TNF receptor-associated factor

Overview
NameTNF receptor-associated factor
Smed IDSMED30011078
Length (bp)1825
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor-associated factor (SMED30011078) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30011078) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011078

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30011078SMESG000067240.1 PL06020B1H10_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF1 (TNF receptor associated factor 1 [Source:HGNC Symbol;Acc:HGNC:12031])

HSP 1 Score: 93.5893 bits (231), Expect = 2.211e-20
Identity = 52/151 (34.44%), Postives = 82/151 (54.30%), Query Frame = 2
Query: 1322 FLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDP--VILRNDCIIIRCSVE 1768
            FLWKI N +++   +  G    + S  FY+ K GYKL L +Y +G  T + T LS+F  I +GE+D  LPWP +N++   L++Q  NR H  + F+ D +  SF     +P++  N+  G   F  L  L   P    +++D + ++C VE
Sbjct:  147 FLWKITNVTRRCHESACGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQ-NNREHAIDAFRPDLSSASF----QRPQSETNVASGCPLFFPLSKL-QSPKHAYVKDDTMFLKCIVE 291          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF1 (TNF receptor associated factor 1 [Source:HGNC Symbol;Acc:HGNC:12031])

HSP 1 Score: 93.2041 bits (230), Expect = 1.277e-19
Identity = 52/151 (34.44%), Postives = 82/151 (54.30%), Query Frame = 2
Query: 1322 FLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDP--VILRNDCIIIRCSVE 1768
            FLWKI N +++   +  G    + S  FY+ K GYKL L +Y +G  T + T LS+F  I +GE+D  LPWP +N++   L++Q  NR H  + F+ D +  SF     +P++  N+  G   F  L  L   P    +++D + ++C VE
Sbjct:  269 FLWKITNVTRRCHESACGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQ-NNREHAIDAFRPDLSSASF----QRPQSETNVASGCPLFFPLSKL-QSPKHAYVKDDTMFLKCIVE 413          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF1 (TNF receptor associated factor 1 [Source:HGNC Symbol;Acc:HGNC:12031])

HSP 1 Score: 93.2041 bits (230), Expect = 1.277e-19
Identity = 52/151 (34.44%), Postives = 82/151 (54.30%), Query Frame = 2
Query: 1322 FLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDP--VILRNDCIIIRCSVE 1768
            FLWKI N +++   +  G    + S  FY+ K GYKL L +Y +G  T + T LS+F  I +GE+D  LPWP +N++   L++Q  NR H  + F+ D +  SF     +P++  N+  G   F  L  L   P    +++D + ++C VE
Sbjct:  269 FLWKITNVTRRCHESACGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQ-NNREHAIDAFRPDLSSASF----QRPQSETNVASGCPLFFPLSKL-QSPKHAYVKDDTMFLKCIVE 413          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF2 (TNF receptor associated factor 2 [Source:HGNC Symbol;Acc:HGNC:12032])

HSP 1 Score: 91.2781 bits (225), Expect = 9.163e-19
Identity = 50/145 (34.48%), Postives = 77/145 (53.10%), Query Frame = 2
Query: 1322 FLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDPVILRNDCIIIR 1756
            F+WKI +F++K + A  G  P I S  FY+ + GYK+ L IY +G  T +GT LS+FF + KG  D  L WP   ++ + L++Q  NR H  + F+ D    SF     +P   +N+  G   F  +  +      +R+D I I+
Sbjct:  354 FIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQ-NNREHVIDAFRPDVTSSSF----QRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIK 493          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 89.3521 bits (220), Expect = 3.533e-18
Identity = 48/150 (32.00%), Postives = 79/150 (52.67%), Query Frame = 2
Query: 1322 FLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDPVILRNDCIIIRCSVEA 1771
             +WKI ++ ++ + A  G    + S  FY+   GYK+   +Y +G    +GT LS+FF I +GE+D  LPWP K ++ + L++Q ++R H  + FK D    SF     +P   +N+  G   F+    L N   I ++D I I+  V+ 
Sbjct:  335 LIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSF----KKPTGEMNIASGCPVFVAQTVLENGTYI-KDDTIFIKVIVDT 479          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-1 (TNF Receptor Associated Factor (TRAF) homolog; TRF-1 [Source:UniProtKB/TrEMBL;Acc:G5EG80])

HSP 1 Score: 70.4774 bits (171), Expect = 1.333e-12
Identity = 48/157 (30.57%), Postives = 70/157 (44.59%), Query Frame = 2
Query: 1271 RQSSFLEE-NSIKHNFSP-FLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQ------ETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFN 1717
            RQ+  L    +    F P  +WKID   ++   A+ G D  I S  F S + GYK++      G  +  G  +S++  + KGEFD  L WP    I ISL++Q        N  +  +  K    EK FL    +P+   N  +G   F +L  L N
Sbjct:  246 RQTRILSAAETCTEMFGPQLIWKIDKLQQRTNEAKSGADTTIFSVPFMSHRFGYKMMACACLFGDGSSAGKSISLYVLLLKGEFDPTLEWPFHRAIKISLLDQNPRPEDRVNITYVIDPRKLKANEK-FL---ARPRGERNAAFGSQSFCSLAILQN 398          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0077429)

HSP 1 Score: 67.781 bits (164), Expect = 1.439e-11
Identity = 44/151 (29.14%), Postives = 74/151 (49.01%), Query Frame = 2
Query: 1322 FLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQ--ETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDPVILRNDCIIIRCSVE 1768
             LWKI ++S K   AR      ++S  FY+ + GYKL   ++ +G    + T +SV+  +  GE+D  L WP  + I  +L  Q  ++ +    E F  D   ++F     +P     LG+G  +FI+   L + P I + D + +R  V+
Sbjct:  333 LLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPD---QLGFGFPRFISHELLHSRPFI-KGDTVFLRVKVD 479          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0334401)

HSP 1 Score: 67.3958 bits (163), Expect = 1.736e-11
Identity = 44/151 (29.14%), Postives = 74/151 (49.01%), Query Frame = 2
Query: 1322 FLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQ--ETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDPVILRNDCIIIRCSVE 1768
             LWKI ++S K   AR      ++S  FY+ + GYKL   ++ +G    + T +SV+  +  GE+D  L WP  + I  +L  Q  ++ +    E F  D   ++F     +P     LG+G  +FI+   L + P I + D + +R  V+
Sbjct:  324 LLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPD---QLGFGFPRFISHELLHSRPFI-KGDTVFLRVKVD 470          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0308606)

HSP 1 Score: 51.6026 bits (122), Expect = 1.518e-6
Identity = 28/95 (29.47%), Postives = 52/95 (54.74%), Query Frame = 2
Query: 1298 SIKHNFSPFLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETN 1582
            S+++     +W+I ++SKK + ++   D  + S+ F ++  GY L L IY +G  T +G  +    ++  GE+D  L WP + +  I + +Q TN
Sbjct:  249 SVQNIRGHLIWRIKDYSKKLEESKQ-YDTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIIIRDQCTN 342          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0074274)

HSP 1 Score: 51.6026 bits (122), Expect = 1.518e-6
Identity = 28/95 (29.47%), Postives = 52/95 (54.74%), Query Frame = 2
Query: 1298 SIKHNFSPFLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETN 1582
            S+++     +W+I ++SKK + ++   D  + S+ F ++  GY L L IY +G  T +G  +    ++  GE+D  L WP + +  I + +Q TN
Sbjct:  249 SVQNIRGHLIWRIKDYSKKLEESKQ-YDTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIIIRDQCTN 342          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0334036)

HSP 1 Score: 51.6026 bits (122), Expect = 1.518e-6
Identity = 28/95 (29.47%), Postives = 52/95 (54.74%), Query Frame = 2
Query: 1298 SIKHNFSPFLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETN 1582
            S+++     +W+I ++SKK + ++   D  + S+ F ++  GY L L IY +G  T +G  +    ++  GE+D  L WP + +  I + +Q TN
Sbjct:  249 SVQNIRGHLIWRIKDYSKKLEESKQ-YDTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIIIRDQCTN 342          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: BX901915.1 (pep chromosome:GRCz11:CHR_ALT_CTG5_1_18:28764891:28768979:-1 gene:ENSDARG00000109857.1 transcript:ENSDART00000191629.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX901915.1)

HSP 1 Score: 97.4413 bits (241), Expect = 4.955e-22
Identity = 63/188 (33.51%), Postives = 96/188 (51.06%), Query Frame = 2
Query: 1226 EIFNNNNKEDSPDL-LRQSSFLEENSIKHNFSP------FLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDPVILRNDCIIIRCSVE 1768
            EI NN  ++    + LR  S +E  +     S       F+WKI +FSKK + A  G  P + S  FY+ K GYK+ L IY +G  T +GT LS+FF + +G  D  L WP   ++ + L++Q  NR H  + F+ D +  SF     +P + +N+  G   F  L  L +    +R+D I I+  V+
Sbjct:   89 EILNNKVRQLERTVGLRDLSIVEMEAKMREMSAATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQ-NNREHIIDAFRPDISSSSF----QRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIVD 271          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: AL844899.1 (pep chromosome:GRCz11:CHR_ALT_CTG5_2_4:28756846:28760787:-1 gene:ENSDARG00000111038.1 transcript:ENSDART00000183806.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL844899.1)

