAGAAAATATTCTTCAGGGATCGAAAATT
CAGATCAAAGAAATGAGAAAGAGAGCAAAACCATTAATCCAAAAGAAATG
GAATTCATAGAACCTGAATTGCCGAGCGGGGATAATAATCACTCAATGAA
GGAAATAATTGATTGTGATTCCAGCTCTATTCGTGGAGAATTGACCGAGA
TATTCAGCAGCGATCAACGACAGGAAATGAAAAATGATTAATGACCTCTA
TTAATCTTAAAAGATATTTTTTTGTGATTAATGAATAAGCGTTTTGTTTT
AATATATTACTG
back to top

protein sequence of SMED30011091-orf-1

>SMED30011091-orf-1 ID=SMED30011091-orf-1|Name=SMED30011091-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=502bp
MKIRAINDNWYGKIIGNADIMKSRPQTMTEAYKETNTETDDSESGFRRFE
FFQDRDEFYSETFGYTILQNSQVACFDSGGEKLLCLPQVLELFADVGHNK
IRATIEKLGIILIECNLSKLEILRQNHVIHSKSTRCGLISQSNAERLSKI
FRSPEYKSSENLVKTFYIPLKYRHQIRVVHDCFGQQKGILMPQLCTNNDA
QCIECFDCGVWFSPSEFVGHTHNSGGLESEMSTCHWGFISSNWRLYLRLA
EDPSRTTEEERSLNDYLTEIKNRFTQPIYDSLTIYNDHDQQTPSDNCSFN
TSPSMPTPTSLSPTDGYNKIDLHNSSSMFQQCIMRICNNHLENFDDRNQL
INTLFMLRQEHHQQISTLISERQELIKALKKSPVANHNQWRTLELDEEKI
TTTQENSSDLTLLSIKDKIAILKRSNAVKRKYSSGIENSDQRNEKESKTI
NPKEMEFIEPELPSGDNNHSMKEIIDCDSSSIRGELTEIFSSDQRQEMKN
D*
back to top
Aliases
The feature 'Ski oncogene' has the following synonyms
Synonym
Smed_32930
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0000122negative regulation of transcription from RNA polymerase II promoter
GO:0008285negative regulation of cell proliferation
GO:0032926negative regulation of activin receptor signaling pathway
GO:0043388positive regulation of DNA binding
GO:0045668negative regulation of osteoblast differentiation
GO:0060395SMAD protein signal transduction
GO:0006351transcription, DNA-templated
GO:0030512negative regulation of transforming growth factor beta receptor signaling pathway
GO:0030514negative regulation of BMP signaling pathway
GO:0045596negative regulation of cell differentiation
GO:0048666neuron development
Vocabulary: molecular function
TermDefinition
GO:0003714transcription corepressor activity
GO:0008270zinc ion binding
GO:0019901protein kinase binding
GO:0031625ubiquitin protein ligase binding
GO:0046332SMAD binding
GO:0005515protein binding
GO:0019904protein domain specific binding
GO:0042803protein homodimerization activity
GO:0043565sequence-specific DNA binding
GO:0046982protein heterodimerization activity
GO:0070491repressing transcription factor binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR023216Tscrpt_reg_SKI_SnoN
IPR014890c-SKI_SMAD4-bd_dom
IPR003380SKI/SNO/DAC
IPR010919SAND-like_dom_sf
IPR009061DNA-bd_dom_put_sf
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005667transcription factor complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR014890c-SKI SMAD4-binding domainSMARTSM01046c_SKI_SMAD_bind_2coord: 1..85
e-value: 3.8E-14
score: 63.0
IPR014890c-SKI SMAD4-binding domainPFAMPF08782c-SKI_SMAD_bindcoord: 1..84
e-value: 1.4E-20
score: 73.3
IPR010919SAND-like domain superfamilyGENE3DG3DSA:3.10.390.10coord: 1..90
e-value: 7.0E-23
score: 82.7
IPR010919SAND-like domain superfamilySUPERFAMILYSSF63763SAND domain-likecoord: 2..71
IPR023216Transcription regulator SKI/SnoNPANTHERPTHR10005SKI ONCOGENE-RELATEDcoord: 2..258
NoneNo IPR availablePANTHERPTHR10005:SF25SNO ONCOGENE, ISOFORM Bcoord: 2..258