Epidermal growth factor receptor kinase substrate 8

Overview
NameEpidermal growth factor receptor kinase substrate 8
Smed IDSMED30011084
Length (bp)2345
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Epidermal growth factor receptor kinase substrate 8 (SMED30011084) t-SNE clustered cells

Violin plots show distribution of expression levels for Epidermal growth factor receptor kinase substrate 8 (SMED30011084) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Epidermal growth factor receptor kinase substrate 8 (SMED30011084) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Epidermal growth factor receptor kinase substrate 8 (SMED30011084) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011084

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30011084SMESG000070650.1 dd_Smed_v4_4256_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30011084SMESG000070650.1 dd_Smed_v4_4256_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30011084SMESG000070650.1 dd_Smed_v4_4256_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30011084SMESG000070650.1 dd_Smed_v4_4256_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011084SMESG000070650.1 dd_Smed_v4_4256_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30011084SMESG000070650.1 dd_Smed_v4_4256_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30011084SMESG000070650.1 dd_Smed_v4_4256_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011084SMESG000070650.1 Contig10348newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011084SMESG000070650.1 Contig10348uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011084SMESG000070650.1 Contig34974newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011084SMESG000070650.1 Contig34974uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011084SMESG000070650.1 Contig4691newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011084SMESG000070650.1 Contig4691uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011084SMESG000002573.1 Contig4691newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011084SMESG000002573.1 Contig4691uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30011084SMESG000070650.1 dd_Smed_v4_4256_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Human
Match: EPS8L1 (EPS8 like 1 [Source:HGNC Symbol;Acc:HGNC:21295])

HSP 1 Score: 139.043 bits (349), Expect = 1.103e-33
Identity = 142/529 (26.84%), Postives = 237/529 (44.80%), Query Frame = 2
Query:  614 DSKPRNDDISS-RTERNLLLLNYCFDDIEFFLQHLKDQEEAQAILKNTKGKNLNDR------LLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQX-----XXXXXXXXXXXGQAYSIYHNGKLSKVKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCK-AREKWAGYKEKYYPEFFNGYQIDLEELMKDGIISPIADIPRRAVSNA---EISHA-IFYNQALPMIAQTDILENTVLSSREEDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLLEPFC--------YIDRSINN---------------FIKSSPESPDYLNVRNIPTVPVSPKRISQIMKDPNSADKVAEANIINEELKKKINTNSNFGGWNSRASFARPGPVVSKKHGQLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKSLSGFGTLSRR----ELDEILTKRKEKVE 2068
            D  PR  D++  + ER + +LN+ FDD+E F+  L+   EA  +L++ +    + R      LL  +AKP ++  Y   ++KIK++ +LL +L G I +P S +L       L +      G  ++       S V+ P LT D V LL   ++   ++ WTS GD+W +   E        Y PEFF+G++             P+ D   RA  +    ++ H      Q+ P +A   +  +  L    E    S T   GK       F A    ELS+ + +++EV++    + WW   +  GQ+GY P  +L P+            RS+N+                 +   + P + +  ++  +            DP+  +K ++  I+NEEL+ ++          S  S A PGP   +   QLS   D++  +V+ WL+ K FS   ++ L +  G  LF L ++E+ R VS E   R+ S V VQ+SL     L  +    EL+ ++ K+K+KVE
Sbjct:  114 DLGPRGPDLAVLQAEREVDILNHVFDDVESFVSRLQKSAEAARVLEHRERGRRSRRRAAGEGLLTLRAKPPSEAEYTDVLQKIKYAFSLLARLRGNIADPSSPELLHFLFGPLQMIVNTSGGPEFA-------SSVRRPHLTSDAVALLRDNVTPRENELWTSLGDSWTRPGLELSPEEGPPYRPEFFSGWE------------PPVTDPQSRAWEDPVEKQLQHERRRRQQSAPQVA---VNGHRDLEPESEPQLESETA--GKWVLCNYDFQARNSSELSVKQRDVLEVLDDS--RKWWKVRDPAGQEGYVPYNILTPYPGPRLHHSQSPARSLNSTPPPPPAPAPAPPPALARPRWDRPRWDSCDSLNGL------------DPSEKEKFSQMLIVNEELQARLAQG------RSGPSRAVPGPRAPEP--QLSPGSDAS--EVRAWLQAKGFSSGTVDALGVLTGAQLFSLQKEEL-RAVSPEEGARVYSQVTVQRSL-----LEDKEKVSELEAVMEKQKKKVE 588          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Human
Match: EPS8L1 (EPS8 like 1 [Source:HGNC Symbol;Acc:HGNC:21295])

HSP 1 Score: 138.658 bits (348), Expect = 1.961e-33
Identity = 142/529 (26.84%), Postives = 237/529 (44.80%), Query Frame = 2
Query:  614 DSKPRNDDISS-RTERNLLLLNYCFDDIEFFLQHLKDQEEAQAILKNTKGKNLNDR------LLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQX-----XXXXXXXXXXXGQAYSIYHNGKLSKVKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCK-AREKWAGYKEKYYPEFFNGYQIDLEELMKDGIISPIADIPRRAVSNA---EISHA-IFYNQALPMIAQTDILENTVLSSREEDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLLEPFC--------YIDRSINN---------------FIKSSPESPDYLNVRNIPTVPVSPKRISQIMKDPNSADKVAEANIINEELKKKINTNSNFGGWNSRASFARPGPVVSKKHGQLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKSLSGFGTLSRR----ELDEILTKRKEKVE 2068
            D  PR  D++  + ER + +LN+ FDD+E F+  L+   EA  +L++ +    + R      LL  +AKP ++  Y   ++KIK++ +LL +L G I +P S +L       L +      G  ++       S V+ P LT D V LL   ++   ++ WTS GD+W +   E        Y PEFF+G++             P+ D   RA  +    ++ H      Q+ P +A   +  +  L    E    S T   GK       F A    ELS+ + +++EV++    + WW   +  GQ+GY P  +L P+            RS+N+                 +   + P + +  ++  +            DP+  +K ++  I+NEEL+ ++          S  S A PGP   +   QLS   D++  +V+ WL+ K FS   ++ L +  G  LF L ++E+ R VS E   R+ S V VQ+SL     L  +    EL+ ++ K+K+KVE
Sbjct:  177 DLGPRGPDLAVLQAEREVDILNHVFDDVESFVSRLQKSAEAARVLEHRERGRRSRRRAAGEGLLTLRAKPPSEAEYTDVLQKIKYAFSLLARLRGNIADPSSPELLHFLFGPLQMIVNTSGGPEFA-------SSVRRPHLTSDAVALLRDNVTPRENELWTSLGDSWTRPGLELSPEEGPPYRPEFFSGWE------------PPVTDPQSRAWEDPVEKQLQHERRRRQQSAPQVA---VNGHRDLEPESEPQLESET--AGKWVLCNYDFQARNSSELSVKQRDVLEVLDDS--RKWWKVRDPAGQEGYVPYNILTPYPGPRLHHSQSPARSLNSTPPPPPAPAPAPPPALARPRWDRPRWDSCDSLNGL------------DPSEKEKFSQMLIVNEELQARLAQG------RSGPSRAVPGPRAPEP--QLSPGSDAS--EVRAWLQAKGFSSGTVDALGVLTGAQLFSLQKEEL-RAVSPEEGARVYSQVTVQRSL-----LEDKEKVSELEAVMEKQKKKVE 651          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Human
Match: EPS8L1 (EPS8 like 1 [Source:HGNC Symbol;Acc:HGNC:21295])

HSP 1 Score: 138.658 bits (348), Expect = 2.946e-33
Identity = 142/529 (26.84%), Postives = 237/529 (44.80%), Query Frame = 2
Query:  614 DSKPRNDDISS-RTERNLLLLNYCFDDIEFFLQHLKDQEEAQAILKNTKGKNLNDR------LLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQX-----XXXXXXXXXXXGQAYSIYHNGKLSKVKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCK-AREKWAGYKEKYYPEFFNGYQIDLEELMKDGIISPIADIPRRAVSNA---EISHA-IFYNQALPMIAQTDILENTVLSSREEDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLLEPFC--------YIDRSINN---------------FIKSSPESPDYLNVRNIPTVPVSPKRISQIMKDPNSADKVAEANIINEELKKKINTNSNFGGWNSRASFARPGPVVSKKHGQLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKSLSGFGTLSRR----ELDEILTKRKEKVE 2068
            D  PR  D++  + ER + +LN+ FDD+E F+  L+   EA  +L++ +    + R      LL  +AKP ++  Y   ++KIK++ +LL +L G I +P S +L       L +      G  ++       S V+ P LT D V LL   ++   ++ WTS GD+W +   E        Y PEFF+G++             P+ D   RA  +    ++ H      Q+ P +A   +  +  L    E    S T   GK       F A    ELS+ + +++EV++    + WW   +  GQ+GY P  +L P+            RS+N+                 +   + P + +  ++  +            DP+  +K ++  I+NEEL+ ++          S  S A PGP   +   QLS   D++  +V+ WL+ K FS   ++ L +  G  LF L ++E+ R VS E   R+ S V VQ+SL     L  +    EL+ ++ K+K+KVE
Sbjct:  241 DLGPRGPDLAVLQAEREVDILNHVFDDVESFVSRLQKSAEAARVLEHRERGRRSRRRAAGEGLLTLRAKPPSEAEYTDVLQKIKYAFSLLARLRGNIADPSSPELLHFLFGPLQMIVNTSGGPEFA-------SSVRRPHLTSDAVALLRDNVTPRENELWTSLGDSWTRPGLELSPEEGPPYRPEFFSGWE------------PPVTDPQSRAWEDPVEKQLQHERRRRQQSAPQVA---VNGHRDLEPESEPQLESET--AGKWVLCNYDFQARNSSELSVKQRDVLEVLDDS--RKWWKVRDPAGQEGYVPYNILTPYPGPRLHHSQSPARSLNSTPPPPPAPAPAPPPALARPRWDRPRWDSCDSLNGL------------DPSEKEKFSQMLIVNEELQARLAQG------RSGPSRAVPGPRAPEP--QLSPGSDAS--EVRAWLQAKGFSSGTVDALGVLTGAQLFSLQKEEL-RAVSPEEGARVYSQVTVQRSL-----LEDKEKVSELEAVMEKQKKKVE 715          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Human
Match: EPS8L2 (EPS8 like 2 [Source:HGNC Symbol;Acc:HGNC:21296])

HSP 1 Score: 117.857 bits (294), Expect = 1.387e-26
Identity = 131/520 (25.19%), Postives = 223/520 (42.88%), Query Frame = 2
Query:  605 KEYDSKPRNDDISSRTERNLLLLNYCFDDIEFFLQHLKDQEEAQAILKNTKGKNLNDR--------------LLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQAYSIYHNGKLSKVKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWAGYKEK--YYPEFFNGYQIDLE---------ELMKDGIISPIADIPRRAVSNAE----ISHAIFYNQALPMIAQTDILENTVLSSREEDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLL---------EPFCYIDRSINNFIKSSPESPDYLNVRNIPTVPVSPKRISQIMKDPNSADKVAEANIINEELKKKINTNSNFGGWNSRASFARPGPVVSKKHGQLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKSLSGFGTLSRRELDEILTK 2050
            +E   +PR   ++ + E+   +LN   DDIE+F+  L+   EA         K LN R              +L  +A+P ++  ++ C +KIK ++NLL KL   I+NP + +L+  L   L  I    S     +   V  PLL+ D V  L   L       W S G++W + R +W    +   Y P+F +G++  ++         E +    I  ++ + R+++ N++     S       ALP +           SS         T    K  +++  F A    ELS+ + E++EV+E    + WW   +  GQ GY P  +L          PF   +++   +    P SP +   +  P+ P +   + Q M +            +N+EL +KI+        N RA   R   V   +     +  +S  ++V+ WLE K FSP  +E L I  G  LF L+++E+ ++   E   R+ S + +QK+       S  EL+E++ K
Sbjct:  238 RESQEEPRAV-LAQKIEKETQILNCALDDIEWFVARLQKAAEA--------FKQLNQRKKGKKKGKKAPAEGVLTLRARPPSEGEFIDCFQKIKLAINLLAKLQKHIQNPSAAELVHFLFGPLDLIVNTCSGPDIAR--SVSCPLLSRDAVDFLRGHLVPKEMSLWESLGESWMRPRSEWPREPQVPLYVPKFHSGWEPPVDVLQEAPWEVEGLASAPIEEVSPVSRQSIRNSQKHSPTSEPTPPGDALPPV-----------SSPHTHRGYQPTPAMAKYVKILYDFTARNANELSVLKDEVLEVLED--GRQWWKLRSRSGQAGYVPCNILGEARPEDAGAPF---EQAGQKYW--GPASPTH---KLPPSFPGNKDELMQHMDE------------VNDELIRKIS--------NIRAQPQRHFRVERSQPVSQPLTYESGPDEVRAWLEAKAFSPRIVENLGILTGPQLFSLNKEELKKVCGEE-GVRVYSQLTMQKAFLE-KQQSGSELEELMNK 703          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Human
Match: EPS8L2 (EPS8 like 2 [Source:HGNC Symbol;Acc:HGNC:21296])

HSP 1 Score: 117.857 bits (294), Expect = 1.387e-26
Identity = 131/520 (25.19%), Postives = 223/520 (42.88%), Query Frame = 2
Query:  605 KEYDSKPRNDDISSRTERNLLLLNYCFDDIEFFLQHLKDQEEAQAILKNTKGKNLNDR--------------LLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQAYSIYHNGKLSKVKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWAGYKEK--YYPEFFNGYQIDLE---------ELMKDGIISPIADIPRRAVSNAE----ISHAIFYNQALPMIAQTDILENTVLSSREEDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLL---------EPFCYIDRSINNFIKSSPESPDYLNVRNIPTVPVSPKRISQIMKDPNSADKVAEANIINEELKKKINTNSNFGGWNSRASFARPGPVVSKKHGQLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKSLSGFGTLSRRELDEILTK 2050
            +E   +PR   ++ + E+   +LN   DDIE+F+  L+   EA         K LN R              +L  +A+P ++  ++ C +KIK ++NLL KL   I+NP + +L+  L   L  I    S     +   V  PLL+ D V  L   L       W S G++W + R +W    +   Y P+F +G++  ++         E +    I  ++ + R+++ N++     S       ALP +           SS         T    K  +++  F A    ELS+ + E++EV+E    + WW   +  GQ GY P  +L          PF   +++   +    P SP +   +  P+ P +   + Q M +            +N+EL +KI+        N RA   R   V   +     +  +S  ++V+ WLE K FSP  +E L I  G  LF L+++E+ ++   E   R+ S + +QK+       S  EL+E++ K
Sbjct:  238 RESQEEPRAV-LAQKIEKETQILNCALDDIEWFVARLQKAAEA--------FKQLNQRKKGKKKGKKAPAEGVLTLRARPPSEGEFIDCFQKIKLAINLLAKLQKHIQNPSAAELVHFLFGPLDLIVNTCSGPDIAR--SVSCPLLSRDAVDFLRGHLVPKEMSLWESLGESWMRPRSEWPREPQVPLYVPKFHSGWEPPVDVLQEAPWEVEGLASAPIEEVSPVSRQSIRNSQKHSPTSEPTPPGDALPPV-----------SSPHTHRGYQPTPAMAKYVKILYDFTARNANELSVLKDEVLEVLED--GRQWWKLRSRSGQAGYVPCNILGEARPEDAGAPF---EQAGQKYW--GPASPTH---KLPPSFPGNKDELMQHMDE------------VNDELIRKIS--------NIRAQPQRHFRVERSQPVSQPLTYESGPDEVRAWLEAKAFSPRIVENLGILTGPQLFSLNKEELKKVCGEE-GVRVYSQLTMQKAFLE-KQQSGSELEELMNK 703          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Celegans
Match: eps-8 (EPS (Human endocytosis) related [Source:UniProtKB/TrEMBL;Acc:Q7YTG1])

HSP 1 Score: 72.4034 bits (176), Expect = 9.026e-13
Identity = 92/371 (24.80%), Postives = 150/371 (40.43%), Query Frame = 2
Query:  122 VARHFG-SFMQTGTGKDSTNKALNELCSQIDDGRFRELQCNIEIDRERQVLVIRRWLDQVILEEFKLALITNVASHQQVPDNNYLSNILTFNT-QIKTSSNVLTETHIFQ-----LEDSNLHMVNYLASDIRSAIESATNLNPKNTPIKVLPSNNKRNSYSNEKMNKVKEYDSKPRND-DISSRT----ERNLLLLNYCFDDIEFFLQHLKDQEEAQAIL--KNTKGKNLNDR------------LLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQA--YSIYHNGKLSKVKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWA-GYKEKYYPEFFNGY 1147
            V R FG +F   G  K    +  + + +Q    RFR     +E D            +  ++E+F L LI    +H         +N+L F   + +   +  TE HIFQ       D    + NY+    R                     N +R +       + ++    P +D  ISS T    ER++  LN CFDDIE F+  ++    AQ  +  +N + +  N R            +L  +A+   ++ ++  ++K K S NLL KL   I  P++ +L+  L   L  I +A  + +  N   + V  PLL+ +  +L+  CL+ H    W S G+ W    E W       Y P F +G+
Sbjct:   41 VGRQFGLTFPADGIRKLKQMEKNSAIWAQPLILRFRHNAVTVEDD------------NGELVEQFPLELIEQPTAHVSNDSRETYNNVLLFVVREDRKRMSTPTEMHIFQCIRVSATDVAEDLKNYVQGQFRRV------------------RNGRRTAAPTHLQAQQQQMPFYPPDDASISSETSEMFERDVNTLNRCFDDIERFVARIQSAALAQREIEQQNHRYRTANRRDKKNQQPPDPNGILFMRAQLPLESEFVDILKKFKLSFNLLAKLKNHIHEPNAPELLHFLFTPLAVILEACHWGLGRNVAPT-VASPLLSLEARELMQNCLTSHESDIWMSLGEAWRTPPEDWTKPLPPPYRPIFNDGF 380          

HSP 2 Score: 60.077 bits (144), Expect = 5.229e-9
Identity = 35/93 (37.63%), Postives = 53/93 (56.99%), Query Frame = 2
Query: 1796 QLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKSLSGFGTLSRRELDEILTKRKEKVEIT 2074
            +++IN+ S+ EDV +WL+ K FSP  I+ L   +G  LF LS+  + +    +    L S + VQK  SGF T +  EL  IL  R+  VE++
Sbjct:  762 RVAINEKSSPEDVTRWLQEKGFSPRVIDLLDGQDGANLFSLSKLHLQQACGRDEGGYLYSQLLVQKKRSGFRTHTGDELKAILNHRRTHVELS 854          

HSP 3 Score: 55.8398 bits (133), Expect = 1.021e-7
Identity = 28/75 (37.33%), Postives = 42/75 (56.00%), Query Frame = 2
Query: 1307 SSREEDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLLE--PF 1525
            S R++ F   +  + GKL  V         +EL++ +GE +EVI    ++NWW C NMH + GY P+T+L   PF
Sbjct:  544 SPRQQAFIDDIVAKGGKLAVVTYDRGGQNTKELTVHKGEYLEVIFD--ERNWWECKNMHQRVGYVPHTILSMVPF 616          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Celegans
Match: eps-8 (EPS (Human endocytosis) related [Source:UniProtKB/TrEMBL;Acc:Q7YTG1])

HSP 1 Score: 72.4034 bits (176), Expect = 9.026e-13
Identity = 92/371 (24.80%), Postives = 150/371 (40.43%), Query Frame = 2
Query:  122 VARHFG-SFMQTGTGKDSTNKALNELCSQIDDGRFRELQCNIEIDRERQVLVIRRWLDQVILEEFKLALITNVASHQQVPDNNYLSNILTFNT-QIKTSSNVLTETHIFQ-----LEDSNLHMVNYLASDIRSAIESATNLNPKNTPIKVLPSNNKRNSYSNEKMNKVKEYDSKPRND-DISSRT----ERNLLLLNYCFDDIEFFLQHLKDQEEAQAIL--KNTKGKNLNDR------------LLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQA--YSIYHNGKLSKVKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWA-GYKEKYYPEFFNGY 1147
            V R FG +F   G  K    +  + + +Q    RFR     +E D            +  ++E+F L LI    +H         +N+L F   + +   +  TE HIFQ       D    + NY+    R                     N +R +       + ++    P +D  ISS T    ER++  LN CFDDIE F+  ++    AQ  +  +N + +  N R            +L  +A+   ++ ++  ++K K S NLL KL   I  P++ +L+  L   L  I +A  + +  N   + V  PLL+ +  +L+  CL+ H    W S G+ W    E W       Y P F +G+
Sbjct:   41 VGRQFGLTFPADGIRKLKQMEKNSAIWAQPLILRFRHNAVTVEDD------------NGELVEQFPLELIEQPTAHVSNDSRETYNNVLLFVVREDRKRMSTPTEMHIFQCIRVSATDVAEDLKNYVQGQFRRV------------------RNGRRTAAPTHLQAQQQQMPFYPPDDASISSETSEMFERDVNTLNRCFDDIERFVARIQSAALAQREIEQQNHRYRTANRRDKKNQQPPDPNGILFMRAQLPLESEFVDILKKFKLSFNLLAKLKNHIHEPNAPELLHFLFTPLAVILEACHWGLGRNVAPT-VASPLLSLEARELMQNCLTSHESDIWMSLGEAWRTPPEDWTKPLPPPYRPIFNDGF 380          

