Evi/Wls

Overview
NameEvi/Wls (ACJ64863.1)
Smed IDSMED30011055
Length (bp)2183
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Evi/Wls (SMED30011055) t-SNE clustered cells

Violin plots show distribution of expression levels for Evi/Wls (SMED30011055) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Evi/Wls (SMED30011055) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Evi/Wls (SMED30011055) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011055

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 24

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
posterior region of the whole animalSMED30011055SMESG000068488.1 dd_Smed_v4_9546_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30011055SMESG000068488.1 dd_Smed_v4_9546_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30011055SMESG000068488.1 dd_Smed_v4_9546_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30011055SMESG000068488.1 dd_Smed_v4_9546_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30011055SMESG000068488.1 dd_Smed_v4_9546_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011055SMESG000068488.1 Contig40818newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011055SMESG000068488.1 Contig40818uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
tail regionSMED30011055SMESG000068488.1 dd_Smed_v6_11629_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
esophagusSMED30011055SMESG000068488.1 dd_Smed_v6_9546_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
tail regionSMED30011055SMESG000068488.1 dd_Smed_v6_9546_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
tail regionSMED30011055SMESG000068488.1 dd_Smed_v6_9546_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
tail regionSMED30011055SMESG000068488.1 OX_Smed_1.0.11066ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30011055SMESG000068488.1 FJ463748.1smed_ncbi_20200123PMID:19211673
Adell et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
nervous systemSMED30011055SMESG000068488.1 FJ463748.1smed_ncbi_20200123PMID:19211673
Adell et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30011055SMESG000068488.1 FJ463748.1smed_ncbi_20200123PMID:19211673
Adell et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
mouthSMED30011055SMESG000068488.1 FJ463748.1smed_ncbi_20200123PMID:19211673
Adell et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
ventral nerve cordSMED30011055SMESG000068488.1 FJ463748.1smed_ncbi_20200123PMID:19211673
Adell et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30011055SMESG000068488.1 FJ463748.1smed_ncbi_20200123PMID:19211673
Adell et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30011055SMESG000068488.1 FJ463748smed_ncbi_20200123PMID:19211673
Adell et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
nervous systemSMED30011055SMESG000068488.1 FJ463748smed_ncbi_20200123PMID:19211673
Adell et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30011055SMESG000068488.1 FJ463748smed_ncbi_20200123PMID:19211673
Adell et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
mouthSMED30011055SMESG000068488.1 FJ463748smed_ncbi_20200123PMID:19211673
Adell et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
ventral nerve cordSMED30011055SMESG000068488.1 FJ463748smed_ncbi_20200123PMID:19211673
Adell et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30011055SMESG000068488.1 FJ463748smed_ncbi_20200123PMID:19211673
Adell et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Evi/Wls vs. Ensembl Human
Match: WLS (Wnt ligand secretion mediator [Source:HGNC Symbol;Acc:HGNC:30238])