HSP 1 Score: 97.4413 bits (241), Expect = 4.955e-22
Identity = 63/188 (33.51%), Postives = 96/188 (51.06%), Query Frame = 2
Query: 1226 EIFNNNNKEDSPDL-LRQSSFLEENSIKHNFSP------FLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDPVILRNDCIIIRCSVE 1768
            EI NN  ++    + LR  S +E  +     S       F+WKI +FSKK + A  G  P + S  FY+ K GYK+ L IY +G  T +GT LS+FF + +G  D  L WP   ++ + L++Q  NR H  + F+ D +  SF     +P + +N+  G   F  L  L +    +R+D I I+  V+
Sbjct:   89 EILNNKVRQLERTVGLRDLSIVEMEAKMREMSAATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQ-NNREHIIDAFRPDISSSSF----QRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIVD 271          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 100.138 bits (248), Expect = 8.649e-22
Identity = 52/145 (35.86%), Postives = 80/145 (55.17%), Query Frame = 2
Query: 1322 FLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDPVILRNDCIIIR 1756
            F+WKI  FS++ + A  G  P + S  FYS K GYK+ L +Y +G  T +G+ LS+FF + KG++D  L WP   ++ + L++Q  NR H  + F+ D +  SF     +P + +N+  G   F  L  L      LR+D I I+
Sbjct:  385 FIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQ-NNREHIIDAFRPDVSSTSF----QRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIK 524          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 100.138 bits (248), Expect = 8.649e-22
Identity = 52/145 (35.86%), Postives = 80/145 (55.17%), Query Frame = 2
Query: 1322 FLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDPVILRNDCIIIR 1756
            F+WKI  FS++ + A  G  P + S  FYS K GYK+ L +Y +G  T +G+ LS+FF + KG++D  L WP   ++ + L++Q  NR H  + F+ D +  SF     +P + +N+  G   F  L  L      LR+D I I+
Sbjct:  385 FIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQ-NNREHIIDAFRPDVSSTSF----QRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIK 524          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 99.7525 bits (247), Expect = 1.212e-21
Identity = 53/149 (35.57%), Postives = 82/149 (55.03%), Query Frame = 2
Query: 1322 FLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDPVILRNDCIIIRCSVE 1768
            F+WKI  FS++ + A  G  P + S  FYS K GYK+ L +Y +G  T +G+ LS+FF + KG++D  L WP   ++ + L++Q  NR H  + F+ D +  SF     +P + +N+  G   F  L  L      LR+D I I+  V+
Sbjct:  398 FIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQ-NNREHIIDAFRPDVSSTSF----QRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIVD 541          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: TRAF2 (TNF receptor associated factor 2 [Source:NCBI gene;Acc:100494415])

HSP 1 Score: 89.3521 bits (220), Expect = 2.720e-18
Identity = 50/145 (34.48%), Postives = 77/145 (53.10%), Query Frame = 2
Query: 1322 FLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDPVILRNDCIIIR 1756
            F+WKI  F KK + A +G  P + S  FY+ K GYK+ L IY +G  T + T LS+FF + KG  D  L WP   ++ + L++Q  NR H  + F+ D +  SF     +P + +N+  G   F  +  L      +R+D I ++
Sbjct:  307 FIWKISEFGKKRQDAINGRCPAMFSPPFYTNKYGYKMCLRIYLNGDGTGRNTHLSLFFVVMKGNNDALLRWPFNQKVTLMLLDQ-NNREHVIDAFRPDVSSSSF----QRPISEMNIASGCPLFCQVSKLEGKNSYVRDDTIFVK 446          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: TRAF2 (TNF receptor associated factor 2 [Source:NCBI gene;Acc:100494415])

HSP 1 Score: 89.3521 bits (220), Expect = 3.371e-18
Identity = 50/145 (34.48%), Postives = 77/145 (53.10%), Query Frame = 2
Query: 1322 FLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDPVILRNDCIIIR 1756
            F+WKI  F KK + A +G  P + S  FY+ K GYK+ L IY +G  T + T LS+FF + KG  D  L WP   ++ + L++Q  NR H  + F+ D +  SF     +P + +N+  G   F  +  L      +R+D I ++
Sbjct:  334 FIWKISEFGKKRQDAINGRCPAMFSPPFYTNKYGYKMCLRIYLNGDGTGRNTHLSLFFVVMKGNNDALLRWPFNQKVTLMLLDQ-NNREHVIDAFRPDVSSSSF----QRPISEMNIASGCPLFCQVSKLEGKNSYVRDDTIFVK 473          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 89.3521 bits (220), Expect = 4.304e-18
Identity = 46/151 (30.46%), Postives = 83/151 (54.97%), Query Frame = 2
Query: 1322 FLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFN--DPVILRNDCIIIRCSVE 1768
             +WKI ++ +K + A +G    I S  FY+   GY+L    Y +G  + +G+FLS++F + KGEFD+ L WP K ++ + L++Q   + H T+ F+ D    SF     +P + +N+  G  +F +   L N  +   +++D + I+  V+
Sbjct:  386 LIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHITDVFRADPNSSSF----KRPDSEMNIASGCPRFASHAQLENPKNGCYIKDDTLFIKIVVD 532          

HSP 2 Score: 51.6026 bits (122), Expect = 3.397e-6
Identity = 42/137 (30.66%), Postives = 60/137 (43.80%), Query Frame = 2
Query:  140 FLTKYNLEFEIDLPSEFRCVICHGILVNAHQSPCSCRFCWECISEYLHKGER-FCPSGMEDCKEFPINLKKDIQIDYFMNRNISNLKVKCPNE-CCKMMIELKNLEEHMKHHIIRCPYYDIGCNSFESSDDKIKHHL 544
            F+ K    F   L   ++C  CH +L N HQ+ C  RFC +CIS  +   E   CP  ME+ K        +I  D    R + NL V C N   C + + L   +EH+     +C Y    C++    D  I+  L
Sbjct:   26 FVPKQEYLFVEQLQDRYKCASCHLVLHNPHQTGCGHRFCEKCISNLIELSETPQCPIDMENIKS------HEIFKDNCCKREVLNLLVYCKNSPACDVKVMLGRYQEHLG----QCLYEMTLCSNDGCHDQMIRKEL 152          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 88.9669 bits (219), Expect = 4.986e-18
Identity = 46/151 (30.46%), Postives = 83/151 (54.97%), Query Frame = 2
Query: 1322 FLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFN--DPVILRNDCIIIRCSVE 1768
             +WKI ++ +K + A +G    I S  FY+   GY+L    Y +G  + +G+FLS++F + KGEFD+ L WP K ++ + L++Q   + H T+ F+ D    SF     +P + +N+  G  +F +   L N  +   +++D + I+  V+
Sbjct:  385 LIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHITDVFRADPNSSSF----KRPDSEMNIASGCPRFASHAQLENPKNGCYIKDDTLFIKIVVD 531          

HSP 2 Score: 50.447 bits (119), Expect = 6.491e-6
Identity = 42/137 (30.66%), Postives = 60/137 (43.80%), Query Frame = 2
Query:  140 FLTKYNLEFEIDLPSEFRCVICHGILVNAHQSPCSCRFCWECISEYLHKGER-FCPSGMEDCKEFPINLKKDIQIDYFMNRNISNLKVKCPNE-CCKMMIELKNLEEHMKHHIIRCPYYDIGCNSFESSDDKIKHHL 544
            F+ K    F   L   ++C  CH +L N HQ+ C  RFC +CIS  +   E   CP  ME+ K        +I  D    R + NL V C N   C + + L   +EH+     +C Y    C++    D  I+  L
Sbjct:   26 FVPKQEYLFVEQLQDRYKCASCHLVLHNPHQTGCGHRFCEKCISNLIELSETPQCPIDMENIKS------HEIFKDNCCKREVLNLLVYCKNSPACDVKVMLGRYQEHLG----QCLYEMTLCSNDGCHDQMIRKEL 152          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 87.8113 bits (216), Expect = 1.152e-17
Identity = 46/151 (30.46%), Postives = 83/151 (54.97%), Query Frame = 2
Query: 1322 FLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFN--DPVILRNDCIIIRCSVE 1768
             +WKI ++ +K + A +G    I S  FY+   GY+L    Y +G  + +G+FLS++F + KGEFD+ L WP K ++ + L++Q   + H T+ F+ D    SF     +P + +N+  G  +F +   L N  +   +++D + I+  V+
Sbjct:  335 LIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHITDVFRADPNSSSF----KRPDSEMNIASGCPRFASHAQLENPKNGCYIKDDTLFIKIVVD 481          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf1 (TNF receptor-associated factor 1 [Source:MGI Symbol;Acc:MGI:101836])

HSP 1 Score: 91.2781 bits (225), Expect = 3.806e-19
Identity = 51/151 (33.77%), Postives = 82/151 (54.30%), Query Frame = 2
Query: 1322 FLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDP--VILRNDCIIIRCSVE 1768
            FLWKI N +K+   +  G    + S  FY+ K GYKL L +Y +G  + + T LS+F  I +GE+D  LPWP +N++   L++Q  NR H  + F+ D +  SF     +P++  N+  G   F  L  L   P    +++D + ++C V+
Sbjct:  262 FLWKITNVTKRCHESVCGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGSGKKTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQ-NNREHAIDAFRPDLSSASF----QRPQSETNVASGCPLFFPLSKL-QSPKHAYVKDDTMFLKCIVD 406          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf1 (TNF receptor-associated factor 1 [Source:MGI Symbol;Acc:MGI:101836])

HSP 1 Score: 91.2781 bits (225), Expect = 3.806e-19
Identity = 51/151 (33.77%), Postives = 82/151 (54.30%), Query Frame = 2
Query: 1322 FLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDP--VILRNDCIIIRCSVE 1768
            FLWKI N +K+   +  G    + S  FY+ K GYKL L +Y +G  + + T LS+F  I +GE+D  LPWP +N++   L++Q  NR H  + F+ D +  SF     +P++  N+  G   F  L  L   P    +++D + ++C V+
Sbjct:  262 FLWKITNVTKRCHESVCGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGSGKKTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQ-NNREHAIDAFRPDLSSASF----QRPQSETNVASGCPLFFPLSKL-QSPKHAYVKDDTMFLKCIVD 406          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf1 (TNF receptor-associated factor 1 [Source:MGI Symbol;Acc:MGI:101836])