HSP 2 Score: 60.077 bits (144), Expect = 5.229e-9
Identity = 35/93 (37.63%), Postives = 53/93 (56.99%), Query Frame = 2
Query: 1796 QLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKSLSGFGTLSRRELDEILTKRKEKVEIT 2074
            +++IN+ S+ EDV +WL+ K FSP  I+ L   +G  LF LS+  + +    +    L S + VQK  SGF T +  EL  IL  R+  VE++
Sbjct:  762 RVAINEKSSPEDVTRWLQEKGFSPRVIDLLDGQDGANLFSLSKLHLQQACGRDEGGYLYSQLLVQKKRSGFRTHTGDELKAILNHRRTHVELS 854          

HSP 3 Score: 55.8398 bits (133), Expect = 1.021e-7
Identity = 28/75 (37.33%), Postives = 42/75 (56.00%), Query Frame = 2
Query: 1307 SSREEDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLLE--PF 1525
            S R++ F   +  + GKL  V         +EL++ +GE +EVI    ++NWW C NMH + GY P+T+L   PF
Sbjct:  544 SPRQQAFIDDIVAKGGKLAVVTYDRGGQNTKELTVHKGEYLEVIFD--ERNWWECKNMHQRVGYVPHTILSMVPF 616          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Celegans
Match: eps-8 (EPS (Human endocytosis) related [Source:UniProtKB/TrEMBL;Acc:Q7YTG1])

HSP 1 Score: 72.4034 bits (176), Expect = 9.026e-13
Identity = 92/371 (24.80%), Postives = 150/371 (40.43%), Query Frame = 2
Query:  122 VARHFG-SFMQTGTGKDSTNKALNELCSQIDDGRFRELQCNIEIDRERQVLVIRRWLDQVILEEFKLALITNVASHQQVPDNNYLSNILTFNT-QIKTSSNVLTETHIFQ-----LEDSNLHMVNYLASDIRSAIESATNLNPKNTPIKVLPSNNKRNSYSNEKMNKVKEYDSKPRND-DISSRT----ERNLLLLNYCFDDIEFFLQHLKDQEEAQAIL--KNTKGKNLNDR------------LLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQA--YSIYHNGKLSKVKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWA-GYKEKYYPEFFNGY 1147
            V R FG +F   G  K    +  + + +Q    RFR     +E D            +  ++E+F L LI    +H         +N+L F   + +   +  TE HIFQ       D    + NY+    R                     N +R +       + ++    P +D  ISS T    ER++  LN CFDDIE F+  ++    AQ  +  +N + +  N R            +L  +A+   ++ ++  ++K K S NLL KL   I  P++ +L+  L   L  I +A  + +  N   + V  PLL+ +  +L+  CL+ H    W S G+ W    E W       Y P F +G+
Sbjct:   41 VGRQFGLTFPADGIRKLKQMEKNSAIWAQPLILRFRHNAVTVEDD------------NGELVEQFPLELIEQPTAHVSNDSRETYNNVLLFVVREDRKRMSTPTEMHIFQCIRVSATDVAEDLKNYVQGQFRRV------------------RNGRRTAAPTHLQAQQQQMPFYPPDDASISSETSEMFERDVNTLNRCFDDIERFVARIQSAALAQREIEQQNHRYRTANRRDKKNQQPPDPNGILFMRAQLPLESEFVDILKKFKLSFNLLAKLKNHIHEPNAPELLHFLFTPLAVILEACHWGLGRNVAPT-VASPLLSLEARELMQNCLTSHESDIWMSLGEAWRTPPEDWTKPLPPPYRPIFNDGF 380          

HSP 2 Score: 60.077 bits (144), Expect = 5.229e-9
Identity = 35/93 (37.63%), Postives = 53/93 (56.99%), Query Frame = 2
Query: 1796 QLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKSLSGFGTLSRRELDEILTKRKEKVEIT 2074
            +++IN+ S+ EDV +WL+ K FSP  I+ L   +G  LF LS+  + +    +    L S + VQK  SGF T +  EL  IL  R+  VE++
Sbjct:  762 RVAINEKSSPEDVTRWLQEKGFSPRVIDLLDGQDGANLFSLSKLHLQQACGRDEGGYLYSQLLVQKKRSGFRTHTGDELKAILNHRRTHVELS 854          

HSP 3 Score: 55.8398 bits (133), Expect = 1.021e-7
Identity = 28/75 (37.33%), Postives = 42/75 (56.00%), Query Frame = 2
Query: 1307 SSREEDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLLE--PF 1525
            S R++ F   +  + GKL  V         +EL++ +GE +EVI    ++NWW C NMH + GY P+T+L   PF
Sbjct:  544 SPRQQAFIDDIVAKGGKLAVVTYDRGGQNTKELTVHKGEYLEVIFD--ERNWWECKNMHQRVGYVPHTILSMVPF 616          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Celegans
Match: eps-8 (EPS (Human endocytosis) related [Source:UniProtKB/TrEMBL;Acc:Q7YTG1])

HSP 1 Score: 72.4034 bits (176), Expect = 9.026e-13
Identity = 92/371 (24.80%), Postives = 150/371 (40.43%), Query Frame = 2
Query:  122 VARHFG-SFMQTGTGKDSTNKALNELCSQIDDGRFRELQCNIEIDRERQVLVIRRWLDQVILEEFKLALITNVASHQQVPDNNYLSNILTFNT-QIKTSSNVLTETHIFQ-----LEDSNLHMVNYLASDIRSAIESATNLNPKNTPIKVLPSNNKRNSYSNEKMNKVKEYDSKPRND-DISSRT----ERNLLLLNYCFDDIEFFLQHLKDQEEAQAIL--KNTKGKNLNDR------------LLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQA--YSIYHNGKLSKVKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWA-GYKEKYYPEFFNGY 1147
            V R FG +F   G  K    +  + + +Q    RFR     +E D            +  ++E+F L LI    +H         +N+L F   + +   +  TE HIFQ       D    + NY+    R                     N +R +       + ++    P +D  ISS T    ER++  LN CFDDIE F+  ++    AQ  +  +N + +  N R            +L  +A+   ++ ++  ++K K S NLL KL   I  P++ +L+  L   L  I +A  + +  N   + V  PLL+ +  +L+  CL+ H    W S G+ W    E W       Y P F +G+
Sbjct:   41 VGRQFGLTFPADGIRKLKQMEKNSAIWAQPLILRFRHNAVTVEDD------------NGELVEQFPLELIEQPTAHVSNDSRETYNNVLLFVVREDRKRMSTPTEMHIFQCIRVSATDVAEDLKNYVQGQFRRV------------------RNGRRTAAPTHLQAQQQQMPFYPPDDASISSETSEMFERDVNTLNRCFDDIERFVARIQSAALAQREIEQQNHRYRTANRRDKKNQQPPDPNGILFMRAQLPLESEFVDILKKFKLSFNLLAKLKNHIHEPNAPELLHFLFTPLAVILEACHWGLGRNVAPT-VASPLLSLEARELMQNCLTSHESDIWMSLGEAWRTPPEDWTKPLPPPYRPIFNDGF 380          

HSP 2 Score: 60.077 bits (144), Expect = 5.229e-9
Identity = 35/93 (37.63%), Postives = 53/93 (56.99%), Query Frame = 2
Query: 1796 QLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKSLSGFGTLSRRELDEILTKRKEKVEIT 2074
            +++IN+ S+ EDV +WL+ K FSP  I+ L   +G  LF LS+  + +    +    L S + VQK  SGF T +  EL  IL  R+  VE++
Sbjct:  762 RVAINEKSSPEDVTRWLQEKGFSPRVIDLLDGQDGANLFSLSKLHLQQACGRDEGGYLYSQLLVQKKRSGFRTHTGDELKAILNHRRTHVELS 854          

HSP 3 Score: 55.8398 bits (133), Expect = 1.021e-7
Identity = 28/75 (37.33%), Postives = 42/75 (56.00%), Query Frame = 2
Query: 1307 SSREEDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLLE--PF 1525
            S R++ F   +  + GKL  V         +EL++ +GE +EVI    ++NWW C NMH + GY P+T+L   PF
Sbjct:  544 SPRQQAFIDDIVAKGGKLAVVTYDRGGQNTKELTVHKGEYLEVIFD--ERNWWECKNMHQRVGYVPHTILSMVPF 616          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Celegans
Match: eps-8 (EPS (Human endocytosis) related [Source:UniProtKB/TrEMBL;Acc:Q7YTG1])

HSP 1 Score: 72.4034 bits (176), Expect = 9.026e-13
Identity = 92/371 (24.80%), Postives = 150/371 (40.43%), Query Frame = 2
Query:  122 VARHFG-SFMQTGTGKDSTNKALNELCSQIDDGRFRELQCNIEIDRERQVLVIRRWLDQVILEEFKLALITNVASHQQVPDNNYLSNILTFNT-QIKTSSNVLTETHIFQ-----LEDSNLHMVNYLASDIRSAIESATNLNPKNTPIKVLPSNNKRNSYSNEKMNKVKEYDSKPRND-DISSRT----ERNLLLLNYCFDDIEFFLQHLKDQEEAQAIL--KNTKGKNLNDR------------LLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQA--YSIYHNGKLSKVKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWA-GYKEKYYPEFFNGY 1147
            V R FG +F   G  K    +  + + +Q    RFR     +E D            +  ++E+F L LI    +H         +N+L F   + +   +  TE HIFQ       D    + NY+    R                     N +R +       + ++    P +D  ISS T    ER++  LN CFDDIE F+  ++    AQ  +  +N + +  N R            +L  +A+   ++ ++  ++K K S NLL KL   I  P++ +L+  L   L  I +A  + +  N   + V  PLL+ +  +L+  CL+ H    W S G+ W    E W       Y P F +G+
Sbjct:   41 VGRQFGLTFPADGIRKLKQMEKNSAIWAQPLILRFRHNAVTVEDD------------NGELVEQFPLELIEQPTAHVSNDSRETYNNVLLFVVREDRKRMSTPTEMHIFQCIRVSATDVAEDLKNYVQGQFRRV------------------RNGRRTAAPTHLQAQQQQMPFYPPDDASISSETSEMFERDVNTLNRCFDDIERFVARIQSAALAQREIEQQNHRYRTANRRDKKNQQPPDPNGILFMRAQLPLESEFVDILKKFKLSFNLLAKLKNHIHEPNAPELLHFLFTPLAVILEACHWGLGRNVAPT-VASPLLSLEARELMQNCLTSHESDIWMSLGEAWRTPPEDWTKPLPPPYRPIFNDGF 380          

HSP 2 Score: 60.077 bits (144), Expect = 5.229e-9
Identity = 35/93 (37.63%), Postives = 53/93 (56.99%), Query Frame = 2
Query: 1796 QLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKSLSGFGTLSRRELDEILTKRKEKVEIT 2074
            +++IN+ S+ EDV +WL+ K FSP  I+ L   +G  LF LS+  + +    +    L S + VQK  SGF T +  EL  IL  R+  VE++
Sbjct:  762 RVAINEKSSPEDVTRWLQEKGFSPRVIDLLDGQDGANLFSLSKLHLQQACGRDEGGYLYSQLLVQKKRSGFRTHTGDELKAILNHRRTHVELS 854          

HSP 3 Score: 55.8398 bits (133), Expect = 1.021e-7
Identity = 28/75 (37.33%), Postives = 42/75 (56.00%), Query Frame = 2
Query: 1307 SSREEDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLLE--PF 1525
            S R++ F   +  + GKL  V         +EL++ +GE +EVI    ++NWW C NMH + GY P+T+L   PF
Sbjct:  544 SPRQQAFIDDIVAKGGKLAVVTYDRGGQNTKELTVHKGEYLEVIFD--ERNWWECKNMHQRVGYVPHTILSMVPF 616          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Fly
Match: CG8907 (gene:FBgn0038466 transcript:FBtr0305271)

HSP 1 Score: 99.3673 bits (246), Expect = 4.647e-21
Identity = 99/416 (23.80%), Postives = 189/416 (45.43%), Query Frame = 2
Query:  302 LEEFKLALITNVASHQQVPDNNYLSNILTFNTQIKTSSNVLTETHIFQLEDSNLHMVNYLASDIRSAIE-SATNLNPKNTPIKVLPSNNKRNSYSNEKMNKVKEYDSKP--RNDDISSRTERNLLLLNYCFDDIEFFLQHLKDQEEAQAILKNTKGKN--LNDRLLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQAYSIYHNGKLSK-VKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWAGYKEKYYPEFFNGYQIDLEELMKDGIISPIADIPRRAVSNAEISHAIFYNQALPMIAQTDILENTVLSSREEDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLLEPFCY 1531
            +E F  +LIT   +          +NIL F+    +  N  TE HIFQ+ D +  +   L  D+++  + +   ++   TPI +      +N  + ++             +N     +TER++ ++N+CF+DIE F+  L    EA   LK  K ++    + LL  +++P  ++ +   + K K +L    +L  +   P +  +  + I     +     IY +  L + V  PLL  +T+  L+  L  +  + W S G NW   ++++  +K  Y+P F++ +  D    + D  +  +A   +++ + + +   +  +           L N    SR E        RN K+  V    +A+ D+EL +++GE +E+I+    +NWW   N +G  GY P+T+L P+ +
Sbjct:  106 IENFPGSLITEPTAFISDHPQESFNNILIFSVPGISLGN--TEMHIFQVADVSSVL---LVEDLKTLSKGTPVTVDRNKTPILLPKPERPQNQQAKDQYGIAAAVAGIAAEKNAIDKEQTERDVQVINHCFEDIERFMARLHYAAEALNELKLRKEQHNPHGEGLLVLRSRPPIESEFHDILAKAKLALIYSVRLQNQFTKP-ADPVHNVFISLKSIVTVCNDIYVDAGLPQAVLNPLLRRETIAFLNGTLDSNEMQLWQSLGPNWTVPKDQFKDHKSSYHPIFYDDWSPD---WVVDEEVPYLAPALKKSTTPSPVPVPMPPSPG---------LGNRTWLSRLES-------RNVKIAEVTFNKSATNDKELKVTKGEYLEIIDD--SRNWWKARNSYGNIGYVPHTVLTPYNF 494          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Fly
Match: CG8907 (gene:FBgn0038466 transcript:FBtr0083372)

HSP 1 Score: 98.9821 bits (245), Expect = 4.761e-21
Identity = 99/416 (23.80%), Postives = 191/416 (45.91%), Query Frame = 2
Query:  302 LEEFKLALITNVASHQQVPDNNYLSNILTFNTQIKTSSNVLTETHIFQLEDSNLHMVNYLASDIRSAIE-SATNLNPKNTPIKVLPSNNKRNSYSNEK--MNKVKEYDSKPRNDDISSRTERNLLLLNYCFDDIEFFLQHLKDQEEAQAILKNTKGKN--LNDRLLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQAYSIYHNGKLSK-VKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWAGYKEKYYPEFFNGYQIDLEELMKDGIISPIADIPRRAVSNAEISHAIFYNQALPMIAQTDILENTVLSSREEDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLLEPFCY 1531
            +E F  +LIT   +          +NIL F+    +  N  TE HIFQ+ D +  +   L  D+++  + +   ++   TPI +      +N  + ++  +       +  +N     +TER++ ++N+CF+DIE F+  L    EA   LK  K ++    + LL  +++P  ++ +   + K K +L    +L  +   P +  +  + I     +     IY +  L + V  PLL  +T+  L+  L  +  + W S G NW   ++++  +K  Y+P F++ +  D    + D  +  +A   +++ + + +   +  +           L N    SR E        RN K+  V    +A+ D+EL +++GE +E+I+    +NWW   N +G  GY P+T+L P+ +
Sbjct:   86 IENFPGSLITEPTAFISDHPQESFNNILIFSVPGISLGN--TEMHIFQVADVSSVL---LVEDLKTLSKGTPVTVDRNKTPILLPKPERPQNQQAKDQYGIAAAVAGIAAEKNAIDKEQTERDVQVINHCFEDIERFMARLHYAAEALNELKLRKEQHNPHGEGLLVLRSRPPIESEFHDILAKAKLALIYSVRLQNQFTKP-ADPVHNVFISLKSIVTVCNDIYVDAGLPQAVLNPLLRRETIAFLNGTLDSNEMQLWQSLGPNWTVPKDQFKDHKSSYHPIFYDDWSPD---WVVDEEVPYLAPALKKSTTPSPVPVPMPPSPG---------LGNRTWLSRLES-------RNVKIAEVTFNKSATNDKELKVTKGEYLEIIDD--SRNWWKARNSYGNIGYVPHTVLTPYNF 474          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Fly
Match: aru (gene:FBgn0029095 transcript:FBtr0078033)

HSP 1 Score: 84.3445 bits (207), Expect = 1.958e-16
Identity = 56/180 (31.11%), Postives = 92/180 (51.11%), Query Frame = 2
Query:  641 SSRTERNLLLLNYCFDDIEFFLQHLKDQEEAQAILKNTKGK------NLNDRLLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQAYS-IYHNGKL-SKVKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWAGYKEKYYPEFFNGYQID 1156
            S + ER++ +LN+CFDDIE F+  L+    A   L+  +        +  + LL  + +P  +  ++    K K S NLL KL   I +P++ +L+  L   L  I +A S  Y+  +L ++V  PLLT + + LL  C++    + W S GD W   R++W      Y+P F +G+  D
Sbjct:  328 SEKYERDVAVLNHCFDDIEKFIARLQHAAAASRELERRRRNRKSKKRDPGEGLLTLRTRPPHEKEFVDIFAKFKLSFNLLAKLKAHIHDPNAPELVHFLFTPLALIVEASSDTYYESQLPARVVNPLLTREAINLLINCVTSKETELWRSLGDAWVIPRDQWKDDVGSYHPVFLDGWSPD 507          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Fly
Match: aru (gene:FBgn0029095 transcript:FBtr0078032)

HSP 1 Score: 84.3445 bits (207), Expect = 2.188e-16
Identity = 56/180 (31.11%), Postives = 92/180 (51.11%), Query Frame = 2
Query:  641 SSRTERNLLLLNYCFDDIEFFLQHLKDQEEAQAILKNTKGK------NLNDRLLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQAYS-IYHNGKL-SKVKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWAGYKEKYYPEFFNGYQID 1156
            S + ER++ +LN+CFDDIE F+  L+    A   L+  +        +  + LL  + +P  +  ++    K K S NLL KL   I +P++ +L+  L   L  I +A S  Y+  +L ++V  PLLT + + LL  C++    + W S GD W   R++W      Y+P F +G+  D
Sbjct:  301 SEKYERDVAVLNHCFDDIEKFIARLQHAAAASRELERRRRNRKSKKRDPGEGLLTLRTRPPHEKEFVDIFAKFKLSFNLLAKLKAHIHDPNAPELVHFLFTPLALIVEASSDTYYESQLPARVVNPLLTREAINLLINCVTSKETELWRSLGDAWVIPRDQWKDDVGSYHPVFLDGWSPD 480          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Fly
Match: aru (gene:FBgn0029095 transcript:FBtr0078031)

HSP 1 Score: 84.3445 bits (207), Expect = 2.188e-16
Identity = 56/180 (31.11%), Postives = 92/180 (51.11%), Query Frame = 2
Query:  641 SSRTERNLLLLNYCFDDIEFFLQHLKDQEEAQAILKNTKGK------NLNDRLLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQAYS-IYHNGKL-SKVKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWAGYKEKYYPEFFNGYQID 1156
            S + ER++ +LN+CFDDIE F+  L+    A   L+  +        +  + LL  + +P  +  ++    K K S NLL KL   I +P++ +L+  L   L  I +A S  Y+  +L ++V  PLLT + + LL  C++    + W S GD W   R++W      Y+P F +G+  D
Sbjct:  301 SEKYERDVAVLNHCFDDIEKFIARLQHAAAASRELERRRRNRKSKKRDPGEGLLTLRTRPPHEKEFVDIFAKFKLSFNLLAKLKAHIHDPNAPELVHFLFTPLALIVEASSDTYYESQLPARVVNPLLTREAINLLINCVTSKETELWRSLGDAWVIPRDQWKDDVGSYHPVFLDGWSPD 480          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Zebrafish
Match: eps8l1b (eps8 like 1b [Source:ZFIN;Acc:ZDB-GENE-050506-143])