HSP 1 Score: 423.705 bits (1088), Expect = 3.850e-140
Identity = 212/521 (40.69%), Postives = 315/521 (60.46%), Query Frame = 3
Query:  132 MPGVVLETLSWKKLGIFIGIIFTCQFICFLIGGFIAPHPNGHTDVLTEKCIDRNPLSNPNKWFYNRLDGDEVTCKEKLPDEIQD-DFINPFNLSAIQIVFAAQFPLPRNGVSLNMSRWFQQLIGILNLDIKYRKDIKMVNEFMLTLDVRLGRRNKGDKEWTEIARSMEHRPLRCVLDEQATIKLNKGEIIDGYYYDCELLPLFSMGSCFYDEYLVNIRIPYDRKHKINTELGKLQDLWVTEIHQNGGFTMVWFALKTTMFPLTLTALVFFWYRISLLDRNPNLLEQTIISLGVMMSILNFPIEWLSLRYNLSFWLVLSDIRQGGFYAMLLCFWVIFTGEHIIEDNVASQKSAKERLYYYWPQLIPVGAASCFLFIFELAERGVQLNNPFYSVWSNKTTAYIAIAFVAISVTCAPLYFIFLFYKIVRAIKQMLSKRSILSSLPEVRRKFYSGVIFRFTLFIIYTLLCATLTVIFFIVSQIDESQWKWGQKKLEYTSAFITGVYGMWNFYVISILCLYAPSHK 1691
            M G ++E +S KKL I  GI+   Q I FL+GG IAP P      ++ KC+D     +  KWF        V       D+I+D +   P  + A  IVF+   PLP     + MS WFQ ++ IL LDI ++ + ++     +++DV L  R+    EWTE+A     R L+C      T +       +G YY+C++LP   +GS  +  YL+NIR+P + K KIN  +G+++D+ +  IHQNGGFT VWFA+KT + P     +V++W RI+++ R P LLE+ I +LG+ M+ +N P+EW S+ ++ ++ L+  DIRQG FYAMLL FW+IF GEH+++ +       +  +  YW Q+ P+   S  LFIF++ ERGVQL NPFYS+W+      +A+AF+ ++  C  LYF+FL + + +  + +  K+S L ++ +VRR  Y G+IFRF   ++ TL CA +TVIFFIVSQ+ E  WKWG   ++  SAF TG+YGMWN YV +++ LYAPSHK
Sbjct:    1 MAGAIIENMSTKKLCIVGGILLVFQIIAFLVGGLIAPGPTTAVSYMSVKCVDARKNHHKTKWF--------VPWGPNHCDKIRDIEEAIPREIEANDIVFSVHIPLPH----MEMSPWFQFMLFILQLDIAFKLNNQIRENAEVSMDVSLAYRDDAFAEWTEMAHERVPRKLKCTFTSPKTPEH------EGRYYECDVLPFMEIGSVAHKFYLLNIRLPVNEKKKINVGIGEIKDIRLVGIHQNGGFTKVWFAMKTFLTPSIFIIMVWYWRRITMMSRPPVLLEKVIFALGISMTFINIPVEWFSIGFDWTWMLLFGDIRQGIFYAMLLSFWIIFCGEHMMDQH------ERNHIAGYWKQVGPIAVGSFCLFIFDMCERGVQLTNPFYSIWTTDIGTELAMAFIIVAGICLCLYFLFLCFMVFQVFRNISGKQSSLPAMSKVRRLHYEGLIFRFKFLMLITLACAAMTVIFFIVSQVTEGHWKWGGVTVQVNSAFFTGIYGMWNLYVFALMFLYAPSHK 497          
BLAST of Evi/Wls vs. Ensembl Human
Match: WLS (Wnt ligand secretion mediator [Source:HGNC Symbol;Acc:HGNC:30238])