HSP 1 Score: 91.2781 bits (225), Expect = 3.806e-19
Identity = 51/151 (33.77%), Postives = 82/151 (54.30%), Query Frame = 2
Query: 1322 FLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDP--VILRNDCIIIRCSVE 1768
            FLWKI N +K+   +  G    + S  FY+ K GYKL L +Y +G  + + T LS+F  I +GE+D  LPWP +N++   L++Q  NR H  + F+ D +  SF     +P++  N+  G   F  L  L   P    +++D + ++C V+
Sbjct:  262 FLWKITNVTKRCHESVCGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGSGKKTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQ-NNREHAIDAFRPDLSSASF----QRPQSETNVASGCPLFFPLSKL-QSPKHAYVKDDTMFLKCIVD 406          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 87.8113 bits (216), Expect = 6.050e-19
Identity = 43/150 (28.67%), Postives = 81/150 (54.00%), Query Frame = 2
Query: 1322 FLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDP-VILRNDCIIIRCSVE 1768
             +WK+ ++  K + A +G    + S  FY+ + GY+L    Y +G  + +GT LS++F + +GEFD+ L WP +  + + L++Q   + H  E FK D    SF     +P   +N+  G  +F++  TL N     +++D + ++ +V+
Sbjct:   98 LIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKADPNSSSF----KRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAVD 243          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 87.8113 bits (216), Expect = 6.050e-19
Identity = 43/150 (28.67%), Postives = 81/150 (54.00%), Query Frame = 2
Query: 1322 FLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDP-VILRNDCIIIRCSVE 1768
             +WK+ ++  K + A +G    + S  FY+ + GY+L    Y +G  + +GT LS++F + +GEFD+ L WP +  + + L++Q   + H  E FK D    SF     +P   +N+  G  +F++  TL N     +++D + ++ +V+
Sbjct:   98 LIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKADPNSSSF----KRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAVD 243          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q13077|TRAF1_HUMAN (TNF receptor-associated factor 1 OS=Homo sapiens OX=9606 GN=TRAF1 PE=1 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 6.132e-19
Identity = 52/151 (34.44%), Postives = 82/151 (54.30%), Query Frame = 2
Query: 1322 FLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDP--VILRNDCIIIRCSVE 1768
            FLWKI N +++   +  G    + S  FY+ K GYKL L +Y +G  T + T LS+F  I +GE+D  LPWP +N++   L++Q  NR H  + F+ D +  SF     +P++  N+  G   F  L  L   P    +++D + ++C VE
Sbjct:  269 FLWKITNVTRRCHESACGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQ-NNREHAIDAFRPDLSSASF----QRPQSETNVASGCPLFFPLSKL-QSPKHAYVKDDTMFLKCIVE 413          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|P39428|TRAF1_MOUSE (TNF receptor-associated factor 1 OS=Mus musculus OX=10090 GN=Traf1 PE=1 SV=2)

HSP 1 Score: 91.2781 bits (225), Expect = 2.662e-18
Identity = 51/151 (33.77%), Postives = 82/151 (54.30%), Query Frame = 2
Query: 1322 FLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDP--VILRNDCIIIRCSVE 1768
            FLWKI N +K+   +  G    + S  FY+ K GYKL L +Y +G  + + T LS+F  I +GE+D  LPWP +N++   L++Q  NR H  + F+ D +  SF     +P++  N+  G   F  L  L   P    +++D + ++C V+
Sbjct:  262 FLWKITNVTKRCHESVCGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGSGKKTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQ-NNREHAIDAFRPDLSSASF----QRPQSETNVASGCPLFFPLSKL-QSPKHAYVKDDTMFLKCIVD 406          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q12933|TRAF2_HUMAN (TNF receptor-associated factor 2 OS=Homo sapiens OX=9606 GN=TRAF2 PE=1 SV=2)

HSP 1 Score: 91.2781 bits (225), Expect = 4.400e-18
Identity = 50/145 (34.48%), Postives = 77/145 (53.10%), Query Frame = 2
Query: 1322 FLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDPVILRNDCIIIR 1756
            F+WKI +F++K + A  G  P I S  FY+ + GYK+ L IY +G  T +GT LS+FF + KG  D  L WP   ++ + L++Q  NR H  + F+ D    SF     +P   +N+  G   F  +  +      +R+D I I+
Sbjct:  354 FIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQ-NNREHVIDAFRPDVTSSSF----QRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIK 493          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|P39429|TRAF2_MOUSE (TNF receptor-associated factor 2 OS=Mus musculus OX=10090 GN=Traf2 PE=1 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 5.853e-18
Identity = 48/145 (33.10%), Postives = 77/145 (53.10%), Query Frame = 2
Query: 1322 FLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDPVILRNDCIIIR 1756
            F+WKI +F++K + A  G  P I S  FY+ + GYK+ L +Y +G  T +GT LS+FF + KG  D  L WP   ++ + L++   NR H  + F+ D    SF     +P + +N+  G   F  +  +      +R+D I I+
Sbjct:  354 FIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDH-NNREHVIDAFRPDVTSSSF----QRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIK 493          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|P70191|TRAF5_MOUSE (TNF receptor-associated factor 5 OS=Mus musculus OX=10090 GN=Traf5 PE=1 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 1.519e-17
Identity = 43/150 (28.67%), Postives = 81/150 (54.00%), Query Frame = 2
Query: 1322 FLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDP-VILRNDCIIIRCSVE 1768
             +WK+ ++  K + A +G    + S  FY+ + GY+L    Y +G  + +GT LS++F + +GEFD+ L WP +  + + L++Q   + H  E FK D    SF     +P   +N+  G  +F++  TL N     +++D + ++ +V+
Sbjct:  406 LIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKADPNSSSF----KRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAVD 551          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: I1ZID8 (TNF receptor associated factor-2 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 3.070e-32
Identity = 70/202 (34.65%), Postives = 113/202 (55.94%), Query Frame = 2
Query:  125 ESVWKFLTKYNLEFEIDLPSEFRCVICHGILVNAHQSPCSCRFCWECISEYLHKGERFCPSGMEDCKEFPINLKKDIQIDYFMNRNISNLKVKCPNECCKMMIELKNLEEHMKHHIIR---CPYYDIGCNSFESSDDKIKHHLITENYSHTKSLIKYIDNLTKELTLVKNKLKSSEENLRDNDNF-------KIDIKMIVNS 700
            E + + L  YN E E  +P   +C +C  +LVNA QS C CRFC +CI EY+ +G  +CP G  +CKE  + +  +I  DY +NR I+ ++VKCP E CK+  EL ++EEH++   ++   CP++ +GCN  +     + +HL    + H+K +I  I N+  +       L + E  LR++ N        + +I M++NS
Sbjct:    4 EKINRLLITYNFEVEGGVPDNLKCDLCKNLLVNACQSRCGCRFCSKCIMEYVSRGNLYCPGGTSECKEENLTICSNIHTDYRVNRKIAKMRVKCPEETCKVYCELVDIEEHLRLCTMKSQNCPFFVLGCNQPKMVIQDLTNHLQNGTFQHSKLIIDIISNMRNDFF----GLTTKEVELREDINLIKNHFQSQNEIMMLINS 201          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: H3B5Y8 (TNF receptor-associated factor OS=Latimeria chalumnae OX=7897 GN=TRAF5 PE=3 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 9.782e-24
Identity = 134/572 (23.43%), Postives = 242/572 (42.31%), Query Frame = 2
Query:  164 FEIDLPSEFRCVICHGILVNAHQSPCSCRFCWECISEYLHK-GERFCPSGMEDCKEFPINLKKDIQIDYFMNRNISNLKVKCPNEC-CKMMIELKNLEEHMKHHIIRCPYYDIGCNSFESSDDKIKHHLITENYSHTKSLIKYIDNLTKELTLVKNKLKSSEENLRDNDNFKIDIKMIVNSXXXXXXXXXXKIALIKDDIDQCIIKNLRINDQFQASICQSQSPAGFNDENQDDKISFDEIKANNYSGDNTELNLLKNELALYTKEH-------------------KQLFDEMESRKNEIKIIDENXXXXXXXXXXXETRLEQLQIKNEPCESKMKNILNSKSETNKEL------VQNMIKKFIVDLTEPGTPLEISKIFTEIFNNNNKEDSPDLLRQSSFLEENSIKHNF-------SPFLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFN--DPVILRNDCIIIRCSVEA 1771
            F   L   ++CV C  +L + +Q+ C  RF  +CI        +  CP   +  K        +I  D    R + NL++ C N   CK    + +L++H++  + +    D  CN      D +KHHL            +Y+ +  KE+   K   +S   ++   +  + ++ MI+ S+                    CI+KN +I   F+  +    S +    ENQ+D   F   + N       E + L   L L +  +                   +QL   +ES +NEIK + +     + L+   +  L+    K +  E ++  ++ ++     EL      V+N+ +K      E  TP  +      +  N +  +  ++ R +  L +N  +             +WKI +++KK + A +G   Y +S  FY+ + GYK+    Y +G    +GT LS+FF + +GE+D+ LPWP K ++ + L++Q  N+ H +E FK D    SF     +P   +N+  G  +F+N  TL N  +   ++ D + I+  V+ 
Sbjct:   35 FVATLEDRYKCVCCGYVLHDPYQTACGHRFSKKCIDNMTQSMSQPKCPIDSQIIK------LDEIFKDACCRREVLNLQIFCINSPDCKFQTTVGHLKDHLEECLFQTEQCD-QCNENILRKD-MKHHL------------EYVCSYRKEM--YKFCKESVLPHISKENKKREEVCMILESL--------------------CILKNFQII--FRTQVVGGLSISPQKSENQNDFHYFKCRQVNKEKISEHEKSYLAEHLVLVSGRYSELDKKISDLSQQLRDPAIQQLKSSLESCENEIKQLQQQNTKDEALLTFKKNALDNQDTKIKQLEMRLNEVIRNQERDRNELRALTETVENLKRKIFS--LEDCTPQLL------LLRNQSTLNEKEISRHADQLSKNEERFKVLEGASYNGRLIWKIWDYTKKKQEAVEGHVFYTLSQPFYTSRFGYKMCARAYLNGDGAGKGTHLSLFFLVMRGEYDSLLPWPFKQKVTLMLLDQSGNKNHISETFKADPTSSSF----KKPTGEMNIASGCPKFVNHDTLENPKNATYIKEDVLFIKVIVDV 550          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A0F7GY08 (TNF receptor associated factor 5 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 5.003e-21
Identity = 54/144 (37.50%), Postives = 83/144 (57.64%), Query Frame = 2
Query: 1301 IKHNFSPFLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAI----NLGYGDTQFINLLTLFND 1720
            +K + +PF WKI NF +K + A  G    + S  FYS KNGYK+ L I P+G +  +  +LSV F I  GE+D+ L WPM  ++ ISLINQ+T   H ++++KFD+  K     +++P +      +  +G  +  N   LFN+
Sbjct:   41 VKEHIAPFEWKITNFMEKHERAISGEKLTVYSEPFYSHKNGYKIQLRIDPNGDEAVKALYLSVSFGIIGGEYDDELDWPMTKQVKISLINQKTGLVHISKRYKFDSVLKKSKCIFFKPISRFEDDEDYFFGTLKLSNFSVLFNN 184          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: D5JG59 (TNF receptor-associated factor-2-like protein A OS=Dugesia japonica OX=6161 GN=TRAF-2A PE=2 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 1.676e-20
Identity = 53/154 (34.42%), Postives = 87/154 (56.49%), Query Frame = 2
Query: 1316 SPFLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQET-NRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDPVILRNDCIIIRCSVEAI 1774
            + F+WK  +F  +   A  G    + S  FY+ + GYK+ L +YP G    +GT LSVFF I KGEFD+ L WP K ++ +S+++QE+ ++PH ++ FK D         Y +P    N+  G  +FI L  + N+ +  +ND I ++ +V+ +
Sbjct:  203 ASFIWKFTDFEVRRVDAESGGRVSVTSDAFYTSEFGYKMCLRVYPAGDGVGKGTHLSVFFAIMKGEFDDLLSWPFKQKVTLSILDQESGSKPH-SDTFKPDARS----ACYQKPTDECNIASGFPKFILLSLIMNNSIYCKNDTIFLKIAVDTM 351          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: T1DBK6 (TRAF-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 1.044e-19
Identity = 61/189 (32.28%), Postives = 103/189 (54.50%), Query Frame = 2
Query: 1205 EISKIFTEIFNNNNKEDSPDLLRQSSFLEENSIKHNFSPFLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDPVILRNDCIIIRCSVEA 1771
            ++ K   E+   +  ++S  + R +S    N        ++WKI +FSK  ++A  G +P I+S  FY+   GYK+ + IYP G    +GT LS+FF I KG++D+ LPWP KN+++I++ +  +   + ++ FK D   KS    Y +P+   N+  G  +FI+   L N    L+ D + I+ +V A
Sbjct:  267 QLLKATLEVMKLDLPKNSGSISRDTSLKRANKTIFRNGKYMWKIKSFSKLRENAMRGKNPTILSEAFYTSDFGYKMCMKIYPCGDGVGKGTHLSIFFVIMKGDYDDILPWPFKNKVIITIFDDFSKSTNLSDTFKPDP--KSI--CYQRPEEEYNIASGSPKFISFSELKN---FLKKDTLYIQINVIA 448          