HSP 1 Score: 156.762 bits (395), Expect = 2.626e-40
Identity = 129/482 (26.76%), Postives = 222/482 (46.06%), Query Frame = 2
Query:  668 LLNYCFDDIEFFLQHLKDQEEAQAILKN-------TKGKNLNDRLLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQAYSIYHNGKLSKVKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWAGYKEKYYPEFFNGYQIDLEELMKDGIISPIADIPRR--AVSNAEISHAIFYNQALPMIAQTDILENTVLSSREEDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLLEPFCYIDRSINNFIKSSPESPDYLNV----RNIPTVPVSPKRISQIMKD-PNSADKVAEANIINEELKKKINTNSNFGGWNSRASFARPGPVVSKKHGQLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKSLSGFGTLSRRELDEILTKRKEKVEI 2071
            +LN+CFDDIE F+  L+   EAQ IL          + K+ ++ LL  KAKP ++  ++   +K K+ L LL +L   I NP + +L+  + + L  + +A      G  + V  P +TE  V LL   L+   +  W S G NW   R         Y  +F +G++    +    G I PI    +    ++  E++ A    +    +  +D  + +V               NG+++R    F A  + ELS+ +GE +E IES   K WW C N   + G+ P  +LEP  +ID  + N     P +P   N       + + P + +  S I+   P   DKV +   +N+EL +++ +  N    + R    R             ++ +S   +V+ WL  K FS   ++ L++ NG  LF L+++E+  ++  E A R+ S + VQ++       +  EL+ ++ K+K KV++
Sbjct:   52 ILNHCFDDIEAFIGKLQQSAEAQIILDQRSKKKKKNQKKSADEDLLTAKAKPPSEREFIDTFQKFKYCLGLLARLKPAISNPSAEELVHHVFKPLDMMVKATG--GPGFAASVSSPAMTEGAVNLLKNNLTTQENALWLSLGPNWTHQRSALRSPVAPYTLQFQDGWKPQGSDAA--GWIDPIESEHKHDAEIAKVELTPAPASERHASPVQTSDQPDGSV---------------NGRIFRCSYDFVARNNSELSVLQGETLEAIESS--KRWWKCRNKFDEVGFVPFNILEPITHIDNPVQNRTPKPPAAPPMYNTLPSSSAVSSEPGAARPRSMIIPSGPEDTDKVMQ---VNDELLQRLTSGKNL---SPRLVIHR------SADTSAPLDYNSPPAEVENWLRKKGFSEPTVQCLRVLNGAQLFSLNKEELRAVIPEEGA-RVYSQLTVQRAQIEDAHRA-SELETVMEKQKMKVDL 498          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Zebrafish
Match: eps8l1a (eps8 like 1a [Source:ZFIN;Acc:ZDB-GENE-050306-14])

HSP 1 Score: 155.992 bits (393), Expect = 5.511e-40
Identity = 148/550 (26.91%), Postives = 244/550 (44.36%), Query Frame = 2
Query:  509 SATNLNPKNTP--IKVLPSNNKRNSYSNEKMNKVKEYDSKPRNDDISSRTERNLLLLNYCFDDIEFFLQHLKDQEEAQAILKNTKGKNL--------------NDRLLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQAYSIYHNGKL-SKVKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWAGYKEKYYPEFFNGYQIDLEELMKDGIISPIADIPRRAVSNAEISHAIFYNQALPMIAQTDILENTVLSSREE-DFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLLEPFCYIDRSINNFI-----KSSPESPDYLNVRNIPTVPVSPKRISQIMKDPNS------ADKVAEANIINEELKKKINTNSNFGGWNSRASFARPGPVVSKKHGQLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKSLSGFGTLSRRELDEILTKRKEKVEI 2071
            +A  + P++ P  IKVLP+N      S   ++ +   D    N  +    +R + L+N+CF D+E F+  L+   EA+ I +  K                  +D     K  P ++  ++   +KIK+S  LL +L  KI  P S +L+  +   L  + +        KL S +  P LT   + LL   L++     WTS G NW     + +    +Y P F +G+Q     +  D    PI D         E+ H    ++AL  I    +++   L+  +E D    +     ++YR    F A    ELS+  GE +EV+ES   K WW C N +GQ G+ P+ +LEP  + +    N +       +P SP    +R       +PK  S +  DP        AD   +  ++N+EL +++         N RA+  RP  +       + ++  S   +VQ+WL+ K F+   ++ L + NG  LF L+++E+ R V  E   R+ S + VQKSL         EL+ I+ K+K K ++
Sbjct:    2 AAPAVVPRSRPKSIKVLPTNGTAADLSPIGVHAMNGGDRVKTNTHLI-YAQREVELVNHCFADVEHFMARLQQTAEAKNIQEQLKRSKKKSRKKNKTKKNKKEDDEPTPQKVTPPSEQEFVDIFQKIKYSFCLLDRLKMKISEPSSEELLHHVFVPLQLMVKTTG---GPKLASSISSPALTSGAISLLQHNLNEQEKTLWTSLGPNWTLPYSQLSETVPQYTPVFLDGWQ----PIAVDANGQPIED-------PIEVQHK---HEAL--IQTQQVIDQARLTVHQENDGMEPLPPNEERMYRCSYDFVARNSSELSVLHGESLEVLES--SKRWWKCKNSYGQTGFVPHNILEPINHAEVDSTNVVMRNQSTKAPISP----LRGGRMSYAAPKSESAVHPDPRPLSMPSFADDGEKVVLMNDELIQRLA--------NGRAASVRPMVINKANETTVPLDYHSPQAEVQEWLKAKGFNNITVQSLGVLNGAQLFSLNKEEL-RAVCPEEGARVYSQITVQKSLLE-DVRKATELEAIMKKQKMKADL 515          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Zebrafish
Match: eps8l1a (eps8 like 1a [Source:ZFIN;Acc:ZDB-GENE-050306-14])

HSP 1 Score: 155.221 bits (391), Expect = 1.097e-39
Identity = 148/550 (26.91%), Postives = 242/550 (44.00%), Query Frame = 2
Query:  509 SATNLNPKNTP--IKVLPSNNKRNSYSNEKMNKVKEYDSKPRNDDISSRTERNLLLLNYCFDDIEFFLQHLKDQEEAQAILKNTKGKNL--------------NDRLLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQAYSIYHNGKL-SKVKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWAGYKEKYYPEFFNGYQIDLEELMKDGIISPIADIPRRAVSNAEISHAIFYNQALPMIAQTDILENTVLSSREE-DFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLLEPFCYIDRSINNFI-----KSSPESPDYLNVRNIPTVPVSPKRISQIMKDPNS------ADKVAEANIINEELKKKINTNSNFGGWNSRASFARPGPVVSKKHGQLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKSLSGFGTLSRRELDEILTKRKEKVEI 2071
            +A  + P++ P  IKVLP+N      S   ++ +   D    N  +    +R + L+N+CF D+E F+  L+   EA+ I +  K                  +D     K  P ++  ++   +KIK+S  LL +L  KI  P S +L+  +   L  + +        KL S +  P LT   + LL   L++     WTS G NW     + +    +Y P F +G+Q     +  D    PI D         E+ H    ++A   I    +++   L+  +E D          ++YR    F A    ELS+  GE +EV+ES   K WW C N +GQ G+ P+ +LEP  + +    N +       +P SP    +R       +PK  S I  DP        AD   +  ++N+EL +++         N RA+  RP  +       + ++  S   +VQ+WL+ K F+   ++ L + NG  LF L+++E+ R V  E   R+ S + VQKSL         EL+ I+ K+K K ++
Sbjct:    2 AAPAVIPRSRPKSIKVLPTNGTAADLSPIGVHAMNGGDRVKTNTHLI-HAQREVELVNHCFADVEHFMARLQQTAEAKNIQEQLKRSKKKSRKKNKTKKNKKEDDEPTPQKVTPPSEQEFVDIFQKIKYSFCLLDRLKMKISEPSSEELLHHVFVPLQLMVKTTG---GPKLASSISSPALTSGAISLLQHNLNEQEKTLWTSLGPNWTLPYSQLSETVPQYTPVFLDGWQ----PIAVDANGQPIED-------PIEVQHK---HEAF--IQTQQVIDQARLTVHQENDGMEPFPPNEERMYRCSYDFVARNSSELSVLHGESLEVLES--SKRWWKCKNSYGQTGFVPHNILEPINHAEVDSTNVVMRNQSTKAPISP----LRGGRMSYAAPKSESAIHPDPRPLSMPSFADDGEKVVLMNDELIQRLA--------NGRAASVRPMVINKANETTVPLDYHSPQAEVQEWLKAKGFNNITVQSLGVLNGAQLFSLNKEEL-RAVCPEEGARVYSQITVQKSLLE-DVRKATELEAIMKKQKMKADL 515          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Zebrafish
Match: eps8l2 (EPS8 like 2 [Source:ZFIN;Acc:ZDB-GENE-131121-340])

HSP 1 Score: 119.013 bits (297), Expect = 2.638e-27
Identity = 138/499 (27.66%), Postives = 217/499 (43.49%), Query Frame = 2
Query:  629 NDDISSRTERNLLLLNYCFDDIEFFLQHLKDQEEAQAIL------KNTKGKNLNDRLLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQAYSIYHNGKLSK-VKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWAGYK--EKYYPEFFNGYQIDLEELMKDGIISPIADIPRRAVSNAEISHAIFYNQALPMIAQTDILENTVLSSREEDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLL------EPFCYIDRSINNFIKSSPESPDYLNVRNIPTVPVSPKRISQIMKDPNSADKVAEANIINEELKKKINTNSNFGGWNSRASFARPGPVVSKKHGQLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKS-LSGFGTLSRRELDEILTKRKEKVEITE 2077
            N  ++ R E+++ +LN   DDIE F+  L    EA A L      K  K +   + +L  +AKP ++  ++ C++K+K S NLL KL   I+NP++ +LI  L   L  I Q+     +  L + V  P L+ D V  L   L+      +   GD W + R  W   +    Y P+F NG++  +E        +    +P+  V +   S   F               +    S    +  S   R  K  ++   F A    ELS+ + EI+EV+E    K WW   N  GQ GY P  +L      +P   ID          P SP Y           SP       KD +    + + + +N+EL   I +N             R   VV +  G L+   +S+  +V  WL  K FS   +E+L I  G  LF L++D + + V  +  +R+ S + VQKS L     +S  EL+EI+ +++EK++ T+
Sbjct:  226 NMKLAQRIEKDVQILNCSLDDIEIFVARLHKAAEAFAQLNQRNRSKKNKKRGPAEGMLTLRAKPPSEVEFVDCLQKLKLSFNLLAKLKKHIQNPNASELIHFLFGPLELILQSSG---SPDLPRAVISPHLSRDAVDFLRGHLTPKEMTIFELLGDGWTRPRADWPKDQCAPLYVPKFRNGWEPPVELFRTSPWETESIGMPKSPVQSEYRSKEFF--------------GSQSSPSSNGSYPPSPAPR--KYAKIRYHFVARNANELSVLQDEILEVLED--GKQWWKLRNRSGQAGYVPYNILDVIKLEDPQAMID---------PPYSPSYRG--------QSPSGSQGSDKDSH----LQQMDKVNDELLMLITSNKIHQP-------TRNFKVVRQSAGPLTF--ESSPAEVTSWLNAKGFSKPTVERLGILTGAQLFSLNKDHL-KAVCGDEGSRVYSQITVQKSQLEKSRGVS--ELEEIMIRQQEKIKSTK 670          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Zebrafish
Match: eps8l2 (EPS8 like 2 [Source:ZFIN;Acc:ZDB-GENE-131121-340])

HSP 1 Score: 119.013 bits (297), Expect = 2.938e-27
Identity = 138/499 (27.66%), Postives = 217/499 (43.49%), Query Frame = 2
Query:  629 NDDISSRTERNLLLLNYCFDDIEFFLQHLKDQEEAQAIL------KNTKGKNLNDRLLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQAYSIYHNGKLSK-VKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWAGYK--EKYYPEFFNGYQIDLEELMKDGIISPIADIPRRAVSNAEISHAIFYNQALPMIAQTDILENTVLSSREEDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLL------EPFCYIDRSINNFIKSSPESPDYLNVRNIPTVPVSPKRISQIMKDPNSADKVAEANIINEELKKKINTNSNFGGWNSRASFARPGPVVSKKHGQLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKS-LSGFGTLSRRELDEILTKRKEKVEITE 2077
            N  ++ R E+++ +LN   DDIE F+  L    EA A L      K  K +   + +L  +AKP ++  ++ C++K+K S NLL KL   I+NP++ +LI  L   L  I Q+     +  L + V  P L+ D V  L   L+      +   GD W + R  W   +    Y P+F NG++  +E        +    +P+  V +   S   F               +    S    +  S   R  K  ++   F A    ELS+ + EI+EV+E    K WW   N  GQ GY P  +L      +P   ID          P SP Y           SP       KD +    + + + +N+EL   I +N             R   VV +  G L+   +S+  +V  WL  K FS   +E+L I  G  LF L++D + + V  +  +R+ S + VQKS L     +S  EL+EI+ +++EK++ T+
Sbjct:  207 NMKLAQRIEKDVQILNCSLDDIEIFVARLHKAAEAFAQLNQRNRSKKNKKRGPAEGMLTLRAKPPSEVEFVDCLQKLKLSFNLLAKLKKHIQNPNASELIHFLFGPLELILQSSG---SPDLPRAVISPHLSRDAVDFLRGHLTPKEMTIFELLGDGWTRPRADWPKDQCAPLYVPKFRNGWEPPVELFRTSPWETESIGMPKSPVQSEYRSKEFF--------------GSQSSPSSNGSYPPSPAPR--KYAKIRYHFVARNANELSVLQDEILEVLED--GKQWWKLRNRSGQAGYVPYNILDVIKLEDPQAMID---------PPYSPSYRG--------QSPSGSQGSDKDSH----LQQMDKVNDELLMLITSNKIHQP-------TRNFKVVRQSAGPLTF--ESSPAEVTSWLNAKGFSKPTVERLGILTGAQLFSLNKDHL-KAVCGDEGSRVYSQITVQKSQLEKSRGVS--ELEEIMIRQQEKIKSTK 651          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Xenopus
Match: eps8 (epidermal growth factor receptor pathway substrate 8 [Source:NCBI gene;Acc:779963])

HSP 1 Score: 127.102 bits (318), Expect = 1.466e-29
Identity = 131/509 (25.74%), Postives = 224/509 (44.01%), Query Frame = 2
Query:  614 DSKPRNDDISSRTERNLLLLNYCFDDIEFFLQHLKDQEEAQAILKNTKGKNLNDR----LLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQAYSIYHNGKLSK-VKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWAG--YKEKYYPEFFNGYQIDLEELMKDGIISPIADIPRRAVSNAEISHAIFYNQALPMIAQTDILENTVLSSREEDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLLEPFCYIDRSINNFIKSSPESPDYLNVRNIPT----VPVSP-----KRISQIMKDPNSADKVAEANIINEELKKKINTNSNFGGWNSRASFARPGPVVSKKHGQLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKSL----SGFGTLSRRELDEILTKRKEKVEITET 2080
            DS P    + +R +R++ +LN+  DD+EFF+  L+   EA + L   K           +L  +A+P  Q  ++ C +K K  +NLL KL   I+NP + +L+  L   L  + +A        L++ V  PL+T+D++  L+  L+K   + WTS GD+W K R +W    +   Y P F NG++  L           ++ +     + AE+     +N    M +       +     E +F     +   +       F A    ELS+ + +++EV++ K  K WW   +  G  G+ PN +L      D+S      + P    Y +   +P+    +P SP      R SQ+                 EE++ ++      G   ++  F  P       H    I+  S +EDV+ WL+ K F+   ++ L +  G  LF L++DE+ + V  E   R+ + V VQK+     SG       EL EI+ KR+E++ +  +
Sbjct:  253 DSTPEM--LEARIDRDVQILNHILDDVEFFIMKLQKAAEAFSELSKRKKGKKKKGPGEGVLTLRARPPPQEEFVDCFQKFKHGINLLAKLKSHIQNPSASELVHFLFTPLHMMVEATG---GPDLARTVLSPLITKDSLDFLNFILNKEEKQLWTSLGDSWNKYRAEWPKEQFIPPYVPRFRNGWEPPLLGCAAAPKEQELSYLAESVANVAELQRKQEFNSVPNMYSHV-----SRYPPSEGNFEERDQVEAQRYALCKYDFVARNSNELSVLKDDVLEVLDDK--KQWWKVRSSSGAVGFVPNNILVAMKPQDQS------AKPMEAAYTHTIQVPSSAWVIPDSPCSFGVGRKSQM-----------------EEVQDELIHRLTIGRSAAQKKFTVPRLNAPAVH----ISHSSPAEDVKSWLQAKGFNSVTVDSLGVLTGAQLFSLTKDEL-KTVCPE-GPRVYNQVTVQKAAIEEQSGGS-----ELLEIMKKRQERINMAAS 715          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Xenopus
Match: EPS8L2 (EPS8-like 2 [Source:NCBI gene;Acc:100489749])

HSP 1 Score: 125.561 bits (314), Expect = 3.200e-29
Identity = 141/500 (28.20%), Postives = 218/500 (43.60%), Query Frame = 2
Query:  572 NSYSNEKMNKVKEYDSKPRNDDISSRTERNLLLLNYCFDDIEFFLQHLKDQEEAQAILKNTKGKNLNDR--------------LLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQAYSIYHNGKLSKVKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWAGYK--EKYYPEFFNGYQIDLEELMKDGIISPIADIPRRAVSNAEISHAIFYNQALPMIAQTDILENTVLSSREEDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLLEPFCYIDRSINNFIKSSPESPDYLNVRNIPTVPV--SPKRISQIMKDPNSADK---VAEANIINEELKKKINTNS----NFGGWNSRASFARPGPVVSKKHGQLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKS 1996
            N   +++ + V +   +PR + ++ + E++  +LN   DDIEFF+  L+   EA         K LN R              +L  ++KP T+  ++ C +KIK ++NLL KL   I+NP S +LI  L   L  I Q+      G+   +  PLL+ D    L   L+      W   GD W K R +W        Y P+F NG+ I   E+ +       A  P       E    I      P    + +L    L  R  ++   V  +  KL ++   F A    ELS+ + E++EV+E   +K WW   N  GQ+GY P  +L+    +    NN       SP  +     P+ PV   P   +      N ++K   +   + +N+EL KKI TN     NF     +A +             + +N  S  E+V+ WLE K FS     +L I NG  LF L+++E+ ++   E A R+ S + VQKS
Sbjct:  201 NDIEHDRRSNVSQEPEEPR-EVLAQKIEKDTQVLNCTLDDIEFFVAKLQKAAEA--------FKQLNQRKKGKKNKKKGHAEGMLTLRSKPPTEFEFVDCYQKIKLAINLLAKLKKHIQNPSSAELIHFLFGPLELIIQSSGGPELGR--SILAPLLSRDATDFLRGHLTPKEMAIWEVLGDRWTKCRAEWPREPPIPLYIPKFNNGW-IPPVEIFQGAPWETEAHPP-------EPKPRIQEEVRSPANGCSFLLTFFHLEVR--NYEAPVPAQPQKLAKIRYDFTARNANELSVLKDEVLEVLED--NKQWWKLRNRIGQEGYVPYNILD---IMSTEENNSRYREDMSPRGVG----PSSPVYKHPSTFAGDKWSTNPSNKEQLIHHMDEVNDELLKKITTNQPAKRNFKVDKPQAVY-------------VPLNYQSEPEEVKAWLEAKGFSKGTASQLGILNGAQLFSLNKEELRKVCGEEGA-RVYSQLAVQKS 656          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Xenopus
Match: EPS8L2 (EPS8-like 2 [Source:NCBI gene;Acc:100489749])

HSP 1 Score: 125.561 bits (314), Expect = 3.754e-29
Identity = 141/500 (28.20%), Postives = 218/500 (43.60%), Query Frame = 2
Query:  572 NSYSNEKMNKVKEYDSKPRNDDISSRTERNLLLLNYCFDDIEFFLQHLKDQEEAQAILKNTKGKNLNDR--------------LLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQAYSIYHNGKLSKVKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWAGYK--EKYYPEFFNGYQIDLEELMKDGIISPIADIPRRAVSNAEISHAIFYNQALPMIAQTDILENTVLSSREEDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLLEPFCYIDRSINNFIKSSPESPDYLNVRNIPTVPV--SPKRISQIMKDPNSADK---VAEANIINEELKKKINTNS----NFGGWNSRASFARPGPVVSKKHGQLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKS 1996
            N   +++ + V +   +PR + ++ + E++  +LN   DDIEFF+  L+   EA         K LN R              +L  ++KP T+  ++ C +KIK ++NLL KL   I+NP S +LI  L   L  I Q+      G+   +  PLL+ D    L   L+      W   GD W K R +W        Y P+F NG+ I   E+ +       A  P       E    I      P    + +L    L  R  ++   V  +  KL ++   F A    ELS+ + E++EV+E   +K WW   N  GQ+GY P  +L+    +    NN       SP  +     P+ PV   P   +      N ++K   +   + +N+EL KKI TN     NF     +A +             + +N  S  E+V+ WLE K FS     +L I NG  LF L+++E+ ++   E A R+ S + VQKS
Sbjct:  193 NDIEHDRRSNVSQEPEEPR-EVLAQKIEKDTQVLNCTLDDIEFFVAKLQKAAEA--------FKQLNQRKKGKKNKKKGHAEGMLTLRSKPPTEFEFVDCYQKIKLAINLLAKLKKHIQNPSSAELIHFLFGPLELIIQSSGGPELGR--SILAPLLSRDATDFLRGHLTPKEMAIWEVLGDRWTKCRAEWPREPPIPLYIPKFNNGW-IPPVEIFQGAPWETEAHPP-------EPKPRIQEEVRSPANGCSFLLTFFHLEVR--NYEAPVPAQPQKLAKIRYDFTARNANELSVLKDEVLEVLED--NKQWWKLRNRIGQEGYVPYNILD---IMSTEENNSRYREDMSPRGVG----PSSPVYKHPSTFAGDKWSTNPSNKEQLIHHMDEVNDELLKKITTNQPAKRNFKVDKPQAVY-------------VPLNYQSEPEEVKAWLEAKGFSKGTASQLGILNGAQLFSLNKEELRKVCGEEGA-RVYSQLAVQKS 648          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Xenopus
Match: EPS8L2 (EPS8-like 2 [Source:NCBI gene;Acc:100489749])