HSP 1 Score: 414.846 bits (1065), Expect = 1.442e-136
Identity = 210/524 (40.08%), Postives = 313/524 (59.73%), Query Frame = 3
Query:  132 MPGVVLETLSWKKLGIFIGIIFTCQFICFLIGGFIAPHPNGHTDVLTEKCIDRNPLSNPNKWFY----NRLDGDEVTCKEKLPDEIQDDFINPFNLSAIQIVFAAQFPLPRNGVSLNMSRWFQQLIGILNLDIKYRKDIKMVNEFMLTLDVRLGRRNKGDKEWTEIARSMEHRPLRCVLDEQATIKLNKGEIIDGYYYDCELLPLFSMGSCFYDEYLVNIRIPYDRKHKINTELGKLQDLWVTEIHQNGGFTMVWFALKTTMFPLTLTALVFFWYRISLLDRNPNLLEQTIISLGVMMSILNFPIEWLSLRYNLSFWLVLSDIRQGGFYAMLLCFWVIFTGEHIIEDNVASQKSAKERLYYYWPQLIPVGAASCFLFIFELAERGVQLNNPFYSVWSNKTTAYIAIAFVAISVTCAPLYFIFLFYKIVRAIKQMLSKRSILSSLPEVRRKFYSGVIFRFTLFIIYTLLCATLTVIFFIVSQIDESQWKWGQKKLEYTSAFITGVYGMWNFYVISILCLYAPSHK 1691
            M G ++E +S KKL I  GI+   Q I FL+GG I P        ++ KC+D     +  KWF     N  D      +E +P EI+ +           IVF+   PLP     + MS WFQ ++ IL LDI ++ + ++     +++DV L  R+    EWTE+A     R L+C      T +       +G YY+C++LP   +GS  +  YL+NIR+P + K KIN  +G+++D+ +  IHQNGGFT VWFA+KT + P     +V++W RI+++ R P LLE+ I +LG+ M+ +N P+EW S+ ++ ++ L+  DIRQG FYAMLL FW+IF GEH+++ +       +  +  YW Q+ P+   S  LFIF++ ERGVQL NPFYS+W+      +A+AF+ ++  C  LYF+FL + + +  + +  K+S L ++ +VRR  Y G+IFRF   ++ TL CA +TVIFFIVSQ+ E  WKWG   ++  SAF TG+YGMWN YV +++ LYAPSHK
Sbjct:    1 MAGAIIENMSTKKLCIVGGILLVFQIIAFLVGGLIGP--TTAVSYMSVKCVDARKNHHKTKWFVPWGPNHCDKIR-DIEEAIPREIEAN----------DIVFSVHIPLPH----MEMSPWFQFMLFILQLDIAFKLNNQIRENAEVSMDVSLAYRDDAFAEWTEMAHERVPRKLKCTFTSPKTPEH------EGRYYECDVLPFMEIGSVAHKFYLLNIRLPVNEKKKINVGIGEIKDIRLVGIHQNGGFTKVWFAMKTFLTPSIFIIMVWYWRRITMMSRPPVLLEKVIFALGISMTFINIPVEWFSIGFDWTWMLLFGDIRQGIFYAMLLSFWIIFCGEHMMDQH------ERNHIAGYWKQVGPIAVGSFCLFIFDMCERGVQLTNPFYSIWTTDIGTELAMAFIIVAGICLCLYFLFLCFMVFQVFRNISGKQSSLPAMSKVRRLHYEGLIFRFKFLMLITLACAAMTVIFFIVSQVTEGHWKWGGVTVQVNSAFFTGIYGMWNLYVFALMFLYAPSHK 495          
BLAST of Evi/Wls vs. Ensembl Human
Match: WLS (Wnt ligand secretion mediator [Source:HGNC Symbol;Acc:HGNC:30238])

HSP 1 Score: 354.369 bits (908), Expect = 1.603e-114
Identity = 164/378 (43.39%), Postives = 245/378 (64.81%), Query Frame = 3
Query:  558 LTLDVRLGRRNKGDKEWTEIARSMEHRPLRCVLDEQATIKLNKGEIIDGYYYDCELLPLFSMGSCFYDEYLVNIRIPYDRKHKINTELGKLQDLWVTEIHQNGGFTMVWFALKTTMFPLTLTALVFFWYRISLLDRNPNLLEQTIISLGVMMSILNFPIEWLSLRYNLSFWLVLSDIRQGGFYAMLLCFWVIFTGEHIIEDNVASQKSAKERLYYYWPQLIPVGAASCFLFIFELAERGVQLNNPFYSVWSNKTTAYIAIAFVAISVTCAPLYFIFLFYKIVRAIKQMLSKRSILSSLPEVRRKFYSGVIFRFTLFIIYTLLCATLTVIFFIVSQIDESQWKWGQKKLEYTSAFITGVYGMWNFYVISILCLYAPSHK 1691
            +++DV L  R+    EWTE+A     R L+C      T +       +G YY+C++LP   +GS  +  YL+NIR+P + K KIN  +G+++D+ +  IHQNGGFT VWFA+KT + P     +V++W RI+++ R P LLE+ I +LG+ M+ +N P+EW S+ ++ ++ L+  DIRQG FYAMLL FW+IF GEH+++ +       +  +  YW Q+ P+   S  LFIF++ ERGVQL NPFYS+W+      +A+AF+ ++  C  LYF+FL + + +  + +  K+S L ++ +VRR  Y G+IFRF   ++ TL CA +TVIFFIVSQ+ E  WKWG   ++  SAF TG+YGMWN YV +++ LYAPSHK
Sbjct:   41 VSMDVSLAYRDDAFAEWTEMAHERVPRKLKCTFTSPKTPEH------EGRYYECDVLPFMEIGSVAHKFYLLNIRLPVNEKKKINVGIGEIKDIRLVGIHQNGGFTKVWFAMKTFLTPSIFIIMVWYWRRITMMSRPPVLLEKVIFALGISMTFINIPVEWFSIGFDWTWMLLFGDIRQGIFYAMLLSFWIIFCGEHMMDQH------ERNHIAGYWKQVGPIAVGSFCLFIFDMCERGVQLTNPFYSIWTTDIGTELAMAFIIVAGICLCLYFLFLCFMVFQVFRNISGKQSSLPAMSKVRRLHYEGLIFRFKFLMLITLACAAMTVIFFIVSQVTEGHWKWGGVTVQVNSAFFTGIYGMWNLYVFALMFLYAPSHK 406          
BLAST of Evi/Wls vs. Ensembl Human
Match: WLS (Wnt ligand secretion mediator [Source:HGNC Symbol;Acc:HGNC:30238])