HSP 2 Score: 67.781 bits (164), Expect = 3.742e-8
Identity = 40/109 (36.70%), Postives = 57/109 (52.29%), Query Frame = 2
Query:  134 WKFLTKYNLEFEIDLPSEFRCVICHGILVNAHQSPCSCRFCWECISEYLHKGERFCPSGMEDCKEFPINLKKDIQIDYFMNRNISNLKVKCPNECCKMMIELKNLEEHM 460
            W+F    NL          +CV+C  IL++A Q+ C CR+C ECI  YL  GE+ C +  EDC+    ++      D   N+ IS LKVKC  E C     LK+++ H+
Sbjct:   21 WRFTINDNL----------KCVMCQDILLDAIQTDCGCRYCKECIDNYLENGEKECVAEYEDCR----SVITSYIYDRATNKEISLLKVKCLYEGCVFEDTLKSIKGHL 115          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:103028261])

HSP 1 Score: 100.523 bits (249), Expect = 6.378e-22
Identity = 56/172 (32.56%), Postives = 91/172 (52.91%), Query Frame = 2
Query: 1253 DSPDLLRQSSFLEENSIKHNFSPFLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDPVILRNDCIIIRCSVE 1768
            +S   LR+  F   + +      F+WKI +FS++ + A  G  P + S  FYS K GYK+ L +Y +G  T +G+ LS+FF + +G++D  L WP   ++ + L++Q  NR H  + F+ D +  SF     +P + +N+  G   F  L  L      LR+D I I+  V+
Sbjct:  367 ESEQALRELQFCTYDGV------FVWKISDFSRRRQDALAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMRGKYDALLKWPFSQKVTLMLLDQ-NNREHIIDAFRPDISSTSF----QRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIVD 527          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 97.0561 bits (240), Expect = 9.313e-21
Identity = 54/149 (36.24%), Postives = 82/149 (55.03%), Query Frame = 2
Query: 1322 FLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDPVILRNDCIIIRCSVE 1768
            F+WKI +FSKK + A  G  P + S  FY+ K GYK+ L IY +G  T +GT LS+FF + +G  D  L WP   ++ + L++Q  NR H  + F+ D +  SF     +P + +N+  G   F  L  L +    +R+D I I+  V+
Sbjct:  425 FVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQ-NNREHIIDAFRPDISSSSF----QRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIVD 568          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 95.9005 bits (237), Expect = 1.096e-20
Identity = 54/149 (36.24%), Postives = 82/149 (55.03%), Query Frame = 2
Query: 1322 FLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDPVILRNDCIIIRCSVE 1768
            F+WKI +FSKK + A  G  P + S  FY+ K GYK+ L IY +G  T +GT LS+FF + +G  D  L WP   ++ + L++Q  NR H  + F+ D +  SF     +P + +N+  G   F  L  L +    +R+D I I+  V+
Sbjct:  312 FVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQ-NNREHIIDAFRPDISSSSF----QRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIVD 455          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: ENSAMXT00000035169.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:3354744:3362219:1 gene:ENSAMXG00000029095.1 transcript:ENSAMXT00000035169.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 79.337 bits (194), Expect = 4.911e-17
Identity = 46/149 (30.87%), Postives = 76/149 (51.01%), Query Frame = 2
Query: 1322 FLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDPVILRNDCIIIRCSVE 1768
             +WKI ++ ++   A       + S  FY+   GYK+   +Y +G    +GT LS+FF + +GE+D  LPWP K ++ + L++Q   R H  + FK D    SF     +P   +N+  G   F+    L N   I ++D I I+ +V+
Sbjct:    6 LIWKIRDYKRRKAEAVASKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPARKHLGDAFKPDPNSSSFR----RPTGEMNIASGCPLFVAQTVLENGTYI-KDDTIFIKVTVD 149          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 83.5741 bits (205), Expect = 1.506e-16
Identity = 53/171 (30.99%), Postives = 87/171 (50.88%), Query Frame = 2
Query: 1268 LRQSSFLEENSIKHNFS---PFLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDP-VILRNDCIIIRCSVE 1768
            L+ SS  +  S + + S    FLW+I + S+K K A  G      S  FY+ + G+K+ + +Y  G    +GT +S+FF I KG++D  L WP K ++   LI+Q   R H  + F+ D    SF     +P + +N+  G   F  L  L +     +++D + I+C V+
Sbjct:  373 LQISSLQQSISAQQDVSYDGTFLWRICDVSQKLKEAATGQKSSQYSPAFYTSRYGFKVCMRLYMYGDGVGKGTHISLFFVIMKGDYDPLLSWPFKQKVTFFLIDQ-NQREHVVDAFRPDLRSASF----QRPVSEMNVASGCPLFFPLSKLRSPKHAYVKDDTLFIKCVVD 538          

HSP 2 Score: 50.0618 bits (118), Expect = 6.338e-6
Identity = 35/117 (29.91%), Postives = 53/117 (45.30%), Query Frame = 2
Query:  179 PSEFRCVICHGILVNAHQSPCSCRFCWECISEYLHKGERFCPSGMEDCKEFPINLKKD---IQIDYF-----MNRNISNLKVKCPNECCKMMIELKNLEEHMKHHIIRCPYYDIGCN 505
            P  F C  C+ +L  AHQ+ C  R+C  C+   L   +    +    CKE P +       + +D+F     +N+ I  L+V C N+ C     LK+ E+H      +C Y  I CN
Sbjct:   24 PVHFLCSSCNNVLNEAHQTQCGHRYCRACVMWLLRNNKDLICT---KCKEDPGSESDSSMMLTLDHFFSDNAINKEIQELRVHCVNQGCGWRSTLKDFEDHQS----QCEYALIPCN 133          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000074.1 (pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-1 gene:ENSPMAG00000000066.1 transcript:ENSPMAT00000000074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 89.3521 bits (220), Expect = 4.240e-19
Identity = 53/187 (28.34%), Postives = 96/187 (51.34%), Query Frame = 2
Query: 1208 ISKIFTEIFNNNNKEDSPDLLRQSSFLEENSIKHNFSPFLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDPVILRNDCIIIRCSVE 1768
            +S+  T++F ++ +    DL  Q   LE  S        +WKI +++++ + A  G    + S  FY+   GY++    Y +G    +GT LS+FF + +GE+D  LPWP +  + ++L++Q   R   ++ FK D A  SF     +P + +N+  G   F++ + L      L++D I I+  V+
Sbjct:  294 LSRHDTQLFAHDTRLAEMDLRFQ--VLETASYN---GKLVWKIRDYARRKQDAVSGRTLSLYSQPFYTSPFGYRMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLPWPFRQRVTLTLLDQGAARRQLSDTFKPDPASSSF----RRPTSDMNIASGCPLFVSHVAL-ESASYLQDDTIFIKVVVD 470          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002130.1 (pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 gene:ENSPMAG00000001936.1 transcript:ENSPMAT00000002130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 86.2705 bits (212), Expect = 2.646e-18
Identity = 43/149 (28.86%), Postives = 78/149 (52.35%), Query Frame = 2
Query: 1322 FLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDPVILRNDCIIIRCSVE 1768
             +WKI +++++ + A  G    + S  FY+   GYK+    Y +G    +GT LS+FF + +GE+D  L WP +  + +SL++Q   R H ++ F  D A  SF     +P   +N+  G   F++ + L     ++ +D + +R  V+
Sbjct:  270 LVWKIRDYARRKQEAASGRTLSLYSQPFYTSPFGYKMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLEWPFRRRVTLSLLDQGAARRHLSDTFTPDPASGSF----RRPDGDMNVASGCPLFVSHVALEGSSYLV-DDTVFVRVVVD 413          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 82.4185 bits (202), Expect = 8.724e-17
Identity = 54/174 (31.03%), Postives = 87/174 (50.00%), Query Frame = 2
Query: 1322 FLWKIDNFSKKWKS------ARDGTDP----YIMSSDFYSQKNGYKLILGI-------YPDGFDTE------QGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQ-ETNRPHTTEKFKFDTAEKSF-LPSYYQ-PKTAINLGYGDTQFINLLTLFNDPVILRNDCIIIRCSV 1765
            F W+++ FS+          A DG  P     + SS FY+   GY+L L +        P G  +       +   L++F H+ +G++D+ LPWP K  I IS+++Q E +  H TE    D    +F  PS ++ PK     G+G   F+++ TL +    LR+DC+++RC V
Sbjct:  395 FTWRVERFSRLLPGGLASGFASDGMHPDAPAVMHSSGFYTGVPGYRLCLRLQVLSGREVPAGAASPSVLLAGRQPHLALFVHLLQGDYDHRLPWPFKGRIRISVVDQCERDSVHVTEMMDADPQLSAFQRPSVHRNPK-----GFGYMNFMDINTLHHR-SYLRDDCLVVRCEV 562          