HSP 1 Score: 125.176 bits (313), Expect = 4.193e-29
Identity = 141/500 (28.20%), Postives = 218/500 (43.60%), Query Frame = 2
Query:  572 NSYSNEKMNKVKEYDSKPRNDDISSRTERNLLLLNYCFDDIEFFLQHLKDQEEAQAILKNTKGKNLNDR--------------LLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQAYSIYHNGKLSKVKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWAGYK--EKYYPEFFNGYQIDLEELMKDGIISPIADIPRRAVSNAEISHAIFYNQALPMIAQTDILENTVLSSREEDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLLEPFCYIDRSINNFIKSSPESPDYLNVRNIPTVPV--SPKRISQIMKDPNSADK---VAEANIINEELKKKINTNS----NFGGWNSRASFARPGPVVSKKHGQLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKS 1996
            N   +++ + V +   +PR + ++ + E++  +LN   DDIEFF+  L+   EA         K LN R              +L  ++KP T+  ++ C +KIK ++NLL KL   I+NP S +LI  L   L  I Q+      G+   +  PLL+ D    L   L+      W   GD W K R +W        Y P+F NG+ I   E+ +       A  P       E    I      P    + +L    L  R  ++   V  +  KL ++   F A    ELS+ + E++EV+E   +K WW   N  GQ+GY P  +L+    +    NN       SP  +     P+ PV   P   +      N ++K   +   + +N+EL KKI TN     NF     +A +             + +N  S  E+V+ WLE K FS     +L I NG  LF L+++E+ ++   E A R+ S + VQKS
Sbjct:  200 NDIEHDRRSNVSQEPEEPR-EVLAQKIEKDTQVLNCTLDDIEFFVAKLQKAAEA--------FKQLNQRKKGKKNKKKGHAEGMLTLRSKPPTEFEFVDCYQKIKLAINLLAKLKKHIQNPSSAELIHFLFGPLELIIQSSGGPELGR--SILAPLLSRDATDFLRGHLTPKEMAIWEVLGDRWTKCRAEWPREPPIPLYIPKFNNGW-IPPVEIFQGAPWETEAHPP-------EPKPRIQEEVRSPANGCSFLLTFFHLEVR--NYEAPVPAQPQKLAKIRYDFTARNANELSVLKDEVLEVLED--NKQWWKLRNRIGQEGYVPYNILD---IMSTEENNSRYREDMSPRGVG----PSSPVYKHPSTFAGDKWSTNPSNKEQLIHHMDEVNDELLKKITTNQPAKRNFKVDKPQAVY-------------VPLNYQSEPEEVKAWLEAKGFSKGTASQLGILNGAQLFSLNKEELRKVCGEEGA-RVYSQLAVQKS 655          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Xenopus
Match: eps8 (epidermal growth factor receptor pathway substrate 8 [Source:NCBI gene;Acc:779963])

HSP 1 Score: 122.479 bits (306), Expect = 4.710e-28
Identity = 137/554 (24.73%), Postives = 237/554 (42.78%), Query Frame = 2
Query:  614 DSKPRNDDISSRTERNLLLLNYCFDDIEFFLQHLKDQEEAQAILKNTKGKNLNDR------LLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQAYSIYHNGKLSK-VKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWAG--YKEKYYPEFFNGYQIDL---------EEL--MKDGIISPIADIPRRAVSNAEISHAIFYNQALPMIAQTDILENTVLSSREEDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLL-----------------------------EPFCYIDR---------SINNFIKSSPESPDYLNVRNIPTVPVSPKRISQIMKDPNSADKVAEANIINEELKKKINTNSNFGGWNSRASFARP---GPVVSKKHGQLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKSL----SGFGTLSRRELDEILTKRKEKVEITET 2080
            DS P    + +R +R++ +LN+  DD+EFF+  L+   EA + L   K             +L  +A+P  Q  ++ C +K K  +NLL KL   I+NP + +L+  L   L  + +A        L++ V  PL+T+D++  L+  L+K   + WTS GD+W K R +W    +   Y P F NG++  L         +EL  + + + + +A++ R+   N+  SH   Y       ++ +  E   + ++    C+               F A    ELS+ + +++EV++ K  K WW   +  G  G+ PN +L                                C+  R              +  +  SP Y  V  +P  P  P    Q+   P S     ++ +  EE++ ++      G   ++  F  P    P V        I+  S +EDV+ WL+ K F+   ++ L +  G  LF L++DE+ + V  E   R+ + V VQK+     SG       EL EI+ KR+E++ +  +
Sbjct:  214 DSTPEM--LEARIDRDVQILNHILDDVEFFIMKLQKAAEAFSELSKRKKGKKKKGPGGEEGVLTLRARPPPQEEFVDCFQKFKHGINLLAKLKSHIQNPSASELVHFLFTPLHMMVEATG---GPDLARTVLSPLITKDSLDFLNFILNKEEKQLWTSLGDSWNKYRAEWPKEQFIPPYVPRFRNGWEPPLLGCAAAPKEQELSYLAESVAN-VAELQRKQEFNS-YSHVSRYPP-----SEGNFEERDQVEAQRYALCK-------------YDFVARNSNELSVLKDDVLEVLDDK--KQWWKVRSSSGAVGFVPNNILVAMKPQDQSAKPMEAAYTHTIQLSSECSSPALCFTHRLPAPPPVSSHQRVLVPPTASSPAYCFVHRLPAPP--PVSSHQVPDSPCSFGVGRKSQM--EEVQDELIHRLTIGRSAAQKKFTVPRLNAPAV-------HISHSSPAEDVKSWLQAKGFNSVTVDSLGVLTGAQLFSLTKDEL-KTVCPE-GPRVYNQVTVQKAAIEEQSGGS-----ELLEIMKKRQERINMAAS 722          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Mouse
Match: Eps8l1 (EPS8-like 1 [Source:MGI Symbol;Acc:MGI:1914675])

HSP 1 Score: 133.65 bits (335), Expect = 8.058e-32
Identity = 143/512 (27.93%), Postives = 227/512 (44.34%), Query Frame = 2
Query:  614 DSKPRNDDISS-RTERNLLLLNYCFDDIEFFLQHLKDQEEAQAILKNTKGKNLNDR------LLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQAYSIYHNGKLSKVKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNW-CKAREKWAGYKEKYYPEFFNGYQIDLEELMKDGIISPIADIPRRAVSNAEISHAIFYNQALPMIA----QTDILENTVLSSREEDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLLEPFCYIDRSINNFIKSSPESPDYLNVRNIPTVPVSPKRISQIMK-----------DPNSADKVAEANIINEELKKKINTNSNFGGWNSRASFARPGPVVSKKHGQLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKSLSGFGTLSRR----ELDEILTKRKEKVE 2068
            D  PR  +++  + ER++ +LN+ FDD+E F+  L+   EA  +L++ +      R      LL  +AKP T+  Y   ++KIK++ +LL +L G I NP S +L+  L   L  I          K   V+ P LT + V LL   ++   ++ WTS GD+W C   E        Y PEF+NG+    E    D    P  D   + + + +        Q+ P +A    Q   LE     S+ E+  R   L N         F A    ELS+   +++EV++ +  + WW   +  GQ+GY P  +L P           +  S     +L     P  P      +Q+             DP+  +K ++   +NEEL+ ++          S  S   PGP    +  QLS   +++   V+ WL+ K FS   +E L +  G  LF L ++E+ R V  E   R+ S V VQ++L     L  R    EL+ ++ K+K+KVE
Sbjct:  241 DLGPRGPELAGLQAERDVDILNHVFDDVESFVSRLQKSAEATRVLEHRERGRRTRRRAAGEGLLTLRAKPPTEAEYTDVLQKIKYAFSLLARLRGNIANPSSPELLHFLFGPLQMIVNTSGGPEFAK--SVRRPHLTLEAVTLLRDNVTPGENELWTSLGDSWTCPGVELPPEEGSPYSPEFYNGW----EPPATDPQGRPWEDPVEKQLQHEKRRR----QQSAPQVAVNGQQDPELET---ESQLEEKARKWVLCN-------YDFQARNGSELSVKHRDVLEVLDDR--RKWWKVRDHQGQEGYVPYNILTPHP------GPQVHRSQSPARHLETSTPPPPPAPAPAPTQVRPQWDSCDSLNSLDPSEKEKFSQMLCVNEELQSRLAQG------RSGPSRVTPGP--RAQEPQLSPRSEASV--VRAWLQTKGFSSGTVEALGVLTGAQLFSLQKEEL-RAVCPEEGARVYSQVTVQRAL-----LEDREKVSELEAVMEKQKKKVE 708          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Mouse
Match: Eps8l1 (EPS8-like 1 [Source:MGI Symbol;Acc:MGI:1914675])

HSP 1 Score: 133.65 bits (335), Expect = 8.058e-32
Identity = 143/512 (27.93%), Postives = 227/512 (44.34%), Query Frame = 2
Query:  614 DSKPRNDDISS-RTERNLLLLNYCFDDIEFFLQHLKDQEEAQAILKNTKGKNLNDR------LLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQAYSIYHNGKLSKVKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNW-CKAREKWAGYKEKYYPEFFNGYQIDLEELMKDGIISPIADIPRRAVSNAEISHAIFYNQALPMIA----QTDILENTVLSSREEDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLLEPFCYIDRSINNFIKSSPESPDYLNVRNIPTVPVSPKRISQIMK-----------DPNSADKVAEANIINEELKKKINTNSNFGGWNSRASFARPGPVVSKKHGQLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKSLSGFGTLSRR----ELDEILTKRKEKVE 2068
            D  PR  +++  + ER++ +LN+ FDD+E F+  L+   EA  +L++ +      R      LL  +AKP T+  Y   ++KIK++ +LL +L G I NP S +L+  L   L  I          K   V+ P LT + V LL   ++   ++ WTS GD+W C   E        Y PEF+NG+    E    D    P  D   + + + +        Q+ P +A    Q   LE     S+ E+  R   L N         F A    ELS+   +++EV++ +  + WW   +  GQ+GY P  +L P           +  S     +L     P  P      +Q+             DP+  +K ++   +NEEL+ ++          S  S   PGP    +  QLS   +++   V+ WL+ K FS   +E L +  G  LF L ++E+ R V  E   R+ S V VQ++L     L  R    EL+ ++ K+K+KVE
Sbjct:  241 DLGPRGPELAGLQAERDVDILNHVFDDVESFVSRLQKSAEATRVLEHRERGRRTRRRAAGEGLLTLRAKPPTEAEYTDVLQKIKYAFSLLARLRGNIANPSSPELLHFLFGPLQMIVNTSGGPEFAK--SVRRPHLTLEAVTLLRDNVTPGENELWTSLGDSWTCPGVELPPEEGSPYSPEFYNGW----EPPATDPQGRPWEDPVEKQLQHEKRRR----QQSAPQVAVNGQQDPELET---ESQLEEKARKWVLCN-------YDFQARNGSELSVKHRDVLEVLDDR--RKWWKVRDHQGQEGYVPYNILTPHP------GPQVHRSQSPARHLETSTPPPPPAPAPAPTQVRPQWDSCDSLNSLDPSEKEKFSQMLCVNEELQSRLAQG------RSGPSRVTPGP--RAQEPQLSPRSEASV--VRAWLQTKGFSSGTVEALGVLTGAQLFSLQKEEL-RAVCPEEGARVYSQVTVQRAL-----LEDREKVSELEAVMEKQKKKVE 708          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Mouse
Match: Eps8l1 (EPS8-like 1 [Source:MGI Symbol;Acc:MGI:1914675])

HSP 1 Score: 133.65 bits (335), Expect = 8.991e-32
Identity = 143/512 (27.93%), Postives = 227/512 (44.34%), Query Frame = 2
Query:  614 DSKPRNDDISS-RTERNLLLLNYCFDDIEFFLQHLKDQEEAQAILKNTKGKNLNDR------LLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQAYSIYHNGKLSKVKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNW-CKAREKWAGYKEKYYPEFFNGYQIDLEELMKDGIISPIADIPRRAVSNAEISHAIFYNQALPMIA----QTDILENTVLSSREEDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLLEPFCYIDRSINNFIKSSPESPDYLNVRNIPTVPVSPKRISQIMK-----------DPNSADKVAEANIINEELKKKINTNSNFGGWNSRASFARPGPVVSKKHGQLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKSLSGFGTLSRR----ELDEILTKRKEKVE 2068
            D  PR  +++  + ER++ +LN+ FDD+E F+  L+   EA  +L++ +      R      LL  +AKP T+  Y   ++KIK++ +LL +L G I NP S +L+  L   L  I          K   V+ P LT + V LL   ++   ++ WTS GD+W C   E        Y PEF+NG+    E    D    P  D   + + + +        Q+ P +A    Q   LE     S+ E+  R   L N         F A    ELS+   +++EV++ +  + WW   +  GQ+GY P  +L P           +  S     +L     P  P      +Q+             DP+  +K ++   +NEEL+ ++          S  S   PGP    +  QLS   +++   V+ WL+ K FS   +E L +  G  LF L ++E+ R V  E   R+ S V VQ++L     L  R    EL+ ++ K+K+KVE
Sbjct:  302 DLGPRGPELAGLQAERDVDILNHVFDDVESFVSRLQKSAEATRVLEHRERGRRTRRRAAGEGLLTLRAKPPTEAEYTDVLQKIKYAFSLLARLRGNIANPSSPELLHFLFGPLQMIVNTSGGPEFAK--SVRRPHLTLEAVTLLRDNVTPGENELWTSLGDSWTCPGVELPPEEGSPYSPEFYNGW----EPPATDPQGRPWEDPVEKQLQHEKRRR----QQSAPQVAVNGQQDPELET---ESQLEEKARKWVLCN-------YDFQARNGSELSVKHRDVLEVLDDR--RKWWKVRDHQGQEGYVPYNILTPHP------GPQVHRSQSPARHLETSTPPPPPAPAPAPTQVRPQWDSCDSLNSLDPSEKEKFSQMLCVNEELQSRLAQG------RSGPSRVTPGP--RAQEPQLSPRSEASV--VRAWLQTKGFSSGTVEALGVLTGAQLFSLQKEEL-RAVCPEEGARVYSQVTVQRAL-----LEDREKVSELEAVMEKQKKKVE 769          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Mouse
Match: Eps8l2 (EPS8-like 2 [Source:MGI Symbol;Acc:MGI:2138828])

HSP 1 Score: 118.242 bits (295), Expect = 7.485e-27
Identity = 128/497 (25.75%), Postives = 215/497 (43.26%), Query Frame = 2
Query:  578 YSNEKMNKVKEYDSKPRNDDISSRTERNLLLLNYCFDDIEFFLQHLKDQEEAQAILKNTKGKNLNDR--------------LLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQAYSIYHNGKLSKVKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWAGYKEK--YYPEFFNGYQIDLEELMK-----DGIISPIAD--IPRRAVSNAEISHAIFYNQALPMIAQTDILENTVLSSREEDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLLEPFCYIDRSINNFIKSSPESPDYLNVRNIPTVPVSPKRISQIMKDPNSADKVAEANIINEELKKKINTNSNFGGWNSRASFARPGPVVSKKHGQLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKSL 1999
            +S     + +  D +PR   ++ R E+   +LN   DDIE+F+  L+   EA         K LN R              +L  +A+P ++  ++ C +K K ++NLL KL   I+NP + +L+  L   L  I          +   V  PLL+ D V  L   L       W S G+ W + R +W    +   Y P+F +G++  L+ L +     +G+ S  +D   P+  +S   + H+  ++ +    A  DI      SS   +     T    K  +++  F A    ELS+ + E++EV+E    + WW   N  GQ GY P  +L      D  +   ++ S +   Y         P SP      +   N  + +   + +N+EL KKI+        N R   ++P          L +  +S  ++V+ WLE K FS   +E L I  G  LF L+++E+ ++   E  +R+ S + VQK+ 
Sbjct:  232 FSEPGYRRRESQDEEPRAV-LAQRIEKETQILNCTLDDIEWFVARLQKAAEA--------FKQLNQRKKGKKKNKKGPAEGVLTLRARPPSEGEFVDCFQKTKLAINLLAKLQKHIQNPSAAELVHFLFGPLDLIINTCGSPDIAR--SVSSPLLSTDAVSFLRGHLVPKEMTLWESLGETWMRPRSEWPREPQVPLYVPKFRSGWEPPLDVLQEAPWEVEGLASVPSDQLTPKNRLS---VRHSPKHSLSSESQAPEDIAPPG--SSPHANRGYQPTPAMTKYVKILYDFTARNANELSVLKDEVLEVLED--GRQWWKLRNRSGQAGYVPCNILAEARQED--VGAPLEQSGQK--YWG-------PASPTHKLPPIFAGNKEELIHHMDEVNDELMKKISHIKTQPQRNFRVERSQP--------VHLPLTFESGPDEVRAWLEAKAFSARIVENLGILTGPQLFSLNKEELKKVCGEE-GSRVYSQLTVQKAF 690          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Mouse
Match: Eps8l3 (EPS8-like 3 [Source:MGI Symbol;Acc:MGI:2139743])

HSP 1 Score: 97.0561 bits (240), Expect = 2.004e-20
Identity = 87/293 (29.69%), Postives = 134/293 (45.73%), Query Frame = 2
Query:  653 ERNLLLLNYCFDDIEFFLQHLKDQEEAQAILKNTKGKNLNDRLLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQAYSIYHNGKLSKVKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWAGYK-EKYYPEFFNGYQIDLEELMKDGIISPIADIPRRAVSNAEISHAIFYNQALPMIAQTDILE-NTVLSSREEDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLLEPF 1525
            ER+  +LN+   DIE F   LK   E QA  +N+  K    R  +      TQ  Y+ C +KIK S NLL KL  +++   + + + L+ + L  I         G  +KV  PLLT   + LL  CLS      W S G +W  +   W G +   Y P F++G+QI     M      PI +    ++  + +  ++ + +  P     +  + N  LSS           R     +V+  F A   +EL++++GEI+EV++    K WWL  N  G  GY P+ +LEP 
Sbjct:  243 ERDEEVLNHVLRDIELFAGKLK---EVQA--RNSHKKTKLGRKKKKSKNGITQAEYIDCFQKIKLSFNLLGKLALRMQETSAPEFVGLIFQTLKFI--LSQCPEAGLPAKVISPLLTPKAIDLLQSCLSPPEDTLWKSLGTSWTTSWADWTGSEPPPYQPTFYDGWQIPQPRSMM-----PITNQDSISLRGSRMRSSLHFPRDEPYNHNPEYEDSNLPLSSPSPG-------RAALKMQVLYEFEARNAQELTVAQGEILEVLDQ--SKRWWLVKNEAGLTGYIPSNILEPL 514          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. UniProt/SwissProt
Match: sp|Q8TE68|ES8L1_HUMAN (Epidermal growth factor receptor kinase substrate 8-like protein 1 OS=Homo sapiens OX=9606 GN=EPS8L1 PE=1 SV=3)

HSP 1 Score: 138.658 bits (348), Expect = 1.415e-32
Identity = 142/529 (26.84%), Postives = 237/529 (44.80%), Query Frame = 2
Query:  614 DSKPRNDDISS-RTERNLLLLNYCFDDIEFFLQHLKDQEEAQAILKNTKGKNLNDR------LLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQX-----XXXXXXXXXXXGQAYSIYHNGKLSKVKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCK-AREKWAGYKEKYYPEFFNGYQIDLEELMKDGIISPIADIPRRAVSNA---EISHA-IFYNQALPMIAQTDILENTVLSSREEDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLLEPFC--------YIDRSINN---------------FIKSSPESPDYLNVRNIPTVPVSPKRISQIMKDPNSADKVAEANIINEELKKKINTNSNFGGWNSRASFARPGPVVSKKHGQLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKSLSGFGTLSRR----ELDEILTKRKEKVE 2068
            D  PR  D++  + ER + +LN+ FDD+E F+  L+   EA  +L++ +    + R      LL  +AKP ++  Y   ++KIK++ +LL +L G I +P S +L       L +      G  ++       S V+ P LT D V LL   ++   ++ WTS GD+W +   E        Y PEFF+G++             P+ D   RA  +    ++ H      Q+ P +A   +  +  L    E    S T   GK       F A    ELS+ + +++EV++    + WW   +  GQ+GY P  +L P+            RS+N+                 +   + P + +  ++  +            DP+  +K ++  I+NEEL+ ++          S  S A PGP   +   QLS   D++  +V+ WL+ K FS   ++ L +  G  LF L ++E+ R VS E   R+ S V VQ+SL     L  +    EL+ ++ K+K+KVE
Sbjct:  241 DLGPRGPDLAVLQAEREVDILNHVFDDVESFVSRLQKSAEAARVLEHRERGRRSRRRAAGEGLLTLRAKPPSEAEYTDVLQKIKYAFSLLARLRGNIADPSSPELLHFLFGPLQMIVNTSGGPEFA-------SSVRRPHLTSDAVALLRDNVTPRENELWTSLGDSWTRPGLELSPEEGPPYRPEFFSGWE------------PPVTDPQSRAWEDPVEKQLQHERRRRQQSAPQVA---VNGHRDLEPESEPQLESET--AGKWVLCNYDFQARNSSELSVKQRDVLEVLDDS--RKWWKVRDPAGQEGYVPYNILTPYPGPRLHHSQSPARSLNSTPPPPPAPAPAPPPALARPRWDRPRWDSCDSLNGL------------DPSEKEKFSQMLIVNEELQARLAQG------RSGPSRAVPGPRAPEP--QLSPGSDAS--EVRAWLQAKGFSSGTVDALGVLTGAQLFSLQKEEL-RAVSPEEGARVYSQVTVQRSL-----LEDKEKVSELEAVMEKQKKKVE 715          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. UniProt/SwissProt
Match: sp|Q8R5F8|ES8L1_MOUSE (Epidermal growth factor receptor kinase substrate 8-like protein 1 OS=Mus musculus OX=10090 GN=Eps8l1 PE=1 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 5.637e-31
Identity = 143/512 (27.93%), Postives = 227/512 (44.34%), Query Frame = 2
Query:  614 DSKPRNDDISS-RTERNLLLLNYCFDDIEFFLQHLKDQEEAQAILKNTKGKNLNDR------LLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQAYSIYHNGKLSKVKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNW-CKAREKWAGYKEKYYPEFFNGYQIDLEELMKDGIISPIADIPRRAVSNAEISHAIFYNQALPMIA----QTDILENTVLSSREEDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLLEPFCYIDRSINNFIKSSPESPDYLNVRNIPTVPVSPKRISQIMK-----------DPNSADKVAEANIINEELKKKINTNSNFGGWNSRASFARPGPVVSKKHGQLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKSLSGFGTLSRR----ELDEILTKRKEKVE 2068
            D  PR  +++  + ER++ +LN+ FDD+E F+  L+   EA  +L++ +      R      LL  +AKP T+  Y   ++KIK++ +LL +L G I NP S +L+  L   L  I          K   V+ P LT + V LL   ++   ++ WTS GD+W C   E        Y PEF+NG+    E    D    P  D   + + + +        Q+ P +A    Q   LE     S+ E+  R   L N         F A    ELS+   +++EV++ +  + WW   +  GQ+GY P  +L P           +  S     +L     P  P      +Q+             DP+  +K ++   +NEEL+ ++          S  S   PGP    +  QLS   +++   V+ WL+ K FS   +E L +  G  LF L ++E+ R V  E   R+ S V VQ++L     L  R    EL+ ++ K+K+KVE
Sbjct:  241 DLGPRGPELAGLQAERDVDILNHVFDDVESFVSRLQKSAEATRVLEHRERGRRTRRRAAGEGLLTLRAKPPTEAEYTDVLQKIKYAFSLLARLRGNIANPSSPELLHFLFGPLQMIVNTSGGPEFAK--SVRRPHLTLEAVTLLRDNVTPGENELWTSLGDSWTCPGVELPPEEGSPYSPEFYNGW----EPPATDPQGRPWEDPVEKQLQHEKRRR----QQSAPQVAVNGQQDPELET---ESQLEEKARKWVLCN-------YDFQARNGSELSVKHRDVLEVLDDR--RKWWKVRDHQGQEGYVPYNILTPHP------GPQVHRSQSPARHLETSTPPPPPAPAPAPTQVRPQWDSCDSLNSLDPSEKEKFSQMLCVNEELQSRLAQG------RSGPSRVTPGP--RAQEPQLSPRSEASV--VRAWLQTKGFSSGTVEALGVLTGAQLFSLQKEEL-RAVCPEEGARVYSQVTVQRAL-----LEDREKVSELEAVMEKQKKKVE 708          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. UniProt/SwissProt
Match: sp|Q99K30|ES8L2_MOUSE (Epidermal growth factor receptor kinase substrate 8-like protein 2 OS=Mus musculus OX=10090 GN=Eps8l2 PE=1 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 5.235e-26
Identity = 128/497 (25.75%), Postives = 215/497 (43.26%), Query Frame = 2
Query:  578 YSNEKMNKVKEYDSKPRNDDISSRTERNLLLLNYCFDDIEFFLQHLKDQEEAQAILKNTKGKNLNDR--------------LLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQAYSIYHNGKLSKVKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWAGYKEK--YYPEFFNGYQIDLEELMK-----DGIISPIAD--IPRRAVSNAEISHAIFYNQALPMIAQTDILENTVLSSREEDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLLEPFCYIDRSINNFIKSSPESPDYLNVRNIPTVPVSPKRISQIMKDPNSADKVAEANIINEELKKKINTNSNFGGWNSRASFARPGPVVSKKHGQLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKSL 1999
            +S     + +  D +PR   ++ R E+   +LN   DDIE+F+  L+   EA         K LN R              +L  +A+P ++  ++ C +K K ++NLL KL   I+NP + +L+  L   L  I          +   V  PLL+ D V  L   L       W S G+ W + R +W    +   Y P+F +G++  L+ L +     +G+ S  +D   P+  +S   + H+  ++ +    A  DI      SS   +     T    K  +++  F A    ELS+ + E++EV+E    + WW   N  GQ GY P  +L      D  +   ++ S +   Y         P SP      +   N  + +   + +N+EL KKI+        N R   ++P          L +  +S  ++V+ WLE K FS   +E L I  G  LF L+++E+ ++   E  +R+ S + VQK+ 
Sbjct:  232 FSEPGYRRRESQDEEPRAV-LAQRIEKETQILNCTLDDIEWFVARLQKAAEA--------FKQLNQRKKGKKKNKKGPAEGVLTLRARPPSEGEFVDCFQKTKLAINLLAKLQKHIQNPSAAELVHFLFGPLDLIINTCGSPDIAR--SVSSPLLSTDAVSFLRGHLVPKEMTLWESLGETWMRPRSEWPREPQVPLYVPKFRSGWEPPLDVLQEAPWEVEGLASVPSDQLTPKNRLS---VRHSPKHSLSSESQAPEDIAPPG--SSPHANRGYQPTPAMTKYVKILYDFTARNANELSVLKDEVLEVLED--GRQWWKLRNRSGQAGYVPCNILAEARQED--VGAPLEQSGQK--YWG-------PASPTHKLPPIFAGNKEELIHHMDEVNDELMKKISHIKTQPQRNFRVERSQP--------VHLPLTFESGPDEVRAWLEAKAFSARIVENLGILTGPQLFSLNKEELKKVCGEE-GSRVYSQLTVQKAF 690          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. UniProt/SwissProt
Match: sp|Q9H6S3|ES8L2_HUMAN (Epidermal growth factor receptor kinase substrate 8-like protein 2 OS=Homo sapiens OX=9606 GN=EPS8L2 PE=1 SV=2)

HSP 1 Score: 117.857 bits (294), Expect = 6.661e-26
Identity = 131/520 (25.19%), Postives = 223/520 (42.88%), Query Frame = 2
Query:  605 KEYDSKPRNDDISSRTERNLLLLNYCFDDIEFFLQHLKDQEEAQAILKNTKGKNLNDR--------------LLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQAYSIYHNGKLSKVKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWAGYKEK--YYPEFFNGYQIDLE---------ELMKDGIISPIADIPRRAVSNAE----ISHAIFYNQALPMIAQTDILENTVLSSREEDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLL---------EPFCYIDRSINNFIKSSPESPDYLNVRNIPTVPVSPKRISQIMKDPNSADKVAEANIINEELKKKINTNSNFGGWNSRASFARPGPVVSKKHGQLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKSLSGFGTLSRRELDEILTK 2050
            +E   +PR   ++ + E+   +LN   DDIE+F+  L+   EA         K LN R              +L  +A+P ++  ++ C +KIK ++NLL KL   I+NP + +L+  L   L  I    S     +   V  PLL+ D V  L   L       W S G++W + R +W    +   Y P+F +G++  ++         E +    I  ++ + R+++ N++     S       ALP +           SS         T    K  +++  F A    ELS+ + E++EV+E    + WW   +  GQ GY P  +L          PF   +++   +    P SP +   +  P+ P +   + Q M +            +N+EL +KI+        N RA   R   V   +     +  +S  ++V+ WLE K FSP  +E L I  G  LF L+++E+ ++   E   R+ S + +QK+       S  EL+E++ K
Sbjct:  238 RESQEEPRAV-LAQKIEKETQILNCALDDIEWFVARLQKAAEA--------FKQLNQRKKGKKKGKKAPAEGVLTLRARPPSEGEFIDCFQKIKLAINLLAKLQKHIQNPSAAELVHFLFGPLDLIVNTCSGPDIAR--SVSCPLLSRDAVDFLRGHLVPKEMSLWESLGESWMRPRSEWPREPQVPLYVPKFHSGWEPPVDVLQEAPWEVEGLASAPIEEVSPVSRQSIRNSQKHSPTSEPTPPGDALPPV-----------SSPHTHRGYQPTPAMAKYVKILYDFTARNANELSVLKDEVLEVLED--GRQWWKLRSRSGQAGYVPCNILGEARPEDAGAPF---EQAGQKYW--GPASPTH---KLPPSFPGNKDELMQHMDE------------VNDELIRKIS--------NIRAQPQRHFRVERSQPVSQPLTYESGPDEVRAWLEAKAFSPRIVENLGILTGPQLFSLNKEELKKVCGEE-GVRVYSQLTMQKAFLE-KQQSGSELEELMNK 703          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. UniProt/SwissProt
Match: sp|Q5RC07|ES8L2_PONAB (Epidermal growth factor receptor kinase substrate 8-like protein 2 OS=Pongo abelii OX=9601 GN=EPS8L2 PE=2 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 3.321e-25
Identity = 127/509 (24.95%), Postives = 216/509 (42.44%), Query Frame = 2
Query:  638 ISSRTERNLLLLNYCFDDIEFFLQHLKDQEEAQAILKNTKGKNLNDR--------------LLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQAYSIYHNGKLSKVKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWAGYKEK--YYPEFFNGYQIDLE---------ELMKDGIISPIADIPRRAVSNAE----ISHAIFYNQALPMIAQTDILENTVLSSREEDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLL---------EPFCYIDRSINNFIKSSPESPDYLNVRNIPTVPVSPKRISQIMKDPNSADKVAEANIINEELKKKINTNSNFGGWNSRASFARPGPVVSKKHGQLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKSLSGFGTLSRRELDEILTK 2050
            ++ + E+   +LN   DDIE+F+  L+   EA         K LN R              +L  +A+P ++  ++ C +K K ++NLL KL   I+NP + +L+  L   L  I          +   V  PLL+ D V  L   L       W S G++W + R +W    +   Y P+F +G++  ++         E +    I  ++ + R+++ N++     S       ALP +           SS         T    K  +++  F A    ELS+ + E++EV+E    + WW   +  GQ GY P  +L          PF   +++   +    P SP +   +  P+ P +   + Q M +            +N+EL +KI+        N RA   R   V   +     +  +S  ++V+ WLE K FSP  +E L I  G  LF L+++E+ ++   E   R+ S + VQK+       S  EL+E++ K
Sbjct:  249 LAQKIEKETQILNCALDDIEWFVARLQKAAEA--------FKQLNQRKKGKKKGKKAPAEGVLTLRARPPSEGEFIDCFQKTKLAINLLAKLQKHIQNPSAAELVHFLFGPLDLIVNTCGGPDIAR--SVSCPLLSRDAVDFLRGHLVPKEMSLWESLGESWMRPRSEWPWEPQVPLYVPKFHSGWEPPMDVLQEAPWEVEGLASAPIEEVSPVSRQSIRNSQKHSPTSEPTPPGDALPPV-----------SSPHTHRGYQPTPAMAKYVKILYDFTARNANELSVLKDEVLEVLED--GRQWWKLRSRSGQAGYVPCNILGEARPEDAGAPF---EQAGQKYW--GPASPTH---KLPPSFPGNKDELMQHMDE------------VNDELIRKIS--------NIRAQPQRHFRVERSQPVSQPLTYESGPDEVRAWLEAKAFSPRIVENLGILTGPQLFSLNKEELKKVCGEE-GVRVYSQLTVQKAFLE-KQQSGSELEELMNK 704          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. TrEMBL
Match: A0A3P8S5V1 (Eps8 like 1b OS=Amphiprion percula OX=161767 PE=4 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 3.701e-38
Identity = 138/497 (27.77%), Postives = 219/497 (44.06%), Query Frame = 2
Query:  647 RTERNLLLLNYCFDDIEFFLQHLKDQEEAQAILKN------TKGKNLNDRLLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQAYSIYHNGKLSKVKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWAGYKEKYYPEFFNGYQIDLEELMKDGIISPIADIPRRAVSNAEISHAIFYNQALPMIAQTDILENTVLSSREEDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLLEPFCYIDRSINN--------------FIKSSPESPDYLNVRNIPTVPVSPKRISQIMKDPNSADKVAEANIINEELKKKINTNSNFGGWNSRASFARPGPVVSKKHGQLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKSLSGFGTLSRR--ELDEILTKRKEKVEI 2071
            R ER + +LN+CFDDIE F+  L+   EA  +L        +K +N  + LL  KA+P  +  ++   +K K+  +LL +L   I NP S +L+  + + L  I +       G  + V  P LT   V LL   LS+   + WTS G NW   R +  G    Y P F +G++   E L  DG +          V +     A+   Q  P            +S  +     +      +LY     F A    ELS+ +GE +EVIES   K WW C N   Q G+ P  +LEP  +ID  + +              F    P  P   +V   P  P  P+ +    +   SA++  +  ++N+EL +++         N + +  +P  +       + ++  S  E+V  WL  K FS   +  L +  G  LF L+++E+ R V  E   R+ S + VQK+L      +RR  EL+ ++ K+K KV++
Sbjct:   44 RAEREVGILNHCFDDIENFMAKLQQTAEAATVLNQRKKKKKSKKQNGEEDLLTAKARPPPEEEFIDIFQKFKYCFSLLARLKSTIANPSSEELVHHVFKPLDMIVKTTGGPALG--ASVSSPALTSSAVSLLQDSLSEEERQLWTSLGPNWTLPRSQLRGPVAPYTPVFLSGWKP--EALRADGQVW------EDPVESQHKHEALRVQQEQP---------PQPISPPDTHIDETDGPELDRLYSCSYDFIARNSSELSVQQGETLEVIESS--KRWWKCRNRFNQIGFVPFNILEPVAHIDSPVAHRPPPAPALPPLAKTFSTVPPSPPALPSVP--PESPQRPRSLPGYNQHMASAEETDKVMLVNDELLQRLT--------NGKVNLNKPLVIPRSSETSVPLDYHSPPEEVADWLRGKGFSEPTVSCLGVLTGAQLFSLNKEEL-RAVIPEEGARVYSQLTVQKALL---EDARRATELEAVMEKQKMKVDL 505          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. TrEMBL
Match: A0A3Q1BX77 (Eps8 like 1b OS=Amphiprion ocellaris OX=80972 PE=4 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 5.243e-38
Identity = 138/498 (27.71%), Postives = 219/498 (43.98%), Query Frame = 2
Query:  647 RTERNLLLLNYCFDDIEFFLQHLKDQEEAQAILKN-------TKGKNLNDRLLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQAYSIYHNGKLSKVKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWAGYKEKYYPEFFNGYQIDLEELMKDGIISPIADIPRRAVSNAEISHAIFYNQALPMIAQTDILENTVLSSREEDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLLEPFCYIDRSINN--------------FIKSSPESPDYLNVRNIPTVPVSPKRISQIMKDPNSADKVAEANIINEELKKKINTNSNFGGWNSRASFARPGPVVSKKHGQLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKSLSGFGTLSRR--ELDEILTKRKEKVEI 2071
            R ER + +LN+CFDDIE F+  L+   EA  +L         +K +N  + LL  KA+P  +  ++   +K K+  +LL +L   I NP S +L+  + + L  I +       G  + V  P LT   V LL   LS+   + WTS G NW   R +  G    Y P F +G++   E L  DG +          V +     A+   Q  P            +S  +     +      +LY     F A    ELS+ +GE +EVIES   K WW C N   Q G+ P  +LEP  +ID  + +              F    P  P   +V   P  P  P+ +    +   SA++  +  ++N+EL +++         N + +  +P  +       + ++  S  E+V  WL  K FS   +  L +  G  LF L+++E+ R V  E   R+ S + VQK+L      +RR  EL+ ++ K+K KV++
Sbjct:   44 RAEREVGILNHCFDDIENFMAKLQQTAEAATVLNQRKKKKKKSKKQNGEEDLLTAKARPPPEEEFIDIFQKFKYCFSLLARLKSTIANPSSEELVHHVFKPLDMIVKTTGGPALG--ASVSSPALTSSAVSLLQDSLSEEERQLWTSLGPNWTLPRSQLRGPVAPYTPVFLSGWKP--EALRADGQVW------EDPVESQHKHEALRVQQEQP---------PQPISPPDTHIDETDGPELDRLYSCSYDFIARNSSELSVQQGETLEVIESS--KRWWKCRNRFNQIGFVPFNILEPVAHIDSPVAHRPPPAPALPPLAKTFSTVPPSPPALPSVP--PESPQRPRSLPGYNQHMASAEETDKVMLVNDELLQRLT--------NGKVNLNKPLVIPRSSETSVPLDYHSPPEEVADWLRGKGFSEPTVSCLGVLTGAQLFSLNKEEL-RAVIPEEGARVYSQLTVQKALL---EDARRATELEAVMEKQKMKVDL 506          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. TrEMBL
Match: A0A482W168 (Epidermal growth factor receptor kinase substrate 8 OS=Asbolus verrucosus OX=1661398 GN=BDFB_000187 PE=4 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 9.566e-38
Identity = 185/721 (25.66%), Postives = 310/721 (43.00%), Query Frame = 2
Query:  257 ERQVLVIRRWLDQVILEEFKLALI---TNVASHQQVPDNNYLSNILTFNTQIKTSSNV--LTETHIFQ---------LED-SNLHMVNYLASDIRSAIESATNLNPKNTPIKVLPSNNKRNSYSNEKMNKVKEYDSKPRNDDISSRT----ERNLLLLNYCFDDIEFFLQHLKDQEEAQAILKNTKGK------NLNDRLLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQA-YSIYHNGKLS-KVKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWAGYKEKYYPEFFNGYQID---LEELMK--------DGIISPIADIPRRAVSNAEI--------SH--AIFYNQALPM----IAQTDILENTV---------LSSREEDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLLEPF-----------CYIDRSINNFIKS-----------SPESPDYLN----------VRNIPTV-----------------PVSPKRISQIMKDPNSADKVAEANIINEELKKKINTNSNFGGWNSRASFARP----GPVVSKKHGQLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKSLSGFGTLSRRELDEILTKRKEKVEITE 2077
            +R  ++I  +    ++E F    I   T   SH  +      +NIL F   I T+SN     E HIFQ         +ED   L M   L    +++I   ++  P N    + P+ + R+ + ++        +    NDD SS T    ER++ +LN+CFDDIE F+  L+    A   L+  +        ++ D +L  + KP  +  ++   +K K S NLL KL   I +P++ +L+  L   L  I +A +  Y + +L  KV  PLLT + V LL  C++    + W S G+ W   R++W G+   Y+P F +G+  D   ++EL          +G     +D      SN EI        SH   I   + LP       ++DI  +++             +E+F   +  R   + +V     A+ D+EL++  GE +E+++    + WW   N  GQ  + P+T++ PF            Y   +  N  ++           SP +P+++N          VR    V                 PV+P  ++ + + P+      + + + +EL             N   S  R       +  ++  ++ I+Q ST E+VQ WL+ K F P    K K   G  LF   ++++ RI   +   RLDS +K+QKS+SG+ T+   EL  IL K +EK+E  +
Sbjct:   71 DRSWVLIMDYETGSVMERFPANSIQEPTAFTSHDPM---EMYNNILVF---IVTNSNQSHPPEMHIFQCQSISAQDLVEDLKQLRMGKTLTRSRKTSIPPPSHKPPPNV---INPTRDPRDYHGSDS-------ELTANNDDSSSTTSEKYERDVTILNHCFDDIEKFIARLQHAAAAARELERRRRSRKSKKRDMGDGMLTMRTKPPPEKEFIDIFQKFKLSFNLLAKLKAHIHDPNAPELVHFLFTPLALIVEASHDTYSDSQLPRKVVSPLLTREAVNLLMNCVTSKETELWHSLGNAWLIPRDQWKGHVPPYHPIFMDGWSPDYPVVDELETNNDNKHYIEGQYG--SDYNDYDTSNQEIFMYEKGSDSHHQKIEPERDLPPNLGESTRSDISVDSIERNGGEDRGFGRSQENFLDDLQARGANIVQVTYPRTANNDKELTVVRGEYLEILDDS--RKWWKARNSRGQVAHVPHTIVTPFHSGGNDIFNNPLYTTHNYRNSHRADSPLDRFSGGHSPSAPEHVNPPVSATSADWVRKERLVNDGPPPPPPPPPPMISNPVTP--VTTLKRSPSIKSTTTQGDRMQDEL-------------NLVLSMVREKRYKSHIEVRQTPEVYIDQKSTPEEVQNWLKAKDFEPKICAKFKGLAGHNLFDFQKNQLERICGPKEGARLDSQLKIQKSVSGYQTVRSSELKAILAKAREKIEAAD 756          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. TrEMBL
Match: A0A1S3JAS1 (epidermal growth factor receptor kinase substrate 8 isoform X6 OS=Lingula unguis OX=7574 GN=LOC106171223 PE=4 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 1.283e-37
Identity = 160/554 (28.88%), Postives = 245/554 (44.22%), Query Frame = 2
Query:  626 RNDD----ISSRTERNLLLLNYCFDDIEFFLQHLKDQEEA-------QAILKNTKGKNLNDRLLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQAYSIYHNGK---LSKVKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWAGYKEKYYPEFFNGYQIDLEELMKD-----GIISP-------IADIPRRAVS-------------NAEISHAIFYNQALPMIAQTDILENTVLSSREED--FCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLLEPF-----------CYIDRSINNFIKSSPESPDYLNV---------------RNIPTVPVSPKRISQIMKDPNSADKVAEANIINEELKKKINTNSNFGGWNSR-ASFARPGPVVSKKHGQLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKSLSGFGTL--SRRELDEILTKRKEKVEITE 2077
            R DD    +S RTER++ LLN+CFDDIE F+  L+   EA       Q     +K K + + +L  +A+P     ++    K K S NLL KL   I +P++ +L+  L   L  + +A     +G     S+V  PLLT    +LL  CL+      W S G+ W   R+ W GY   Y P F++G+Q      M+D     G   P        A  P+R  S             N +  H     +  P +      E  VLS  E+   F R +  +  K+Y V+   +    +EL++S+GEI+EV++    +NWW   N  G  G++P T+L+ +            + +R   +F +S+   P                    R   T    PK      ++     K A  + ++ ELK ++    N    NSR  S  RP   V        +   ST+E+V +WL+ K F    + KL  ++G++LF  S+ E+ R++  E   RL S V VQK+LSGF        EL  IL KRK++ + +E
Sbjct:  290 REDDNDSVVSERTERDVQLLNHCFDDIEKFVARLQFAAEAYKELSRRQKNRGKSKKKVMGEGMLTMRARPPPPQDFIDIFAKFKLSFNLLAKLKAHIHDPNAPELVHFLFTPLSLVVEASKDPRHGTPDLASQVISPLLTVHARELLLNCLTSKEIDLWMSLGEPWSVHRDAWKGYVPPYVPRFYDGWQPGGP--MEDPTYQYGHGGPNYSGQGYGAPPPQRGESFRDVQRSNSLQYGNRQAQHEAMARRQEPQLPP----EPRVLSFEEKQKIFLRELRSKGAKVYEVMHERSGRNAKELTVSKGEILEVLDD--GRNWWKLRNSEGTVGHAPYTILKKYDDDSDPRGHDSSFDERDRRDFGRSNGARPPPPPPGPPPPPVNGNWKQANRQEETKKPKPKE----NEEKTIIHKAASKDDLHNELKNQLTKGKN---RNSRPVSHGRPISAV-------YLTMYSTTEEVGEWLQSKNFPERVVYKLDEYDGESLFKASQAELERLIGKEQGQRLASQVLVQKNLSGFKDTNSGNNELAAILQKRKQRADSSE 821          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. TrEMBL
Match: H2UXA0 (Eps8 like 1b OS=Takifugu rubripes OX=31033 GN=LOC101074325 PE=4 SV=2)