HSP 2 Score: 60.8474 bits (146), Expect = 4.810e-10
Identity = 43/126 (34.13%), Postives = 58/126 (46.03%), Query Frame = 2
Query:  152 YNLEFEIDLPSEFRCVICHGILVNAHQSPCSCRFCWECI--SEYLHKGERFCP---SGMEDCKEFPINLKKDIQIDYFMNRNISNLKVKCPNECCKMMIELKNLEEHMKHHIIRCPYYDIGCNSFE 514
            Y  +FE  L S++ C IC   L    Q+PC  RFC  CI  S  L      CP   + + + + FP         D F  R I +L V+CPN+ C    EL+ L+EH     +RC Y  + C   E
Sbjct:   51 YEADFEPPLESKYECPICLMALREPVQTPCGHRFCRACILHSMRLRDAGPKCPVDNAVLHEGQLFP---------DNFAKREILSLTVRCPNKPCGHRGELRALQEHQ----LRCEYAQVPCVRCE 163          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO35237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM27])

HSP 1 Score: 97.8265 bits (242), Expect = 1.581e-21
Identity = 74/298 (24.83%), Postives = 147/298 (49.33%), Query Frame = 2
Query:  893 YSGDNTELNLLKNELALYTKEHKQLFDEMESRKNEIKIIDENXXXXXXXXXXXETRLEQLQIKNEPCESKMKNILNSKSETNKELVQNMIKKFIVDLTEPGTPLEISKIFTEIFNNNNKEDSPDLLRQSSFLE------ENSIKHNFSPFLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDPVILRNDCIIIRCSVE 1768
            + G+NT     K EL  +  E  Q+ +    +   + I+++ +  ++  I ++  R +Q  +  E            K++ NKE + +++K+  V       P ++++  +++      E S  + +   F E      + +I ++ + FLWKID F++++  A+ G    I SS FY+ + GYKL   ++P+G  + +  +LS+F  + +GE+D+ LPWP +  I I+LI+Q+ N  + +E F  D    SF     +P   IN+  G  +F +  T+      +  +C+ ++  V+
Sbjct:  243 FDGENTSF---KTELERHKYEFAQMKERFNDQNARLGIVEKTVANQKGDIAEIWMRFDQENLVGEVRMRDKLKKFKVKTKANKECLLSLMKRLEVQDDSQTNPNKLNRRLSQL------ESSITIHKTKLFQEDLRIQIQQAISYDGT-FLWKIDKFTERYAEAKSGNATSIYSSPFYTHRFGYKLCARLFPNGDGSARDNYLSIFIALMRGEYDSILPWPFQETITITLIDQD-NGMNISETFDPDPCSISF----QRPTRNINVASGCPRFCS-QTVLRTRGYMNENCVFVKVVVD 524          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO49464 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG36])

HSP 1 Score: 92.0485 bits (227), Expect = 1.063e-19
Identity = 47/150 (31.33%), Postives = 82/150 (54.67%), Query Frame = 2
Query: 1322 FLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPH-TTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDPVILRNDCIIIRCSVE 1768
            ++WKID ++++++    G  P I S  FY  + GYK    +YP+G    +G+ LS+FF + +GEFD  LPWP + ++   L++Q  +R H   + F+ D    SF     +P + +N+  G   FI+   L      +R+D + I+ +V+
Sbjct:  380 YIWKIDEYTRRYQEGVSGKTPSIYSPPFYVGRYGYKACARVYPNGDGMGKGSHLSLFFVLMRGEFDALLPWPFRQKVTFKLLDQ--DRVHDIGDTFRPDPTSSSF----KRPTSNMNIASGCPLFISHTNL-QTRAYVRDDTMFIKIAVD 522          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO41243 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4Z7])

HSP 1 Score: 84.3445 bits (207), Expect = 3.012e-17
Identity = 43/142 (30.28%), Postives = 77/142 (54.23%), Query Frame = 2
Query: 1322 FLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLP-----SYYQPKTAINLGYGDTQFINLLTLFNDPVIL 1732
            F+W+I +F+   + A+ G    + S  F+++KNGYKL   +YP+G  + + T +S F  I +GE+D  L WP    I I+L++Q+ N        +    EK+ +P     ++++PKT  N G G   F++   L+ +  ++
Sbjct:  320 FVWRIPDFADSLRQAKLGLKVRLDSEPFFTEKNGYKLRATLYPNGTMSGKNTHISAFVSINRGEYDGILAWPFTRVIKITLLDQKEN------VLQRRNVEKTIIPNPSLENFHRPKTVSNNGRGSATFVSHEKLWTENYVV 455          

HSP 2 Score: 70.8626 bits (172), Expect = 5.685e-13
Identity = 48/141 (34.04%), Postives = 70/141 (49.65%), Query Frame = 2
Query:  146 TKYNLEFEIDLPSEFRCVICHGILVNAHQSPCSCRFCWECISEYLHKGERF-CPSGMEDCKEFPINLKKDIQIDYFMNRNISNLKVKCPNECCKMMIELKNLEEHMKHHIIRCPYYDIGCN----SFESSDDKIKHHLITE 553
            + Y+ EF I +  E+ C ICH  L    Q+ C  RFC EC+ E   +  R  CP   E     P++LKKD+ +D    R I +  VKCP + CK   EL++LE H ++    C Y  + C+    S +     +  HL+ E
Sbjct:    9 SGYDSEFVIAVAEEYTCRICHLPLRVPVQTKCGHRFCKECLDEASRRKSRAECPMDRE-----PLDLKKDVFLDKAAERTILSFLVKCPCKGCKWEAELRDLEAHARN----CDYELVTCSNPMCSAQLPRMDVDEHLLVE 140          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO37750 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SER6])

HSP 1 Score: 80.8777 bits (198), Expect = 3.281e-16
Identity = 43/132 (32.58%), Postives = 75/132 (56.82%), Query Frame = 2
Query: 1316 SPFLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETN---RPHTTEKFKFDTAEKSF-LPSYYQPKTAINLGYGDTQFIN 1699
            S  LW+ID+F + +   +      + S  FY+   GYK  + ++P G  + +GT LS++  +  GE+D+ LPWP + +I ++L++Q T+   + H ++ F  D   KSF  PS    K + +LG+G  QF++
Sbjct:  313 SKLLWRIDDFWEAFDEGKRKPGTELHSPVFYTSNYGYKFKVVLFPYGNGSGEGTHLSLYIRLLPGEYDSLLPWPFEGQITLTLLDQSTDKRAKRHISQSFSPDPNWKSFQRPS----KNSTSLGFGYPQFVS 440          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO48394 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJK8])

HSP 1 Score: 79.7221 bits (195), Expect = 9.050e-16
Identity = 55/164 (33.54%), Postives = 81/164 (49.39%), Query Frame = 2
Query: 1322 FLWKIDNFSKKWKSA-------------RDGTDPYIMSSD------FYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQ-ETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDPVILRNDCIII 1753
            F+W+I N+  K+K A              D  D   M+ D      FY+ + GYK+ L  YP+G+   +GT LS+   I KGE+D  L WP + +I +SLINQ E  R  T E +  D A       + +P    N+G G + FI+ + L N    +++D I I
Sbjct:  322 FVWRICNYKDKYKKAVAFATNQEVKGGNSDSDDDISMAGDIMVSLPFYTSRYGYKMRLKAYPNGYGDGKGTHLSLSIRIMKGEYDAILEWPFRRKITLSLINQSEQWRSETVEIYP-DDATPDKKHKFERPIENENVGCGYSCFISHMEL-NSGDYIKDDVIFI 483          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 97.4413 bits (241), Expect = 5.918e-21
Identity = 52/149 (34.90%), Postives = 80/149 (53.69%), Query Frame = 2
Query: 1322 FLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDPVILRNDCIIIRCSVE 1768
            F+WKI +FS + + A  G  P + S  FYS K GYK+ L +Y +G  T +GT LS+FF + + ++D  L WP   ++ + L++Q  NR H  + F+ D    SF     +P + +N+  G   F  L  L      LR+D I I+  V+
Sbjct:  369 FVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQ-NNREHIIDAFRPDITSTSF----QRPVSEMNIASGCPLFCPLAKLAGKSPYLRDDTIFIKAIVD 512          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 97.4413 bits (241), Expect = 6.347e-21
Identity = 52/149 (34.90%), Postives = 80/149 (53.69%), Query Frame = 2
Query: 1322 FLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDPVILRNDCIIIRCSVE 1768
            F+WKI +FS + + A  G  P + S  FYS K GYK+ L +Y +G  T +GT LS+FF + + ++D  L WP   ++ + L++Q  NR H  + F+ D    SF     +P + +N+  G   F  L  L      LR+D I I+  V+
Sbjct:  376 FVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQ-NNREHIIDAFRPDITSTSF----QRPVSEMNIASGCPLFCPLAKLAGKSPYLRDDTIFIKAIVD 519          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: ENSORLT00000020861.2 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101167626])

HSP 1 Score: 95.1301 bits (235), Expect = 3.555e-20
Identity = 52/149 (34.90%), Postives = 82/149 (55.03%), Query Frame = 2
Query: 1322 FLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDPVILRNDCIIIRCSVE 1768
            F+WKI +F+KK + A  G  P + S  FY+ K GYK+ L IY +G  T +GT LS+FF + +G  D  L WP   ++ + L++Q  NR H  + F+ D +  SF     +P + +N+  G   F  L  L +    +R++ I I+  V+
Sbjct:  422 FIWKISDFTKKRQDAMAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQ-NNREHIIDAFRPDISSSSF----QRPVSDMNIASGCPLFCPLSKLDSKNSYIRDETIFIKAIVD 565          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: unm_sa808 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101155367])