HSP 1 Score: 160.999 bits (406), Expect = 1.543e-37
Identity = 138/500 (27.60%), Postives = 226/500 (45.20%), Query Frame = 2
Query:  647 RTERNLLLLNYCFDDIEFFLQHLKDQEEAQAILKN--------TKGKNLNDRLLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQAYSIYHNGKLSKVKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWAGYKEKYYPEFFNGYQIDLEELMKDGII--SPIADIPRRAVSNAEISHAIFYNQALPMIAQTDILENTVLSSREEDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLLEPFCYIDRSINNFIKSS-------------PESPDYLNVRNIPTVPVSPKRISQIMKDPNSADKVAEANIINEELKKKINTNSNFGGWNSRASFARPGPVVSKKHGQLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKSLSGFGTLSRR--ELDEILTKRKEKVEI 2071
            R ER + +LN+CFDDIE F+  L+   EA  +L          +K ++  + LL  KA+P  +  ++   +K K+  +LL +L   I NP +  L+  + + L  + +       G    V  P LT   V LL   LS+   + WTS G NW     +  G    Y P F++G++   E L  DG +   P+    +     A+           P I  +             D      +   +LY  +  F A    ELS+ +GE +EV+ES   K WW C N   Q G+ P  +L+P  +++  +++   S+             P SP  L+  + P  P S    SQ +  P + D   +A ++N+EL  ++         N +A+  +P  +       + ++ DS+ E+V +WL  K FS   +  L +  G  LF L++DE+ R V  E   R+ S + VQK+L      +RR  EL+E++ K+K KV++
Sbjct:  189 RAEREVGILNHCFDDIENFMAKLQQTAEAAMVLNQRKKKNKKKSKKQSSEEDLLTAKARPPPEEEFVDIFQKFKYCFSLLARLKSAISNPSAEDLVHHVFKPLDMMVKTTGGPAMG--GSVSSPALTNAAVTLLQDNLSEEERQLWTSLGPNWTLPCSQLRGPVAPYVPVFYDGWKP--ETLRPDGQVWEDPVESQHKHEDLQAKREQQQPPQPVRPAITSSS------------DATDGSPVPPERLYSCMYDFIARNSTELSVQQGETLEVLESS--KRWWKCRNYFNQVGFVPFNILQPMTHVESPVSSRPPSAPAPPPLPKTFSVVPPSPPVLHPSHSPQRPRSLPPYSQNI--PAADDTENKAMLVNDELLHRLT--------NGKANLNKPLVIQRSSETSIPLDYDSSPEEVGEWLRGKGFSEPTVTCLGVLTGAQLFSLNKDEL-RAVIPEEGARVYSQLTVQKALL---EDARRATELEEVMEKQKMKVDL 656          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Cavefish
Match: eps8l1a (eps8 like 1a [Source:ZFIN;Acc:ZDB-GENE-050306-14])

HSP 1 Score: 128.257 bits (321), Expect = 9.680e-31
Identity = 130/510 (25.49%), Postives = 211/510 (41.37%), Query Frame = 2
Query:  650 TERNLLLLNYCFDDIEFFLQHLKDQEEAQAILKNTKGKNLN------------DRLLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQAYSIYHNGKLSKVKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWAGYKEKYYPEFFNGYQIDLEELMKDGIISPIADIPRRAVSNAEISHAIFYNQALPMIAQTDILENTVLSSREEDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLLEPFCYIDRSINNFIKSSPESPDYLNVRNIPT--VPVSPK---RISQIMKD----------------PNSADKVAEANIINEELKKKINTNSNFGGWNSRASFARPGPVVSKKHGQLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKSLSGFGTLSR----RELDEILTKRKEKVE 2068
             +R + LLN+CF D+E F+  L+    A+  ++ +K K               D + E      +   ++   +KIK+S +LL +L  +I  P S +L+  L   L  +    +       + V  P LT   V LL Q LS+   + W S G NW ++  +       Y P F +G+Q +  +        P+           E  H             TD L   + +  EE+          +LYR    F A    ELS+  GE ++V+ES   K WW C N + Q G+ P+ +LEP  + +             PD   V   P+  +P+SP    R S ++                  P   D      ++N EL +++          +R SF      V++ +   S+N  S   +VQ WL+ K FS   +  L I +G  LF L+++E+   VS +   R+ S + +QK+L     L +     ELD ++ K+K KV+
Sbjct:   60 AQREVDLLNHCFADVETFMGRLQQAANARTAVEQSKKKKKAKKDNSKKKKQQYDLMAEEVPSGPSGQEFVDIFQKIKYSFSLLGRLKNEISKPSSEELLHHLFVPLDLL--VKTTGGPDMAAGVSSPALTSGAVGLLQQNLSQEERELWESLGPNWTQSYSQQTNPVSPYTPVFLDGWQPEACDASGQAFEDPV-----------ESQHKYEAQPESQQFDSTDALPPNLPT--EENVENPPPSEGERLYRCSYDFVARNSSELSVLHGETLQVLES--SKRWWKCRNNYDQIGFVPSNILEPVNHTE-------------PDSRVVMRHPSTRIPLSPPGGGRFSYVVPSSSGEIYSHNETRPHSMPPIGDDGERVTLMNNELAERLANG------RTRPSF------VTRTNETASLNYHSAPGEVQDWLKGKGFSEHTVNSLGILSGAQLFSLNKEELC-TVSPQEGGRVYSQLTIQKAL-----LEKVNKATELDAVMKKQKMKVD 521          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Cavefish
Match: eps8l2 (EPS8 like 2 [Source:NCBI gene;Acc:103026465])

HSP 1 Score: 108.997 bits (271), Expect = 4.554e-24
Identity = 154/640 (24.06%), Postives = 263/640 (41.09%), Query Frame = 2
Query:  281 RWLDQVILEEFKLALITNVASHQQVPDNNYLSNILTFNTQIKTSSNVLTETHIFQLEDSNLHMVNYLASDIRSAI---ESATNLNPKNTPI----------KVLPSNNKRNSYSNEKMNKVKEYDSK-------PRNDD-----ISSRTERNLLLLNYCFDDIEFFLQHLKDQEEAQAIL------KNTKGKNLNDRLLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQAYSIYHNGKLSKVKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWAGYK--EKYYPEFFNGYQIDLE-------ELMKDGIISPIADIPRRAVSNAEISHAIFYNQALPMIAQTDILENTVLSSREEDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLL-----EPFCYIDRSINNFIKSSPESPDYLNVRNIPTVPVSPKRISQIMKDPNSADKVAEANIINEELKKKINTNSNFGGWNSRASFARPGPVVSKKHGQLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKSLSGFGTLSRRELDEILTKRKEKV 2065
            + LD   +EE +   +  V   Q V +     ++L    Q K       + H F  ++    +V+   +DI SA+   ++  N+ P+   +           ++P +  + S    K  +V   D K       P+ D      ++   E+++ +LN   DDIE F+  L+   EA A L      +  K +   + +L  +AKP ++  ++  ++K+K S NLL KL   I+NP + +L+  L   L  + Q  S         +  P L+ D V  L   L+      +   GD W + R  W   +    Y P+F NG++  +E       E    G +SP         S++E     F+              +    S    F     +R  K  ++   F A    ELS+ + E++EVIE   DK WW   N  GQ GY P  +L     E    +D + +   K S  S   L   +   +P SP+         +   +  + + +N+EL K+I  + +          AR   V       + ++ +S+  +V  WL  K FS   ++ L + +G  LF L +DE+  +   E A R+ S + VQK+     +    EL  I+ ++KEK+
Sbjct:   96 KLLDCDTMEELENFPLPTVHHSQTVLNKLRYPSVLLLVCQDKEQHK--PDIHFFHCDEVEADIVH---ADIDSALGDNKNGKNMRPQTLKMNQEKMKRQRETIIPPSESKGSAPAVK-GRVAAMDMKSVERRVSPQQDPESYEKLAQYIEKDVQILNCALDDIEIFVARLQKAAEAFAQLNQRNKSRKNKKRGPAEGMLTLRAKPPSEVEFIDSLQKLKLSFNLLAKLKKHIQNPSASELVHFLFGPLELVLQ--SCGSPDLPRSIISPHLSRDAVDFLRGHLTPKEMTIFELLGDGWTRPRADWPREQCAPLYIPKFRNGWEPPVELFRTSPWETECSGPMSP---------SSSEYRKKEFFG-------------SQSSLSSNGSFTAPSPIR--KYAKIRYHFVARNANELSVLQDEVLEVIED--DKQWWKLRNRSGQAGYVPYNILDVITPEELRVMDPAYSQSYKGSSPS-GSLGRGDSFDMPRSPR---------DKDIRTQQMDEVNDELLKRITASKS-------QPQARNFKVERHSTRAIPLSFNSSPAEVATWLNGKGFSKPTVDCLGVLSGAQLFSLEKDELKAVCGDEGA-RVYSQITVQKAQLE-KSRGDSELQNIMKRQKEKI 682          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Cavefish
Match: eps8l2 (EPS8 like 2 [Source:NCBI gene;Acc:103026465])

HSP 1 Score: 108.227 bits (269), Expect = 5.794e-24
Identity = 154/641 (24.02%), Postives = 266/641 (41.50%), Query Frame = 2
Query:  281 RWLDQVILEEFKLALITNVASHQQVPDNNYLSNILTFNTQIKTSSNVLTETHIFQLEDSNLHMVNYLASDIRSAI---ESATNLNPKNTPI----------KVLPSNNKRNSYSNEKMNKVKEYDSK-------PRND-----DISSRTERNLLLLNYCFDDIEFFLQHLKDQEEAQAIL------KNTKGKNLNDRLLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQAYSIYHNGKLSK-VKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWAGYK--EKYYPEFFNGYQIDLE-------ELMKDGIISPIADIPRRAVSNAEISHAIFYNQALPMIAQTDILENTVLSSREEDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLL-----EPFCYIDRSINNFIKSSPESPDYLNVRNIPTVPVSPKRISQIMKDPNSADKVAEANIINEELKKKINTNSNFGGWNSRASFARPGPVVSKKHGQLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKSLSGFGTLSRRELDEILTKRKEKV 2065
            + LD   +EE +   +  V   Q V +     ++L    Q K       + H F  ++    +V+   +DI SA+   ++  N+ P+   +           ++P +  + S    K  +V   D K       P+ D      ++   E+++ +LN   DDIE F+  L+   EA A L      +  K +   + +L  +AKP ++  ++  ++K+K S NLL KL   I+NP + +L+  L   L  + Q+     +  L + +  P L+ D V  L   L+      +   GD W + R  W   +    Y P+F NG++  +E       E    G +SP         S++E     F+              +    S    F     +R  K  ++   F A    ELS+ + E++EVIE   DK WW   N  GQ GY P  +L     E    +D + +   K S  S   L   +   +P SP+         +   +  + + +N+EL K+I  + +          AR   V       + ++ +S+  +V  WL  K FS   ++ L + +G  LF L +DE+  +   E A R+ S + VQK+     +    EL  I+ ++KEK+
Sbjct:   73 KLLDCDTMEELENFPLPTVHHSQTVLNKLRYPSVLLLVCQDKEQHK--PDIHFFHCDEVEADIVH---ADIDSALGDNKNGKNMRPQTLKMNQEKMKRQRETIIPPSESKGSAPAVK-GRVAAMDMKSVERRVSPQQDPESYEKLAQYIEKDVQILNCALDDIEIFVARLQKAAEAFAQLNQRNKSRKNKKRGPAEGMLTLRAKPPSEVEFIDSLQKLKLSFNLLAKLKKHIQNPSASELVHFLFGPLELVLQSCG---SPDLPRSIISPHLSRDAVDFLRGHLTPKEMTIFELLGDGWTRPRADWPREQCAPLYIPKFRNGWEPPVELFRTSPWETECSGPMSP---------SSSEYRKKEFFG-------------SQSSLSSNGSFTAPSPIR--KYAKIRYHFVARNANELSVLQDEVLEVIED--DKQWWKLRNRSGQAGYVPYNILDVITPEELRVMDPAYSQSYKGSSPS-GSLGRGDSFDMPRSPR---------DKDIRTQQMDEVNDELLKRITASKS-------QPQARNFKVERHSTRAIPLSFNSSPAEVATWLNGKGFSKPTVDCLGVLSGAQLFSLEKDELKAVCGDEGA-RVYSQITVQKAQLE-KSRGDSELQNIMKRQKEKI 659          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Cavefish
Match: eps8l2 (EPS8 like 2 [Source:NCBI gene;Acc:103026465])

HSP 1 Score: 108.227 bits (269), Expect = 7.941e-24
Identity = 157/641 (24.49%), Postives = 266/641 (41.50%), Query Frame = 2
Query:  281 RWLDQVILEEFKLALITNVASHQQVPDNNYLSNILTFNTQIKTSSNVLTETHIFQLEDSNLHMVNYLASDIRSAI---ESATNLNPKNTPI----------KVLPSNNKRNSYSNEKMNKVKEYDSK-------PRND-----DISSRTERNLLLLNYCFDDIEFFLQHLKDQEEAQAIL--KNTKGKNLNDRLLEG----KAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQAYSIYHNGKLSK-VKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWAGYK--EKYYPEFFNGYQIDLE-------ELMKDGIISPIADIPRRAVSNAEISHAIFYNQALPMIAQTDILENTVLSSREEDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLL-----EPFCYIDRSINNFIKSSPESPDYLNVRNIPTVPVSPKRISQIMKDPNSADKVAEANIINEELKKKINTNSNFGGWNSRASFARPGPVVSKKHGQLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKSLSGFGTLSRRELDEILTKRKEKV 2065
            + LD   +EE +   +  V   Q V +     ++L    Q K       + H F  ++    +V+   +DI SA+   ++  N+ P+   +           ++P +  + S    K  +V   D K       P+ D      ++   E+++ +LN   DDIE F+  L+   EA A L  +N   KN      EG    +AKP ++  ++  ++K+K S NLL KL   I+NP + +L+  L   L  + Q+     +  L + +  P L+ D V  L   L+      +   GD W + R  W   +    Y P+F NG++  +E       E    G +SP         S++E     F+              +    S    F     +R  K  ++   F A    ELS+ + E++EVIE   DK WW   N  GQ GY P  +L     E    +D + +   K S  S   L   +   +P SP+         +   +  + + +N+EL K+I  + +          AR   V       + ++ +S+  +V  WL  K FS   ++ L + +G  LF L +DE+  +   E A R+ S + VQK+     +    EL  I+ ++KEK+
Sbjct:   98 KLLDCDTMEELENFPLPTVHHSQTVLNKLRYPSVLLLVCQDKEQHK--PDIHFFHCDEVEADIVH---ADIDSALGDNKNGKNMRPQTLKMNQEKMKRQRETIIPPSESKGSAPAVK-GRVAAMDMKSVERRVSPQQDPESYEKLAQYIEKDVQILNCALDDIEIFVARLQKAAEAFAQLNQRNKSRKNKKRGPAEGMLTLRAKPPSEVEFIDSLQKLKLSFNLLAKLKKHIQNPSASELVHFLFGPLELVLQSCG---SPDLPRSIISPHLSRDAVDFLRGHLTPKEMTIFELLGDGWTRPRADWPREQCAPLYIPKFRNGWEPPVELFRTSPWETECSGPMSP---------SSSEYRKKEFFG-------------SQSSLSSNGSFTAPSPIR--KYAKIRYHFVARNANELSVLQDEVLEVIED--DKQWWKLRNRSGQAGYVPYNILDVITPEELRVMDPAYSQSYKGSSPS-GSLGRGDSFDMPRSPR---------DKDIRTQQMDEVNDELLKRITASKS-------QPQARNFKVERHSTRAIPLSFNSSPAEVATWLNGKGFSKPTVDCLGVLSGAQLFSLEKDELKAVCGDEGA-RVYSQITVQKAQLE-KSRGDSELQNIMKRQKEKI 684          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Cavefish
Match: eps8a (epidermal growth factor receptor pathway substrate 8 [Source:NCBI gene;Acc:103047627])