HSP 1 Score: 94.7449 bits (234), Expect = 6.111e-20
Identity = 52/149 (34.90%), Postives = 81/149 (54.36%), Query Frame = 2
Query: 1322 FLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDPVILRNDCIIIRCSVE 1768
            F+W+I +F+KK + A  G  P + S  FY+ K GYK+ L IY +G  T +GT LS+FF + +G  D  L WP   ++ + L++Q +NR H  + F+ D    SF     +P + +N+  G   F  L  L      +R+D I I+  V+
Sbjct:  449 FIWRISDFAKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGLSDALLKWPFNQKVTLMLLDQ-SNREHIIDAFRPDVTSSSF----QRPVSEMNIASGCPLFCPLSKLDAKNSYIRDDTIFIKAIVD 592          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf3 (TNF receptor associated factor 3 [Source:NCBI gene;Acc:101161601])

HSP 1 Score: 88.9669 bits (219), Expect = 1.843e-18
Identity = 44/150 (29.33%), Postives = 81/150 (54.00%), Query Frame = 2
Query: 1322 FLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDPVILRNDCIIIRCSVEA 1771
             +WKI ++ ++ + A  G    + S  FY+   GYK+   +Y +G    +GT LS+FF + +GE+D  LPWP K ++ + L++Q  +R H  + FK D +  SF     +P   +N+  G   F++  ++      +++D I I+ +V+ 
Sbjct:  300 LIWKIRDYKRRKQDAVAGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPSRKHLGDAFKPDPSSSSF----RRPVAEMNIASGCPLFVS-QSVLESGTYIKDDTIFIKVTVDT 444          

HSP 2 Score: 49.6766 bits (117), Expect = 7.432e-6
Identity = 32/109 (29.36%), Postives = 54/109 (49.54%), Query Frame = 2
Query:  182 SEFRCVICHGILVNAHQSPCSCRFCWECISEYLHKGERFCPSGMEDCKEFPINLKKDIQIDYFMNRNISNLKVKCPNEC--CKMMIELKNLEEHMKHHIIRCPYYDIGC 502
            +++ C  C  +L    Q+ C  RFC+ CI++ L      CP+ ME     P+  K  I  D   +R I  LKV C +E   C+  + L+ + +H+      CP++++ C
Sbjct:   44 AKYCCEACRLVLCQPRQTECGHRFCYSCINDILSCPNPVCPADME-----PL-FKDKIFRDVCCHREIMALKVYCRSEANGCQEQMSLQQIPDHVN----VCPFFEVPC 142          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000067240.1 (SMESG000067240.1)

HSP 1 Score: 1005.74 bits (2599), Expect = 0.000e+0
Identity = 515/524 (98.28%), Postives = 515/524 (98.28%), Query Frame = 2
Query:  203 CHGILVNAHQSPCSCRFCWECISEYLHKGERFCPSGMEDCKEFPINLKKDIQIDYFMNRNISNLKVKCPNECCKMMIELKNLEEHMKHHIIRCPYYDIGCNSFESSDDKIKHHLITENYSHTKSLIKYIDNLTKELTLVKNKLKSSEENLRDNDNFKIDIKMIVNSXXXXXXXXXXKIALIKDDIDQCIIKNLRINDQFQASICQSQSPAGFNDENQDDKISFDEIKANNYSGDNTELNLLKNELALYTKEHKQLFDEMESRKNEIKIIDENXXXXXXXXXXXETRLEQLQIKNEPCESKMKNILNSKSETNKELVQNMIKKFIVDLTEPGTPLEISKIFTEIFNNNNKEDSPDLLRQSSFLEENSIKHNFSPFLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDPVILRNDCIIIRCSVEAI 1774
            C    V     PCSCRFCWECISEYLHKGERFCPSGMEDCKEFPINLKKDIQIDYFMNRNISNLKVKCPNECCKMMIELKNLEEHMKHHIIRCPYYDIGCNSFESSDDKIKHHLITENYSHTKSLIKYIDNLTKELTLVKNKLKSSEENLRDNDNFKIDIKMIVNSIQENIIEQNQKIALIKDDIDQCIIKNLRINDQFQASICQSQSPAGFNDENQDDKISFDEIKANNYSGDNTELNLLKNELALYTKEHKQLFDEMESRKNEIKIIDENLQLKQKLILKLETRLEQLQIKNEPCESKMKNILNSKSETNKELVQNMIKKFIVDLTEPGTPLEISKIFTEIFNNNNKEDSPDLLRQSSFLEENSIKHNFSPFLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDPVILRNDCIIIRCSVEAI
Sbjct:  287 CQVSNVKVFAYPCSCRFCWECISEYLHKGERFCPSGMEDCKEFPINLKKDIQIDYFMNRNISNLKVKCPNECCKMMIELKNLEEHMKHHIIRCPYYDIGCNSFESSDDKIKHHLITENYSHTKSLIKYIDNLTKELTLVKNKLKSSEENLRDNDNFKIDIKMIVNSIQENIIEQNQKIALIKDDIDQCIIKNLRINDQFQASICQSQSPAGFNDENQDDKISFDEIKANNYSGDNTELNLLKNELALYTKEHKQLFDEMESRKNEIKIIDENLQLKQKLILKLETRLEQLQIKNEPCESKMKNILNSKSETNKELVQNMIKKFIVDLTEPGTPLEISKIFTEIFNNNNKEDSPDLLRQSSFLEENSIKHNFSPFLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDPVILRNDCIIIRCSVEAI 810          

HSP 2 Score: 56.6102 bits (135), Expect = 4.985e-8
Identity = 24/27 (88.89%), Postives = 24/27 (88.89%), Query Frame = 3
Query:   57 ITLVLVCGGFNNECYLKCQVSNVKVFG 137
            I  VLVCGGFNNECYLKCQVSNVKVF 
Sbjct:  270 IVTVLVCGGFNNECYLKCQVSNVKVFA 296          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000067240.1 (SMESG000067240.1)

HSP 1 Score: 1005.36 bits (2598), Expect = 0.000e+0
Identity = 515/524 (98.28%), Postives = 515/524 (98.28%), Query Frame = 2
Query:  203 CHGILVNAHQSPCSCRFCWECISEYLHKGERFCPSGMEDCKEFPINLKKDIQIDYFMNRNISNLKVKCPNECCKMMIELKNLEEHMKHHIIRCPYYDIGCNSFESSDDKIKHHLITENYSHTKSLIKYIDNLTKELTLVKNKLKSSEENLRDNDNFKIDIKMIVNSXXXXXXXXXXKIALIKDDIDQCIIKNLRINDQFQASICQSQSPAGFNDENQDDKISFDEIKANNYSGDNTELNLLKNELALYTKEHKQLFDEMESRKNEIKIIDENXXXXXXXXXXXETRLEQLQIKNEPCESKMKNILNSKSETNKELVQNMIKKFIVDLTEPGTPLEISKIFTEIFNNNNKEDSPDLLRQSSFLEENSIKHNFSPFLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDPVILRNDCIIIRCSVEAI 1774
            C    V     PCSCRFCWECISEYLHKGERFCPSGMEDCKEFPINLKKDIQIDYFMNRNISNLKVKCPNECCKMMIELKNLEEHMKHHIIRCPYYDIGCNSFESSDDKIKHHLITENYSHTKSLIKYIDNLTKELTLVKNKLKSSEENLRDNDNFKIDIKMIVNSIQENIIEQNQKIALIKDDIDQCIIKNLRINDQFQASICQSQSPAGFNDENQDDKISFDEIKANNYSGDNTELNLLKNELALYTKEHKQLFDEMESRKNEIKIIDENLQLKQKLILKLETRLEQLQIKNEPCESKMKNILNSKSETNKELVQNMIKKFIVDLTEPGTPLEISKIFTEIFNNNNKEDSPDLLRQSSFLEENSIKHNFSPFLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDPVILRNDCIIIRCSVEAI
Sbjct:  286 CQVSNVKVFAYPCSCRFCWECISEYLHKGERFCPSGMEDCKEFPINLKKDIQIDYFMNRNISNLKVKCPNECCKMMIELKNLEEHMKHHIIRCPYYDIGCNSFESSDDKIKHHLITENYSHTKSLIKYIDNLTKELTLVKNKLKSSEENLRDNDNFKIDIKMIVNSIQENIIEQNQKIALIKDDIDQCIIKNLRINDQFQASICQSQSPAGFNDENQDDKISFDEIKANNYSGDNTELNLLKNELALYTKEHKQLFDEMESRKNEIKIIDENLQLKQKLILKLETRLEQLQIKNEPCESKMKNILNSKSETNKELVQNMIKKFIVDLTEPGTPLEISKIFTEIFNNNNKEDSPDLLRQSSFLEENSIKHNFSPFLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDPVILRNDCIIIRCSVEAI 809          

HSP 2 Score: 56.6102 bits (135), Expect = 5.025e-8
Identity = 24/27 (88.89%), Postives = 24/27 (88.89%), Query Frame = 3
Query:   57 ITLVLVCGGFNNECYLKCQVSNVKVFG 137
            I  VLVCGGFNNECYLKCQVSNVKVF 
Sbjct:  269 IVTVLVCGGFNNECYLKCQVSNVKVFA 295          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000067240.1 (SMESG000067240.1)