HSP 1 Score: 99.7525 bits (247), Expect = 3.294e-21
Identity = 95/359 (26.46%), Postives = 161/359 (44.85%), Query Frame = 2
Query:  563 NKRNSYSNEKMNKVKEYDSKPRNDDISSRTERNLLLLNYCFDDIEFFLQHLKDQEEA------QAILKNTKGKNLNDRLLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQAYSIYHNGKLSKVKE---PLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWAGYKEKYYP----EFFNGYQIDL-----EELMKDGIISPIADIPRRAVSNAEISHAIFYNQALPMIAQTDILENTVLSSREEDFCRSVTLRNGK-----LYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLLEPFCYIDRSINNFIKSSP 1570
            N++  Y  +K     E+D  P  +  ++R +R++ +LN+  DDIE F+  L+   EA      +   K +K K   + +L  +AKP  Q  ++ C +K K + NLL KL   I+NP +  L+  L   L  +     I+ +G +   K    PLLT + +  LH   +      W + GD W K R +W   K+ Y+P     F +G++  +     ++L +       A+I R+     E+S  + + QA                 R +DF  +    +G+       +    F A    ELS+ + E++EV++ +  K WW   N  G  GY PN +LE    I R+++   +  P
Sbjct:  240 NEQQDY--DKQRPYGEHDESP--EMTAARVDRDVQILNHILDDIEHFVTKLQKAAEAFNELSKRKKSKKSKKKGPGEGMLTLRAKPPGQEEFVDCFQKFKHAFNLLGKLKNHIQNPSAVDLVHFLFTPLRMV-----IHTSGGVDLAKSVVVPLLTREAIDFLHSAGTPEERHLWVTLGDGWTKCRLEWP--KDHYFPPHTLRFRDGWEPPVLVSREQDLTQLAETLAQAEIHRQ----EEVSRRLHHEQA-----------------RVQDFPIADGSYDGRGQPRNFAKSKYDFVARNGTELSVVKDEVVEVMDDR--KQWWKVRNATGATGYVPNNILE----ISRAVDMTGRGEP 560          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010635.1 (pep scaffold:Pmarinus_7.0:GL476906:83540:115491:1 gene:ENSPMAG00000009631.1 transcript:ENSPMAT00000010635.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.1738 bits (178), Expect = 1.189e-13
Identity = 78/286 (27.27%), Postives = 120/286 (41.96%), Query Frame = 2
Query:  647 RTERNLLLLNYCFDDIEFFLQHLKDQEEAQAILKNTKGKNL----------NDRLLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQAYSIYHNGKLSKVK---EPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWAGYK--EKYYPEF-------FNGYQIDLEELMKDGIISPIADIPRRAVSNAEISHAIFYNQALPMIAQTDILENTVLSS-REEDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEV 1435
            R +R+  +LN+ FD+IE F+  L  Q+ AQA   N  GK             D +L  ++KP     ++  ++K K+  NLL +L G I NP + ++I  L   L  I     ++  G L  V+    PLLT   + +L+   +    K W S G+ W   R +W   K    Y P F       FN   I       D   +P+   PRR          I     LP+   + +  +   S  R +D   S      ++ R   TF A    E+S+ + +I+EV
Sbjct:  248 RVQRDTEILNHLFDEIEGFVAKL--QKAAQAF--NELGKRKKQKRSKKKKNGDGILTLRSKPPPPEEFVDILQKFKYGFNLLARLKGIIDNPSAEEMITSLFPPLQMI-----LHACGGLDMVRCVASPLLTRQAIDILNTSTNPEQRKLWLSLGNAWSVTRAEWPADKPLPSYIPRFPNWEPERFNVPPIAHAHDSPDA--APMPSSPRR----------IAPETQLPITVPSSLRHHLAASGPRRDDDAHS-----KRMARASYTFTARNKNEISVEKDDILEV 507          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001720.1 (pep scaffold:Pmarinus_7.0:GL477470:1323:5557:1 gene:ENSPMAG00000001552.1 transcript:ENSPMAT00000001720.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.8322 bits (120), Expect = 3.691e-7
Identity = 69/268 (25.75%), Postives = 120/268 (44.78%), Query Frame = 2
Query:  779 LLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQAYSIYHNGKLSK-VKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNW------------CKAREKWAGYKEK------YYPEFFNGYQIDLEELMKDGIISPIADIPRRAVSNAEISHAIFYNQALPMIAQTDILENTVLSSREEDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWW-LCGNMHGQKGYSPNTLLEP 1522
            +L  +AKP T+  ++ C++KIKFS NLL +L   + +P + + +  L + L ++ Q        +L++ V  PLLT D + LL    S      W+S G+ W            C  R + +    K      Y P F +G+Q  +++              + +  +AE S       A P   QT I  + +  +  +  CR        + R +  + A    E+S+  G+I++V++S   ++WW +  N   Q GY P+ +LEP
Sbjct:   12 VLTLRAKPPTEEEFIECLQKIKFSFNLLARLKDHLHDPTAEEHVQSLFQTLTRVVQESG---GPELAETVVSPLLTRDALLLLAPSTSGDGIHLWSSLGEAWSTPRSGTNPSSLCSQRRQSSSAWNKPAPVPHYVPVFRSGWQPHVQK--------------KVSFVDAEPSQP--SPSAWPP-GQTRI--DPIYEAEIDCSCRG-------MARCLYDYVARSSSEISVLAGDILQVLDST--RSWWKVASNGAQQMGYVPHNILEP 248          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Nematostella
Match: EDO29184 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4C9])

HSP 1 Score: 56.225 bits (134), Expect = 3.187e-8
Identity = 54/204 (26.47%), Postives = 97/204 (47.55%), Query Frame = 2
Query:  293 QVILEEFKLALITNVASHQQVPDNNYLSNILTFNTQIKTSSNVLTETHIFQLEDSNLHMVNYLASDIRSAIESATNLNPKNTPIKVLPSNNKRNSYSNEKMNKVKEYDSKPRNDDISSRTERNLLLLNYCFDDIEFFLQHLKDQEEAQAILKNTKGKNLNDRLLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQ 904
            Q ++E + LA I  V   Q + D+  L+++L F+T    + +    TH+FQ +   + + +  A  +  A  S  + +    P +V P  + +     E  N ++          + +RT R++ +LN+C DDIE  +   K   EA   L+  KGK   D  L  +A+P  +  ++   +K K + NLL +L   I NP++ +
Sbjct:   73 QNVIEVYPLASIGTV---QHISDDTDLNSVLLFSTL--QTDDKYAATHLFQSD--RVPVASGYAFYLTIAAFSVHSQSNIKKPSRV-PRGSSQGDGEQEDSNSLEA---------LEARTNRDVQILNHCIDDIENLVWRTKRSAEAWKKLQKKKGKVKADSQLALEARPPPEADFVDAFQKFKHAFNLLARLRQHIHNPNASE 259          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Medaka
Match: eps8l1b (epidermal growth factor receptor kinase substrate 8-like protein 1 [Source:NCBI gene;Acc:101168497])

HSP 1 Score: 155.221 bits (391), Expect = 8.936e-40
Identity = 135/503 (26.84%), Postives = 232/503 (46.12%), Query Frame = 2
Query:  647 RTERNLLLLNYCFDDIEFFLQHLKDQEEAQAILKN--------TKGKNLNDRLLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQAYSIYHNGKLSKVKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWAGYKEKYYPEFFNGYQIDLEELMKDGII--SPIADIPRRAVSNAEISHAIFYNQALPMIAQTDILENTVLSSRE--EDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLLEPFCYIDRSINNFIKSSPESPDYLNVRNI----PTVPVSPKRISQIMKDPNS----------ADKVAEANIINEELKKKINTNSNFGGWNSRASFARPGPVVSKKHGQLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKSLSGFGTLSRR--ELDEILTKRKEKVEI 2071
            R ER + +LN+CFDDIE F+  L+   +A  +L          +K ++  D +L  KA+P     ++   +K K+  +LL +L   I +P S +L+  + + L  + +       G  + V  P +T   + LL + L++   + WTS G NW   R K  G    Y P F +G++   E    DG +   P+           E  H    ++AL +  +    ++  LS R   ED   ++     +LY     F A  + ELS+ +GE +EVIES   K WW C N   Q G+ P  +LEP  +I+   N    +    P     + +    P+ P  P+  S   + P++          AD+  +  ++N+EL +++         N +A+  +P  +       + ++  S  E+V +WL  K FS   ++ L +  G  LF L++DE+  ++  E   R+ S + VQK+L      +RR  EL+ ++ K+K KV++
Sbjct:   45 RAEREVGILNHCFDDIESFMGKLQQTADAALVLSQRKTKKKKKSKKQSAEDEMLAAKAQPPQAEEFVEIFQKFKYCFSLLARLKSTIVSPSSEELVHHVFKPLDMMVKTTGGPAMG--AAVSSPAMTNSAISLLQETLNEEEKQLWTSLGPNWTHPRSKLRGPVAPYTPVFLDGWKP--EAARADGQVWEDPV-----------ESQHK---HEALLVKQEQQPPQSKRLSDRNNYEDMV-ALPPDAERLYSCSYDFIARNNSELSVQQGETLEVIES--SKRWWKCRNRFNQIGFVPFNILEPVTHIEHPTNGPPPAPTPPPANAPPKTLLGVQPSPPALPRTASSSPQRPHTLPSYNQAVQVADETDKVMLVNDELLQRLT--------NGKANLNKPLVIPRSSETSVPLDYHSPPEEVTEWLRGKGFSEPTVKCLGVLTGAQLFSLTKDELREVIPEE-GTRVYSQLTVQKALL---EDARRATELEAVMEKQKMKVDL 514          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Medaka
Match: eps8l1b (epidermal growth factor receptor kinase substrate 8-like protein 1 [Source:NCBI gene;Acc:101168497])

HSP 1 Score: 154.836 bits (390), Expect = 5.725e-39
Identity = 135/503 (26.84%), Postives = 232/503 (46.12%), Query Frame = 2
Query:  647 RTERNLLLLNYCFDDIEFFLQHLKDQEEAQAILKN--------TKGKNLNDRLLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQAYSIYHNGKLSKVKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWAGYKEKYYPEFFNGYQIDLEELMKDGII--SPIADIPRRAVSNAEISHAIFYNQALPMIAQTDILENTVLSSRE--EDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLLEPFCYIDRSINNFIKSSPESPDYLNVRNI----PTVPVSPKRISQIMKDPNS----------ADKVAEANIINEELKKKINTNSNFGGWNSRASFARPGPVVSKKHGQLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKSLSGFGTLSRR--ELDEILTKRKEKVEI 2071
            R ER + +LN+CFDDIE F+  L+   +A  +L          +K ++  D +L  KA+P     ++   +K K+  +LL +L   I +P S +L+  + + L  + +       G  + V  P +T   + LL + L++   + WTS G NW   R K  G    Y P F +G++   E    DG +   P+           E  H    ++AL +  +    ++  LS R   ED   ++     +LY     F A  + ELS+ +GE +EVIES   K WW C N   Q G+ P  +LEP  +I+   N    +    P     + +    P+ P  P+  S   + P++          AD+  +  ++N+EL +++         N +A+  +P  +       + ++  S  E+V +WL  K FS   ++ L +  G  LF L++DE+  ++  E   R+ S + VQK+L      +RR  EL+ ++ K+K KV++
Sbjct:  191 RAEREVGILNHCFDDIESFMGKLQQTADAALVLSQRKTKKKKKSKKQSAEDEMLAAKAQPPQAEEFVEIFQKFKYCFSLLARLKSTIVSPSSEELVHHVFKPLDMMVKTTGGPAMG--AAVSSPAMTNSAISLLQETLNEEEKQLWTSLGPNWTHPRSKLRGPVAPYTPVFLDGWKP--EAARADGQVWEDPV-----------ESQHK---HEALLVKQEQQPPQSKRLSDRNNYEDMV-ALPPDAERLYSCSYDFIARNNSELSVQQGETLEVIES--SKRWWKCRNRFNQIGFVPFNILEPVTHIEHPTNGPPPAPTPPPANAPPKTLLGVQPSPPALPRTASSSPQRPHTLPSYNQAVQVADETDKVMLVNDELLQRLT--------NGKANLNKPLVIPRSSETSVPLDYHSPPEEVTEWLRGKGFSEPTVKCLGVLTGAQLFSLTKDELREVIPEE-GTRVYSQLTVQKALL---EDARRATELEAVMEKQKMKVDL 660          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Medaka
Match: EPS8L2 (EPS8 like 2 [Source:NCBI gene;Acc:101169604])

HSP 1 Score: 120.553 bits (301), Expect = 8.217e-28
Identity = 136/503 (27.04%), Postives = 219/503 (43.54%), Query Frame = 2
Query:  629 NDDISSRTERNLLLLNYCFDDIEFFLQHLKDQEEAQAILKN------TKGKNLNDRLLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQAYSIYHNGKLSK-VKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWA--GYKEKYYPEFFNGYQIDLEELMKDGIISPIADIPRRAVSNAEISHAIFYNQALPMIAQTDILENTVLSSREEDFCRSVTLR-----------NGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLLEPFCYIDRSINNFIKSSPESPDYLNVRNIPTVPVSPKRISQIMKDPNSADKVAEANIINEELKKKINTNSNFGGWNSRASFARPGPVVSKKHG---QLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKSLSGFGTLSRRELDEILTKRKEKVE 2068
            ++++  R E+++ +LN   DDIE F+  L+   EA + LK        K K   + +L  +AKP ++  ++  ++K+K +LNLL KL   I+NP++ +L+  L   L  + Q      +  L++ +  P L++DTV  L   L+      +   GD W K R +W        YYP+F NG++             P A++   A    E     F  Q  P  +  D  +++      ED+  + +             N K  ++   F A    ELS+ + EI+EV+E   DK WW   N  GQ GY P  +L+     D          P+ P   N ++  T P              + DK  +   +N EL KKI            AS  +P  ++  K     Q+ +  DS    V  WL  K FS   ++ L I  G  LF L++DE+ + V  +   R+   V VQK      + S  EL EI+ +R+E+++
Sbjct:  206 HENLPQRIEKDVQILNCALDDIEIFVARLQKAAEAFSQLKQRNKSKKNKKKGPAEGMLTLRAKPPSEAEFIDSLQKLKLALNLLTKLRKHIQNPNASELVHFLFGPLELVLQTCG---SPDLARSIISPHLSKDTVDFLRGHLTPKETTIFELLGDGWTKPRAEWPRDQCAPPYYPKFRNGWE-------------PPAELFLTASWETEGPSGQFAGQHGPPFS-PDYRQHS-----SEDYYGTHSSNSSNGSYSEKPNNRKFAKIRYNFVARNANELSVLQDEILEVLED--DKQWWKLRNRSGQAGYVPFNVLDVVKIED----------PDVP--YNQKSFMTSPSGSASREDSFNKGITKDKAMDE--VNNELLKKIT-----------ASKTQPPKLIHVKRTPSTQVPLTSDSNPGQVTAWLNAKGFSKPTVDCLGILTGAQLFSLNKDEL-KAVCGDEGGRVYFQVTVQKEQVEKSSGS-SELQEIMKRRQERID 657          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Medaka
Match: EPS8L2 (EPS8 like 2 [Source:NCBI gene;Acc:101169604])

HSP 1 Score: 120.553 bits (301), Expect = 9.372e-28
Identity = 136/503 (27.04%), Postives = 220/503 (43.74%), Query Frame = 2
Query:  629 NDDISSRTERNLLLLNYCFDDIEFFLQHLKDQEEAQAILKN------TKGKNLNDRLLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQAYSIYHNGKLSK-VKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWAGYK--EKYYPEFFNGYQIDLEELMKDGIISPIADIPRRAVSNAEISHAIFYNQALPMIAQTDILENTVLSSREEDFCRSVTLR-----------NGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLLEPFCYIDRSINNFIKSSPESPDYLNVRNIPTVPVSPKRISQIMKDPNSADKVAEANIINEELKKKINTNSNFGGWNSRASFARPGPVVSKKHG---QLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKSLSGFGTLSRRELDEILTKRKEKVE 2068
            ++++  R E+++ +LN   DDIE F+  L+   EA + LK        K K   + +L  +AKP ++  ++  ++K+K +LNLL KL   I+NP++ +L+  L   L  + Q      +  L++ +  P L++DTV  L   L+      +   GD W K R +W   +    YYP+F NG++             P A++   A    E     F  Q  P  +  D  +++      ED+  + +             N K  ++   F A    ELS+ + EI+EV+E   DK WW   N  GQ GY P  +L+     D          P+ P   N ++  T P              + DK  +   +N EL KKI            AS  +P  ++  K     Q+ +  DS    V  WL  K FS   ++ L I  G  LF L++DE+ + V  +   R+   V VQK      + S  EL EI+ +R+E+++
Sbjct:  233 HENLPQRIEKDVQILNCALDDIEIFVARLQKAAEAFSQLKQRNKSKKNKKKGPAEGMLTLRAKPPSEAEFIDSLQKLKLALNLLTKLRKHIQNPNASELVHFLFGPLELVLQTCG---SPDLARSIISPHLSKDTVDFLRGHLTPKETTIFELLGDGWTKPRAEWPRDQCAPPYYPKFRNGWE-------------PPAELFLTASWETEGPSGQFAGQHGPPFS-PDYRQHS-----SEDYYGTHSSNSSNGSYSEKPNNRKFAKIRYNFVARNANELSVLQDEILEVLED--DKQWWKLRNRSGQAGYVPFNVLDVVKIED----------PDVP--YNQKSFMTSPSGSASREDSFNKGITKDKAMDE--VNNELLKKIT-----------ASKTQPPKLIHVKRTPSTQVPLTSDSNPGQVTAWLNAKGFSKPTVDCLGILTGAQLFSLNKDEL-KAVCGDEGGRVYFQVTVQKEQVEKSSGS-SELQEIMKRRQERID 684          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Medaka
Match: EPS8L2 (EPS8 like 2 [Source:NCBI gene;Acc:101169604])

HSP 1 Score: 120.168 bits (300), Expect = 1.055e-27
Identity = 136/503 (27.04%), Postives = 219/503 (43.54%), Query Frame = 2
Query:  629 NDDISSRTERNLLLLNYCFDDIEFFLQHLKDQEEAQAILKN------TKGKNLNDRLLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQAYSIYHNGKLSK-VKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWA--GYKEKYYPEFFNGYQIDLEELMKDGIISPIADIPRRAVSNAEISHAIFYNQALPMIAQTDILENTVLSSREEDFCRSVTLR-----------NGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLLEPFCYIDRSINNFIKSSPESPDYLNVRNIPTVPVSPKRISQIMKDPNSADKVAEANIINEELKKKINTNSNFGGWNSRASFARPGPVVSKKHG---QLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKSLSGFGTLSRRELDEILTKRKEKVE 2068
            ++++  R E+++ +LN   DDIE F+  L+   EA + LK        K K   + +L  +AKP ++  ++  ++K+K +LNLL KL   I+NP++ +L+  L   L  + Q      +  L++ +  P L++DTV  L   L+      +   GD W K R +W        YYP+F NG++             P A++   A    E     F  Q  P  +  D  +++      ED+  + +             N K  ++   F A    ELS+ + EI+EV+E   DK WW   N  GQ GY P  +L+     D          P+ P   N ++  T P              + DK  +   +N EL KKI            AS  +P  ++  K     Q+ +  DS    V  WL  K FS   ++ L I  G  LF L++DE+ + V  +   R+   V VQK      + S  EL EI+ +R+E+++
Sbjct:  234 HENLPQRIEKDVQILNCALDDIEIFVARLQKAAEAFSQLKQRNKSKKNKKKGPAEGMLTLRAKPPSEAEFIDSLQKLKLALNLLTKLRKHIQNPNASELVHFLFGPLELVLQTCG---SPDLARSIISPHLSKDTVDFLRGHLTPKETTIFELLGDGWTKPRAEWPRDQCAPPYYPKFRNGWE-------------PPAELFLTASWETEGPSGQFAGQHGPPFS-PDYRQHS-----SEDYYGTHSSNSSNGSYSEKPNNRKFAKIRYNFVARNANELSVLQDEILEVLED--DKQWWKLRNRSGQAGYVPFNVLDVVKIED----------PDVP--YNQKSFMTSPSGSASREDSFNKGITKDKAMDE--VNNELLKKIT-----------ASKTQPPKLIHVKRTPSTQVPLTSDSNPGQVTAWLNAKGFSKPTVDCLGILTGAQLFSLNKDEL-KAVCGDEGGRVYFQVTVQKEQVEKSSGS-SELQEIMKRRQERID 685          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Planmine SMEST
Match: SMESG000070650.1 (SMESG000070650.1)