HSP 1 Score: 1004.97 bits (2597), Expect = 0.000e+0
Identity = 515/524 (98.28%), Postives = 515/524 (98.28%), Query Frame = 2
Query:  203 CHGILVNAHQSPCSCRFCWECISEYLHKGERFCPSGMEDCKEFPINLKKDIQIDYFMNRNISNLKVKCPNECCKMMIELKNLEEHMKHHIIRCPYYDIGCNSFESSDDKIKHHLITENYSHTKSLIKYIDNLTKELTLVKNKLKSSEENLRDNDNFKIDIKMIVNSXXXXXXXXXXKIALIKDDIDQCIIKNLRINDQFQASICQSQSPAGFNDENQDDKISFDEIKANNYSGDNTELNLLKNELALYTKEHKQLFDEMESRKNEIKIIDENXXXXXXXXXXXETRLEQLQIKNEPCESKMKNILNSKSETNKELVQNMIKKFIVDLTEPGTPLEISKIFTEIFNNNNKEDSPDLLRQSSFLEENSIKHNFSPFLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDPVILRNDCIIIRCSVEAI 1774
            C    V     PCSCRFCWECISEYLHKGERFCPSGMEDCKEFPINLKKDIQIDYFMNRNISNLKVKCPNECCKMMIELKNLEEHMKHHIIRCPYYDIGCNSFESSDDKIKHHLITENYSHTKSLIKYIDNLTKELTLVKNKLKSSEENLRDNDNFKIDIKMIVNSIQENIIEQNQKIALIKDDIDQCIIKNLRINDQFQASICQSQSPAGFNDENQDDKISFDEIKANNYSGDNTELNLLKNELALYTKEHKQLFDEMESRKNEIKIIDENLQLKQKLILKLETRLEQLQIKNEPCESKMKNILNSKSETNKELVQNMIKKFIVDLTEPGTPLEISKIFTEIFNNNNKEDSPDLLRQSSFLEENSIKHNFSPFLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDPVILRNDCIIIRCSVEAI
Sbjct:  285 CQVSNVKVFAYPCSCRFCWECISEYLHKGERFCPSGMEDCKEFPINLKKDIQIDYFMNRNISNLKVKCPNECCKMMIELKNLEEHMKHHIIRCPYYDIGCNSFESSDDKIKHHLITENYSHTKSLIKYIDNLTKELTLVKNKLKSSEENLRDNDNFKIDIKMIVNSIQENIIEQNQKIALIKDDIDQCIIKNLRINDQFQASICQSQSPAGFNDENQDDKISFDEIKANNYSGDNTELNLLKNELALYTKEHKQLFDEMESRKNEIKIIDENLQLKQKLILKLETRLEQLQIKNEPCESKMKNILNSKSETNKELVQNMIKKFIVDLTEPGTPLEISKIFTEIFNNNNKEDSPDLLRQSSFLEENSIKHNFSPFLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDPVILRNDCIIIRCSVEAI 808          

HSP 2 Score: 53.9138 bits (128), Expect = 3.050e-7
Identity = 22/25 (88.00%), Postives = 23/25 (92.00%), Query Frame = 3
Query:   63 LVLVCGGFNNECYLKCQVSNVKVFG 137
            +V VCGGFNNECYLKCQVSNVKVF 
Sbjct:  270 IVTVCGGFNNECYLKCQVSNVKVFA 294          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000067240.1 (SMESG000067240.1)

HSP 1 Score: 1004.97 bits (2597), Expect = 0.000e+0
Identity = 515/524 (98.28%), Postives = 515/524 (98.28%), Query Frame = 2
Query:  203 CHGILVNAHQSPCSCRFCWECISEYLHKGERFCPSGMEDCKEFPINLKKDIQIDYFMNRNISNLKVKCPNECCKMMIELKNLEEHMKHHIIRCPYYDIGCNSFESSDDKIKHHLITENYSHTKSLIKYIDNLTKELTLVKNKLKSSEENLRDNDNFKIDIKMIVNSXXXXXXXXXXKIALIKDDIDQCIIKNLRINDQFQASICQSQSPAGFNDENQDDKISFDEIKANNYSGDNTELNLLKNELALYTKEHKQLFDEMESRKNEIKIIDENXXXXXXXXXXXETRLEQLQIKNEPCESKMKNILNSKSETNKELVQNMIKKFIVDLTEPGTPLEISKIFTEIFNNNNKEDSPDLLRQSSFLEENSIKHNFSPFLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDPVILRNDCIIIRCSVEAI 1774
            C    V     PCSCRFCWECISEYLHKGERFCPSGMEDCKEFPINLKKDIQIDYFMNRNISNLKVKCPNECCKMMIELKNLEEHMKHHIIRCPYYDIGCNSFESSDDKIKHHLITENYSHTKSLIKYIDNLTKELTLVKNKLKSSEENLRDNDNFKIDIKMIVNSIQENIIEQNQKIALIKDDIDQCIIKNLRINDQFQASICQSQSPAGFNDENQDDKISFDEIKANNYSGDNTELNLLKNELALYTKEHKQLFDEMESRKNEIKIIDENLQLKQKLILKLETRLEQLQIKNEPCESKMKNILNSKSETNKELVQNMIKKFIVDLTEPGTPLEISKIFTEIFNNNNKEDSPDLLRQSSFLEENSIKHNFSPFLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDPVILRNDCIIIRCSVEAI
Sbjct:  284 CQVSNVKVFAYPCSCRFCWECISEYLHKGERFCPSGMEDCKEFPINLKKDIQIDYFMNRNISNLKVKCPNECCKMMIELKNLEEHMKHHIIRCPYYDIGCNSFESSDDKIKHHLITENYSHTKSLIKYIDNLTKELTLVKNKLKSSEENLRDNDNFKIDIKMIVNSIQENIIEQNQKIALIKDDIDQCIIKNLRINDQFQASICQSQSPAGFNDENQDDKISFDEIKANNYSGDNTELNLLKNELALYTKEHKQLFDEMESRKNEIKIIDENLQLKQKLILKLETRLEQLQIKNEPCESKMKNILNSKSETNKELVQNMIKKFIVDLTEPGTPLEISKIFTEIFNNNNKEDSPDLLRQSSFLEENSIKHNFSPFLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDPVILRNDCIIIRCSVEAI 807          

HSP 2 Score: 53.9138 bits (128), Expect = 3.210e-7
Identity = 22/25 (88.00%), Postives = 23/25 (92.00%), Query Frame = 3
Query:   63 LVLVCGGFNNECYLKCQVSNVKVFG 137
            +V VCGGFNNECYLKCQVSNVKVF 
Sbjct:  269 IVTVCGGFNNECYLKCQVSNVKVFA 293          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000067240.1 (SMESG000067240.1)

HSP 1 Score: 837.41 bits (2162), Expect = 0.000e+0
Identity = 438/440 (99.55%), Postives = 440/440 (100.00%), Query Frame = 2
Query:  455 HMKHHIIRCPYYDIGCNSFESSDDKIKHHLITENYSHTKSLIKYIDNLTKELTLVKNKLKSSEENLRDNDNFKIDIKMIVNSXXXXXXXXXXKIALIKDDIDQCIIKNLRINDQFQASICQSQSPAGFNDENQDDKISFDEIKANNYSGDNTELNLLKNELALYTKEHKQLFDEMESRKNEIKIIDENXXXXXXXXXXXETRLEQLQIKNEPCESKMKNILNSKSETNKELVQNMIKKFIVDLTEPGTPLEISKIFTEIFNNNNKEDSPDLLRQSSFLEENSIKHNFSPFLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDPVILRNDCIIIRCSVEAI 1774
            ++KHHIIRCPYYDIGCNSFESSDDKIKHHLITENYSHTKSLIKYIDNLTKELTLVKNKLKSSEENLRDNDNFKIDIKMIVNSIQENIIEQNQKIALIKDDIDQCIIKNLRINDQFQASICQSQSPAGFNDENQDDKISFDEIKANNYSGDNTELNLLKNELALYTKEHKQLFDEMESRKNEIKIIDENLQLKQKLILKLETRLEQLQIKNEPCESKMKNILNSKSETNKELVQNMIKKFIVDLTEPGTPLEISKIFTEIFNNNNKEDSPDLLRQSSFLEENSIKHNFSPFLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDPVILRNDCIIIRCSVEAI
Sbjct:   45 YIKHHIIRCPYYDIGCNSFESSDDKIKHHLITENYSHTKSLIKYIDNLTKELTLVKNKLKSSEENLRDNDNFKIDIKMIVNSIQENIIEQNQKIALIKDDIDQCIIKNLRINDQFQASICQSQSPAGFNDENQDDKISFDEIKANNYSGDNTELNLLKNELALYTKEHKQLFDEMESRKNEIKIIDENLQLKQKLILKLETRLEQLQIKNEPCESKMKNILNSKSETNKELVQNMIKKFIVDLTEPGTPLEISKIFTEIFNNNNKEDSPDLLRQSSFLEENSIKHNFSPFLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGIYPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHTTEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDPVILRNDCIIIRCSVEAI 484          