HSP 1 Score: 1357.81 bits (3513), Expect = 0.000e+0
Identity = 670/671 (99.85%), Postives = 671/671 (100.00%), Query Frame = 2
Query:   71 MNGTYLKMDSSKSKTKWVARHFGSFMQTGTGKDSTNKALNELCSQIDDGRFRELQCNIEIDRERQVLVIRRWLDQVILEEFKLALITNVASHQQVPDNNYLSNILTFNTQIKTSSNVLTETHIFQLEDSNLHMVNYLASDIRSAIESATNLNPKNTPIKVLPSNNKRNSYSNEKMNKVKEYDSKPRNDDISSRTERNLLLLNYCFDDIEFFLQHLKDQEEAQAILKNTKGKNLNDRLLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQAYSIYHNGKLSKVKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWAGYKEKYYPEFFNGYQIDLEELMKDGIISPIADIPRRAVSNAEISHAIFYNQALPMIAQTDILENTVLSSREEDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLLEPFCYIDRSINNFIKSSPESPDYLNVRNIPTVPVSPKRISQIMKDPNSADKVAEANIINEELKKKINTNSNFGGWNSRASFARPGPVVSKKHGQLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKSLSGFGTLSRRELDEILTKRKEKVEITETF 2083
            MNGTYLKMDSSKSKTKWVARHFGSFMQTGTGKDSTNKALNELCSQIDDGRFRELQCNIEIDRERQVLVIRRWLDQVILEEFKLALITNVASHQQVPDNNYLSNILTFNTQIKTSSNVLTETHIFQLEDSNLHMVNYLASDIRSAIESATNLNPKNTPIKVLPSNNKRNSYSNEKMNKVKEY+SKPRNDDISSRTERNLLLLNYCFDDIEFFLQHLKDQEEAQAILKNTKGKNLNDRLLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQLILLLIENLLKIGQAYSIYHNGKLSKVKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWAGYKEKYYPEFFNGYQIDLEELMKDGIISPIADIPRRAVSNAEISHAIFYNQALPMIAQTDILENTVLSSREEDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLLEPFCYIDRSINNFIKSSPESPDYLNVRNIPTVPVSPKRISQIMKDPNSADKVAEANIINEELKKKINTNSNFGGWNSRASFARPGPVVSKKHGQLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKSLSGFGTLSRRELDEILTKRKEKVEITETF
Sbjct:    1 MNGTYLKMDSSKSKTKWVARHFGSFMQTGTGKDSTNKALNELCSQIDDGRFRELQCNIEIDRERQVLVIRRWLDQVILEEFKLALITNVASHQQVPDNNYLSNILTFNTQIKTSSNVLTETHIFQLEDSNLHMVNYLASDIRSAIESATNLNPKNTPIKVLPSNNKRNSYSNEKMNKVKEYESKPRNDDISSRTERNLLLLNYCFDDIEFFLQHLKDQEEAQAILKNTKGKNLNDRLLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQLILLLIENLLKIGQAYSIYHNGKLSKVKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWAGYKEKYYPEFFNGYQIDLEELMKDGIISPIADIPRRAVSNAEISHAIFYNQALPMIAQTDILENTVLSSREEDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLLEPFCYIDRSINNFIKSSPESPDYLNVRNIPTVPVSPKRISQIMKDPNSADKVAEANIINEELKKKINTNSNFGGWNSRASFARPGPVVSKKHGQLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKSLSGFGTLSRRELDEILTKRKEKVEITETF 671          
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Planmine SMEST
Match: SMESG000070650.1 (SMESG000070650.1)

HSP 1 Score: 1342.41 bits (3473), Expect = 0.000e+0
Identity = 663/664 (99.85%), Postives = 664/664 (100.00%), Query Frame = 2
Query:   92 MDSSKSKTKWVARHFGSFMQTGTGKDSTNKALNELCSQIDDGRFRELQCNIEIDRERQVLVIRRWLDQVILEEFKLALITNVASHQQVPDNNYLSNILTFNTQIKTSSNVLTETHIFQLEDSNLHMVNYLASDIRSAIESATNLNPKNTPIKVLPSNNKRNSYSNEKMNKVKEYDSKPRNDDISSRTERNLLLLNYCFDDIEFFLQHLKDQEEAQAILKNTKGKNLNDRLLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQXXXXXXXXXXXXGQAYSIYHNGKLSKVKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWAGYKEKYYPEFFNGYQIDLEELMKDGIISPIADIPRRAVSNAEISHAIFYNQALPMIAQTDILENTVLSSREEDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLLEPFCYIDRSINNFIKSSPESPDYLNVRNIPTVPVSPKRISQIMKDPNSADKVAEANIINEELKKKINTNSNFGGWNSRASFARPGPVVSKKHGQLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKSLSGFGTLSRRELDEILTKRKEKVEITETF 2083
            MDSSKSKTKWVARHFGSFMQTGTGKDSTNKALNELCSQIDDGRFRELQCNIEIDRERQVLVIRRWLDQVILEEFKLALITNVASHQQVPDNNYLSNILTFNTQIKTSSNVLTETHIFQLEDSNLHMVNYLASDIRSAIESATNLNPKNTPIKVLPSNNKRNSYSNEKMNKVKEY+SKPRNDDISSRTERNLLLLNYCFDDIEFFLQHLKDQEEAQAILKNTKGKNLNDRLLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQLILLLIENLLKIGQAYSIYHNGKLSKVKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWAGYKEKYYPEFFNGYQIDLEELMKDGIISPIADIPRRAVSNAEISHAIFYNQALPMIAQTDILENTVLSSREEDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLLEPFCYIDRSINNFIKSSPESPDYLNVRNIPTVPVSPKRISQIMKDPNSADKVAEANIINEELKKKINTNSNFGGWNSRASFARPGPVVSKKHGQLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKSLSGFGTLSRRELDEILTKRKEKVEITETF
Sbjct:    1 MDSSKSKTKWVARHFGSFMQTGTGKDSTNKALNELCSQIDDGRFRELQCNIEIDRERQVLVIRRWLDQVILEEFKLALITNVASHQQVPDNNYLSNILTFNTQIKTSSNVLTETHIFQLEDSNLHMVNYLASDIRSAIESATNLNPKNTPIKVLPSNNKRNSYSNEKMNKVKEYESKPRNDDISSRTERNLLLLNYCFDDIEFFLQHLKDQEEAQAILKNTKGKNLNDRLLEGKAKPSTQNAYLTCIEKIKFSLNLLCKLDGKIKNPDSRQLILLLIENLLKIGQAYSIYHNGKLSKVKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWAGYKEKYYPEFFNGYQIDLEELMKDGIISPIADIPRRAVSNAEISHAIFYNQALPMIAQTDILENTVLSSREEDFCRSVTLRNGKLYRVIATFAASKDEELSMSEGEIIEVIESKPDKNWWLCGNMHGQKGYSPNTLLEPFCYIDRSINNFIKSSPESPDYLNVRNIPTVPVSPKRISQIMKDPNSADKVAEANIINEELKKKINTNSNFGGWNSRASFARPGPVVSKKHGQLSINQDSTSEDVQKWLEYKKFSPSDIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKSLSGFGTLSRRELDEILTKRKEKVEITETF 664          
The following BLAST results are available for this feature:
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EPS8L11.103e-3326.84EPS8 like 1 [Source:HGNC Symbol;Acc:HGNC:21295][more]
EPS8L11.961e-3326.84EPS8 like 1 [Source:HGNC Symbol;Acc:HGNC:21295][more]
EPS8L12.946e-3326.84EPS8 like 1 [Source:HGNC Symbol;Acc:HGNC:21295][more]
EPS8L21.387e-2625.19EPS8 like 2 [Source:HGNC Symbol;Acc:HGNC:21296][more]
EPS8L21.387e-2625.19EPS8 like 2 [Source:HGNC Symbol;Acc:HGNC:21296][more]
back to top
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eps-89.026e-1324.80EPS (Human endocytosis) related [Source:UniProtKB... [more]
eps-89.026e-1324.80EPS (Human endocytosis) related [Source:UniProtKB... [more]
eps-89.026e-1324.80EPS (Human endocytosis) related [Source:UniProtKB... [more]
eps-89.026e-1324.80EPS (Human endocytosis) related [Source:UniProtKB... [more]
eps-89.026e-1324.80EPS (Human endocytosis) related [Source:UniProtKB... [more]
back to top
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG89074.647e-2123.80gene:FBgn0038466 transcript:FBtr0305271[more]
CG89074.761e-2123.80gene:FBgn0038466 transcript:FBtr0083372[more]
aru1.958e-1631.11gene:FBgn0029095 transcript:FBtr0078033[more]
aru2.188e-1631.11gene:FBgn0029095 transcript:FBtr0078032[more]
aru2.188e-1631.11gene:FBgn0029095 transcript:FBtr0078031[more]
back to top
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eps8l1b2.626e-4026.76eps8 like 1b [Source:ZFIN;Acc:ZDB-GENE-050506-143][more]
eps8l1a5.511e-4026.91eps8 like 1a [Source:ZFIN;Acc:ZDB-GENE-050306-14][more]
eps8l1a1.097e-3926.91eps8 like 1a [Source:ZFIN;Acc:ZDB-GENE-050306-14][more]
eps8l22.638e-2727.66EPS8 like 2 [Source:ZFIN;Acc:ZDB-GENE-131121-340][more]
eps8l22.938e-2727.66EPS8 like 2 [Source:ZFIN;Acc:ZDB-GENE-131121-340][more]
back to top
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eps81.466e-2925.74epidermal growth factor receptor pathway substrate... [more]
EPS8L23.200e-2928.20EPS8-like 2 [Source:NCBI gene;Acc:100489749][more]
EPS8L23.754e-2928.20EPS8-like 2 [Source:NCBI gene;Acc:100489749][more]
EPS8L24.193e-2928.20EPS8-like 2 [Source:NCBI gene;Acc:100489749][more]
eps84.710e-2824.73epidermal growth factor receptor pathway substrate... [more]
back to top
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Eps8l18.058e-3227.93EPS8-like 1 [Source:MGI Symbol;Acc:MGI:1914675][more]
Eps8l18.058e-3227.93EPS8-like 1 [Source:MGI Symbol;Acc:MGI:1914675][more]
Eps8l18.991e-3227.93EPS8-like 1 [Source:MGI Symbol;Acc:MGI:1914675][more]
Eps8l27.485e-2725.75EPS8-like 2 [Source:MGI Symbol;Acc:MGI:2138828][more]
Eps8l32.004e-2029.69EPS8-like 3 [Source:MGI Symbol;Acc:MGI:2139743][more]
back to top
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8TE68|ES8L1_HUMAN1.415e-3226.84Epidermal growth factor receptor kinase substrate ... [more]
sp|Q8R5F8|ES8L1_MOUSE5.637e-3127.93Epidermal growth factor receptor kinase substrate ... [more]
sp|Q99K30|ES8L2_MOUSE5.235e-2625.75Epidermal growth factor receptor kinase substrate ... [more]
sp|Q9H6S3|ES8L2_HUMAN6.661e-2625.19Epidermal growth factor receptor kinase substrate ... [more]
sp|Q5RC07|ES8L2_PONAB3.321e-2524.95Epidermal growth factor receptor kinase substrate ... [more]
back to top
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P8S5V13.701e-3827.77Eps8 like 1b OS=Amphiprion percula OX=161767 PE=4 ... [more]
A0A3Q1BX775.243e-3827.71Eps8 like 1b OS=Amphiprion ocellaris OX=80972 PE=4... [more]
A0A482W1689.566e-3825.66Epidermal growth factor receptor kinase substrate ... [more]
A0A1S3JAS11.283e-3728.88epidermal growth factor receptor kinase substrate ... [more]
H2UXA01.543e-3727.60Eps8 like 1b OS=Takifugu rubripes OX=31033 GN=LOC1... [more]
back to top
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eps8l1a9.680e-3125.49eps8 like 1a [Source:ZFIN;Acc:ZDB-GENE-050306-14][more]
eps8l24.554e-2424.06EPS8 like 2 [Source:NCBI gene;Acc:103026465][more]
eps8l25.794e-2424.02EPS8 like 2 [Source:NCBI gene;Acc:103026465][more]
eps8l27.941e-2424.49EPS8 like 2 [Source:NCBI gene;Acc:103026465][more]
eps8a3.294e-2126.46epidermal growth factor receptor pathway substrate... [more]
back to top
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000010635.11.189e-1327.27pep scaffold:Pmarinus_7.0:GL476906:83540:115491:1 ... [more]
ENSPMAT00000001720.13.691e-725.75pep scaffold:Pmarinus_7.0:GL477470:1323:5557:1 gen... [more]
back to top
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO291843.187e-826.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eps8l1b8.936e-4026.84epidermal growth factor receptor kinase substrate ... [more]
eps8l1b5.725e-3926.84epidermal growth factor receptor kinase substrate ... [more]
EPS8L28.217e-2827.04EPS8 like 2 [Source:NCBI gene;Acc:101169604][more]
EPS8L29.372e-2827.04EPS8 like 2 [Source:NCBI gene;Acc:101169604][more]
EPS8L21.055e-2727.04EPS8 like 2 [Source:NCBI gene;Acc:101169604][more]
back to top
BLAST of Epidermal growth factor receptor kinase substrate 8 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000070650.10.000e+099.85SMESG000070650.1[more]
SMESG000070650.10.000e+099.85SMESG000070650.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011084 ID=SMED30011084|Name=Epidermal growth factor receptor kinase substrate 8|organism=Schmidtea mediterranea sexual|type=transcript|length=2345bp
TTCATTAATAAAAGTTTGTGGTATTTCAAATACTTATTATTAGGATAATA
AAAATTTTTTCTGTTACCAAATGAATGGCACCTATTTAAAAATGGACTCA
AGTAAAAGTAAAACAAAATGGGTAGCGCGACATTTCGGTAGTTTTATGCA
AACTGGAACTGGAAAAGATTCAACGAATAAAGCTTTAAATGAACTTTGTT
CGCAAATTGACGATGGAAGGTTTCGTGAACTTCAGTGTAACATTGAAATC
GATAGAGAAAGACAGGTTTTAGTGATTCGACGATGGCTAGATCAGGTGAT
TCTTGAAGAATTCAAACTCGCCTTAATAACTAATGTCGCCAGTCACCAAC
AAGTGCCCGATAACAACTACTTATCCAACATTTTAACATTCAACACCCAA
ATTAAAACCTCTTCAAATGTTTTGACAGAAACCCACATCTTTCAATTAGA
AGATTCCAATCTGCACATGGTAAATTATCTTGCTTCAGATATTCGATCTG
CAATTGAAAGTGCGACAAATCTCAATCCGAAAAATACACCTATCAAAGTT
TTACCTTCGAATAATAAACGAAACAGTTACTCAAATGAAAAGATGAACAA
AGTCAAAGAATATGACTCGAAACCGAGAAATGATGATATCTCGTCAAGAA
CTGAAAGAAATCTTTTGTTATTAAATTATTGTTTCGACGACATCGAATTC
TTTTTACAGCATTTAAAAGATCAAGAAGAAGCTCAAGCAATTTTGAAAAA
TACTAAAGGAAAAAATTTAAACGACCGATTGCTGGAAGGAAAAGCCAAAC
CCTCTACTCAAAATGCATATCTAACTTGTATTGAAAAGATAAAATTCTCA
CTCAATCTTCTCTGTAAGTTAGATGGGAAAATTAAAAATCCTGACAGTCG
ACAACTCATTTTACTTCTCATTGAAAACTTATTGAAAATCGGTCAAGCAT
ACTCAATATATCACAACGGAAAGTTAAGTAAAGTTAAAGAACCATTGTTG
ACAGAAGACACCGTAAAACTGCTTCATCAATGTCTTAGCAAGCATTATCA
CAAACAGTGGACGAGCTGGGGTGACAATTGGTGTAAGGCTAGAGAAAAAT
GGGCCGGTTACAAAGAAAAATATTATCCAGAATTTTTTAATGGTTATCAA
ATTGACCTTGAAGAATTAATGAAAGATGGTATTATTAGTCCAATTGCTGA
TATTCCAAGAAGAGCGGTCAGTAATGCCGAAATTAGCCATGCAATATTTT
ATAATCAAGCATTACCAATGATTGCCCAAACTGATATTTTGGAAAATACA
GTTCTATCGTCAAGGGAGGAAGATTTTTGTCGCAGTGTAACTTTACGAAA
CGGAAAACTCTATCGAGTAATTGCTACGTTTGCCGCGTCAAAGGATGAAG
AGTTGTCAATGTCAGAAGGAGAGATAATTGAGGTTATTGAAAGTAAACCA
GATAAGAATTGGTGGCTATGTGGCAACATGCATGGTCAAAAAGGTTACAG
TCCAAACACATTATTAGAGCCATTCTGCTATATTGATAGATCAATCAATA
ACTTTATTAAATCGAGCCCAGAATCACCTGACTACTTGAACGTTAGAAAT
ATTCCGACAGTTCCAGTTTCCCCCAAGCGAATCAGTCAAATTATGAAAGA
TCCGAACTCTGCAGATAAGGTTGCTGAAGCTAACATTATTAATGAAGAAC
TTAAAAAGAAGATTAATACCAATTCCAATTTTGGTGGCTGGAATTCTAGA
GCTTCGTTTGCTAGACCAGGTCCAGTTGTTTCTAAGAAACATGGACAATT
GTCAATTAATCAGGATTCGACTAGTGAGGATGTTCAAAAATGGTTAGAAT
ACAAAAAGTTTTCTCCAAGTGATATTGAAAAATTAAAAATTTTTAATGGA
CAAACTTTGTTTCTTCTTTCTCGTGATGAAATGGTTCGAATAGTAAGTTC
TGAAGTTGCAAATAGATTGGATAGTCTGGTTAAAGTACAGAAGAGTTTAT
CTGGATTTGGTACACTGAGTCGTCGTGAACTTGATGAAATTTTAACAAAA
AGAAAAGAGAAAGTAGAAATTACTGAAACATTTTAAATTTATCACAATTC
ATTTTATCCTAGAATTGAATGATTCTAAATTTTTATCTTATCATTAGTTT
TACATATCAACGTTGATTGCTTTGTTTTATGTTTTCAATTTGAGTTCATT
ATTTGCCATTTACTTTAATAAATGTTATTAAAATTGTTTCGCTCTTCTGT
GGCATTATCAAATATAAAGATTTTACATTTTATTTTTTGACACTGTATTA
TTTATTTATGCTAAAATTGGTTTTGTTAATAAAAGTCAAAAGACG
back to top

protein sequence of SMED30011084-orf-1

>SMED30011084-orf-1 ID=SMED30011084-orf-1|Name=SMED30011084-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=672bp
MNGTYLKMDSSKSKTKWVARHFGSFMQTGTGKDSTNKALNELCSQIDDGR
FRELQCNIEIDRERQVLVIRRWLDQVILEEFKLALITNVASHQQVPDNNY
LSNILTFNTQIKTSSNVLTETHIFQLEDSNLHMVNYLASDIRSAIESATN
LNPKNTPIKVLPSNNKRNSYSNEKMNKVKEYDSKPRNDDISSRTERNLLL
LNYCFDDIEFFLQHLKDQEEAQAILKNTKGKNLNDRLLEGKAKPSTQNAY
LTCIEKIKFSLNLLCKLDGKIKNPDSRQLILLLIENLLKIGQAYSIYHNG
KLSKVKEPLLTEDTVKLLHQCLSKHYHKQWTSWGDNWCKAREKWAGYKEK
YYPEFFNGYQIDLEELMKDGIISPIADIPRRAVSNAEISHAIFYNQALPM
IAQTDILENTVLSSREEDFCRSVTLRNGKLYRVIATFAASKDEELSMSEG
EIIEVIESKPDKNWWLCGNMHGQKGYSPNTLLEPFCYIDRSINNFIKSSP
ESPDYLNVRNIPTVPVSPKRISQIMKDPNSADKVAEANIINEELKKKINT
NSNFGGWNSRASFARPGPVVSKKHGQLSINQDSTSEDVQKWLEYKKFSPS
DIEKLKIFNGQTLFLLSRDEMVRIVSSEVANRLDSLVKVQKSLSGFGTLS
RRELDEILTKRKEKVEITETF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR041418SAM_3
IPR039801EPS8-like
IPR036028SH3-like_dom_sf
IPR001452SH3_domain
IPR011511SH3_2
IPR013761SAM/pointed_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001452SH3 domainSMARTSM00326SH3_2coord: 429..486
e-value: 8.2E-8
score: 42.0
IPR001452SH3 domainPFAMPF07653SH3_2coord: 431..484
e-value: 9.6E-10
score: 38.0
IPR001452SH3 domainPROSITEPS50002SH3coord: 426..487
score: 19.15
IPR041418SAM domainPFAMPF18016SAM_3coord: 577..636
e-value: 8.5E-15
score: 54.3
NoneNo IPR availableGENE3DG3DSA:2.30.30.40coord: 425..487
e-value: 4.4E-14
score: 53.8
IPR013761Sterile alpha motif/pointed domain superfamilyGENE3DG3DSA:1.10.150.50coord: 568..645
e-value: 1.5E-15
score: 58.3
IPR013761Sterile alpha motif/pointed domain superfamilySUPERFAMILYSSF47769SAM/Pointed domaincoord: 584..640
IPR039801Epidermal growth factor receptor kinase substrate 8-likePANTHERPTHR12287EPIDERMAL GROWTH FACTOR RECEPTOR KINASE SUBSTRATE EPS8-RELATED PROTEINcoord: 77..666
IPR036028SH3-like domain superfamilySUPERFAMILYSSF50044SH3-domaincoord: 426..485