HSP 2 Score: 64.6994 bits (156), Expect = 1.046e-10
Identity = 33/53 (62.26%), Postives = 36/53 (67.92%), Query Frame = 2
Query:   95 MLFKMSSIKCESVWKFLTKYNLEFEIDLP----SEFRCVICHGILVNAHQSPC 241
            MLFKMSSIKCESVWKFLTKYNLEFEIDLP     +F   +   I +  H   C
Sbjct:    1 MLFKMSSIKCESVWKFLTKYNLEFEIDLPILVAVDFVGNVFQNIYIKHHIIRC 53          
The following BLAST results are available for this feature:
BLAST of TNF receptor-associated factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF12.211e-2034.44TNF receptor associated factor 1 [Source:HGNC Symb... [more]
TRAF11.277e-1934.44TNF receptor associated factor 1 [Source:HGNC Symb... [more]
TRAF11.277e-1934.44TNF receptor associated factor 1 [Source:HGNC Symb... [more]
TRAF29.163e-1934.48TNF receptor associated factor 2 [Source:HGNC Symb... [more]
TRAF33.533e-1832.00TNF receptor associated factor 3 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
trf-11.333e-1230.57TNF Receptor Associated Factor (TRAF) homolog; TRF... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf41.439e-1129.14gene:FBgn0026319 transcript:FBtr0077429[more]
Traf41.736e-1129.14gene:FBgn0026319 transcript:FBtr0334401[more]
Traf-like1.518e-629.47gene:FBgn0030748 transcript:FBtr0308606[more]
Traf-like1.518e-629.47gene:FBgn0030748 transcript:FBtr0074274[more]
Traf-like1.518e-629.47gene:FBgn0030748 transcript:FBtr0334036[more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BX901915.14.955e-2233.51pep chromosome:GRCz11:CHR_ALT_CTG5_1_18:28764891:2... [more]
AL844899.14.955e-2233.51pep chromosome:GRCz11:CHR_ALT_CTG5_2_4:28756846:28... [more]
traf2b8.649e-2235.86Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf2b8.649e-2235.86Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf2b1.212e-2135.57Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF22.720e-1834.48TNF receptor associated factor 2 [Source:NCBI gene... [more]
TRAF23.371e-1834.48TNF receptor associated factor 2 [Source:NCBI gene... [more]
slc12a14.304e-1830.46solute carrier family 12 member 1 [Source:Xenbase;... [more]
slc12a14.986e-1830.46solute carrier family 12 member 1 [Source:Xenbase;... [more]
slc12a11.152e-1730.46solute carrier family 12 member 1 [Source:Xenbase;... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf13.806e-1933.77TNF receptor-associated factor 1 [Source:MGI Symbo... [more]
Traf13.806e-1933.77TNF receptor-associated factor 1 [Source:MGI Symbo... [more]
Traf13.806e-1933.77TNF receptor-associated factor 1 [Source:MGI Symbo... [more]
Traf56.050e-1928.67TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
Traf56.050e-1928.67TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q13077|TRAF1_HUMAN6.132e-1934.44TNF receptor-associated factor 1 OS=Homo sapiens O... [more]
sp|P39428|TRAF1_MOUSE2.662e-1833.77TNF receptor-associated factor 1 OS=Mus musculus O... [more]
sp|Q12933|TRAF2_HUMAN4.400e-1834.48TNF receptor-associated factor 2 OS=Homo sapiens O... [more]
sp|P39429|TRAF2_MOUSE5.853e-1833.10TNF receptor-associated factor 2 OS=Mus musculus O... [more]
sp|P70191|TRAF5_MOUSE1.519e-1728.67TNF receptor-associated factor 5 OS=Mus musculus O... [more]
back to top
BLAST of TNF receptor-associated factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZID83.070e-3234.65TNF receptor associated factor-2 (Fragment) OS=Sch... [more]
H3B5Y89.782e-2423.43TNF receptor-associated factor OS=Latimeria chalum... [more]
A0A0F7GY085.003e-2137.50TNF receptor associated factor 5 (Fragment) OS=Sch... [more]
D5JG591.676e-2034.42TNF receptor-associated factor-2-like protein A OS... [more]
T1DBK61.044e-1932.28TRAF-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf2b6.378e-2232.56TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf2a9.313e-2136.24TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf2a1.096e-2036.24TNF receptor-associated factor 2-like [Source:NCBI... [more]
ENSAMXT00000035169.14.911e-1730.87pep primary_assembly:Astyanax_mexicanus-2.0:9:3354... [more]
traf11.506e-1630.99TNF receptor-associated factor 1-like [Source:NCBI... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000000074.14.240e-1928.34pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-... [more]
ENSPMAT00000002130.12.646e-1828.86pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 g... [more]
traf68.724e-1731.03TNF receptor-associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO352371.581e-2124.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494641.063e-1931.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412433.012e-1730.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO377503.281e-1632.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483949.050e-1633.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf2b5.918e-2134.90TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf2b6.347e-2134.90TNF receptor associated factor 2 [Source:NCBI gene... [more]
ENSORLT00000020861.23.555e-2034.90TNF receptor-associated factor 2 [Source:NCBI gene... [more]
unm_sa8086.111e-2034.90TNF receptor-associated factor 2 [Source:NCBI gene... [more]
traf31.843e-1829.33TNF receptor associated factor 3 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000067240.14.985e-898.28SMESG000067240.1[more]
SMESG000067240.15.025e-898.28SMESG000067240.1[more]
SMESG000067240.13.050e-798.28SMESG000067240.1[more]
SMESG000067240.13.210e-798.28SMESG000067240.1[more]
SMESG000067240.11.046e-1099.55SMESG000067240.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011078 ID=SMED30011078|Name=TNF receptor-associated factor|organism=Schmidtea mediterranea sexual|type=transcript|length=1825bp
AAGTCATTTTAATTTAGTTGATCCATTTGTTCATTCGAATTTGTTTCATT
TTTCAAATTACATTAGTTCTAGTATGTGGAGGATTTAATAATGAATGCTA
TTTAAAATGTCAAGTATCAAATGTGAAAGTGTTTGGAAATTCCTTACAAA
GTATAATTTAGAATTCGAAATAGATTTGCCTAGTGAGTTTAGATGTGTTA
TATGTCATGGCATACTTGTTAATGCTCATCAAAGTCCTTGTAGCTGTAGA
TTTTGTTGGGAATGTATTTCAGAATATTTACATAAAGGTGAAAGATTTTG
CCCAAGTGGAATGGAAGATTGCAAAGAATTTCCTATTAACTTGAAAAAAG
ATATTCAAATAGATTACTTTATGAATCGTAATATATCAAATCTTAAAGTC
AAATGTCCAAATGAATGCTGTAAAATGATGATTGAATTGAAAAATTTAGA
GGAACATATGAAGCATCACATTATTCGGTGCCCATATTACGACATTGGTT
GTAATAGTTTTGAATCTTCTGATGATAAAATAAAACATCATTTAATTACT
GAAAATTACAGCCATACAAAATCACTGATAAAATACATTGATAACTTGAC
TAAAGAATTAACTTTAGTTAAAAATAAATTAAAATCCTCCGAAGAGAATT
TAAGAGATAATGATAATTTTAAAATCGACATAAAAATGATTGTTAATTCA
ATCCAGGAGAACATTATTGAACAAAACCAAAAAATCGCGCTTATAAAAGA
TGACATTGACCAGTGCATCATAAAAAATCTAAGAATAAATGATCAATTCC
AAGCTTCTATTTGCCAATCGCAATCACCTGCTGGCTTTAACGATGAAAAC
CAGGATGACAAAATTTCTTTTGATGAAATCAAAGCAAACAATTATTCTGG
TGATAACACGGAACTTAACTTATTGAAAAATGAGTTAGCTTTATATACAA
AAGAGCATAAACAATTATTTGATGAAATGGAATCAAGGAAAAATGAAATA
AAAATTATTGATGAAAATTTACAATTGAAACAAAAATTAATCTTAAAATT
AGAGACTCGTCTCGAACAATTACAAATCAAAAATGAACCGTGTGAAAGCA
AAATGAAAAATATACTAAATTCAAAATCAGAAACAAATAAAGAGTTAGTT
CAAAATATGATAAAGAAATTTATAGTGGATTTGACGGAGCCAGGCACTCC
ACTTGAGATAAGTAAAATTTTCACAGAAATATTCAATAATAATAATAAAG
AAGATTCGCCCGATTTGCTTAGACAATCCAGCTTTCTGGAAGAAAATTCT
ATAAAACATAACTTTTCTCCATTTCTTTGGAAAATCGATAATTTCTCAAA
AAAGTGGAAATCCGCCCGAGATGGAACCGATCCCTACATTATGAGCAGTG
ATTTCTATTCCCAGAAAAACGGTTACAAACTTATCCTCGGTATCTATCCC
GACGGATTCGATACAGAACAAGGCACATTTTTATCGGTGTTTTTTCACAT
TGCCAAAGGTGAATTTGATAATAATTTACCCTGGCCCATGAAAAATGAAA
TATTAATAAGTTTAATCAACCAAGAAACTAACAGACCGCACACAACTGAG
AAATTCAAATTTGATACCGCGGAAAAGAGTTTCCTTCCCTCGTATTATCA
ACCGAAAACTGCTATAAATTTAGGCTATGGAGATACTCAATTCATAAATT
TATTAACCTTATTCAACGATCCAGTCATCCTTAGAAATGATTGTATCATT
ATAAGATGTTCTGTAGAAGCAATTTGAGCACATAAATATAAATGATTTTT
ATTTAGATTATTTCTTGAAAACCTA
back to top

protein sequence of SMED30011078-orf-1

>SMED30011078-orf-1 ID=SMED30011078-orf-1|Name=SMED30011078-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=561bp
MLFKMSSIKCESVWKFLTKYNLEFEIDLPSEFRCVICHGILVNAHQSPCS
CRFCWECISEYLHKGERFCPSGMEDCKEFPINLKKDIQIDYFMNRNISNL
KVKCPNECCKMMIELKNLEEHMKHHIIRCPYYDIGCNSFESSDDKIKHHL
ITENYSHTKSLIKYIDNLTKELTLVKNKLKSSEENLRDNDNFKIDIKMIV
NSIQENIIEQNQKIALIKDDIDQCIIKNLRINDQFQASICQSQSPAGFND
ENQDDKISFDEIKANNYSGDNTELNLLKNELALYTKEHKQLFDEMESRKN
EIKIIDENLQLKQKLILKLETRLEQLQIKNEPCESKMKNILNSKSETNKE
LVQNMIKKFIVDLTEPGTPLEISKIFTEIFNNNNKEDSPDLLRQSSFLEE
NSIKHNFSPFLWKIDNFSKKWKSARDGTDPYIMSSDFYSQKNGYKLILGI
YPDGFDTEQGTFLSVFFHIAKGEFDNNLPWPMKNEILISLINQETNRPHT
TEKFKFDTAEKSFLPSYYQPKTAINLGYGDTQFINLLTLFNDPVILRNDC
IIIRCSVEAI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005164tumor necrosis factor receptor binding
GO:0003676nucleic acid binding
GO:0005515protein binding
GO:0046872metal ion binding
GO:0008270zinc ion binding
GO:0004842ubiquitin-protein transferase activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0042981regulation of apoptotic process
GO:0043123positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0006955immune response
GO:0007165signal transduction
GO:0016567protein ubiquitination
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR043211TNF_rcpt-assoc_TRAF
IPR013087Znf_C2H2_type
IPR002083MATH/TRAF_dom
IPR008974TRAF-like
IPR013083Znf_RING/FYVE/PHD
IPR007087Znf_C2H2
IPR001841Znf_RING
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 274..294
NoneNo IPR availableCOILSCoilCoilcoord: 309..329
NoneNo IPR availableCOILSCoilCoilcoord: 165..185
NoneNo IPR availablePANTHERPTHR10131:SF129TNF RECEPTOR-ASSOCIATED FACTOR 6coord: 17..124
NoneNo IPR availablePANTHERPTHR10131:SF129TNF RECEPTOR-ASSOCIATED FACTOR 6coord: 297..558
NoneNo IPR availableCDDcd16449RING-HCcoord: 34..70
e-value: 1.47665E-7
score: 45.9213
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 27..105
IPR002083MATH/TRAF domainSMARTSM00061math_3coord: 412..539
e-value: 2.7E-9
score: 46.9
IPR002083MATH/TRAF domainPROSITEPS50144MATHcoord: 407..557
score: 20.493
IPR008974TRAF-likeGENE3DG3DSA:2.60.210.10coord: 375..559
e-value: 7.5E-41
score: 141.8
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 99..150
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 410..559
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 18..140
e-value: 8.3E-18
score: 66.6
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 17..124
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 297..558
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 104..125
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 34..70
score: 8.742