HSP 1 Score: 151.754 bits (382), Expect = 3.038e-41
Identity = 85/240 (35.42%), Postives = 132/240 (55.00%), Query Frame = 3
Query:  267 LTEKCIDRNPLSNPNKWFYNRLDGDEVTCKEKLPDEIQD-DFINPFNLSAIQIVFAAQFPLPRNGVSLNMSRWFQQLIGILNLDIKYRKDIKMVNEFMLTLDVRLGRRNKGDKEWTEIARSMEHRPLRCVLDEQATIKLNKGEIIDGYYYDCELLPLFSMGSCFYDEYLVNIRIPYDRKHKINTELGKLQDLWVTEIHQNGGFTMVWFALKTTMFPLTLTALVFFWYRISLLDRNPNLLE 983
            ++ KC+D     +  KWF        V       D+I+D +   P  + A  IVF+   PLP     + MS WFQ ++ IL LDI ++ + ++     +++DV L  R+    EWTE+A     R L+C      T +       +G YY+C++LP   +GS  +  YL+NIR+P + K KIN  +G+++D+ +  IHQNGGFT VWFA+KT + P     +V++W RI+++ R P LLE
Sbjct:    1 MSVKCVDARKNHHKTKWF--------VPWGPNHCDKIRDIEEAIPREIEANDIVFSVHIPLPH----MEMSPWFQFMLFILQLDIAFKLNNQIRENAEVSMDVSLAYRDDAFAEWTEMAHERVPRKLKCTFTSPKTPEH------EGRYYECDVLPFMEIGSVAHKFYLLNIRLPVNEKKKINVGIGEIKDIRLVGIHQNGGFTKVWFAMKTFLTPSIFIIMVWYWRRITMMSRPPVLLE 222          
BLAST of Evi/Wls vs. Ensembl Human
Match: WLS (Wnt ligand secretion mediator [Source:HGNC Symbol;Acc:HGNC:30238])

HSP 1 Score: 145.976 bits (367), Expect = 1.743e-39
Identity = 67/172 (38.95%), Postives = 108/172 (62.79%), Query Frame = 3
Query:  558 LTLDVRLGRRNKGDKEWTEIARSMEHRPLRCVLDEQATIKLNKGEIIDGYYYDCELLPLFSMGSCFYDEYLVNIRIPYDRKHKINTELGKLQDLWVTEIHQNGGFTMVWFALKTTMFPLTLTALVFFWYRISLLDRNPNLLEQTIISLGVMMSILNFPIEWLSLRYNLSFWL 1073
            +++DV L  R+    EWTE+A     R L+C      T +       +G YY+C++LP   +GS  +  YL+NIR+P + K KIN  +G+++D+ +  IHQNGGFT VWFA+KT + P     +V++W RI+++ R P LLE+ I +LG+ M+ +N P+EW S+ ++ ++ L
Sbjct:   35 VSMDVSLAYRDDAFAEWTEMAHERVPRKLKCTFTSPKTPEH------EGRYYECDVLPFMEIGSVAHKFYLLNIRLPVNEKKKINVGIGEIKDIRLVGIHQNGGFTKVWFAMKTFLTPSIFIIMVWYWRRITMMSRPPVLLEKVIFALGISMTFINIPVEWFSIGFDWTWML 200          
BLAST of Evi/Wls vs. Ensembl Celegans
Match: mig-14 (pep chromosome:WBcel235:II:13741742:13749983:1 gene:WBGene00003246.1 transcript:R06B9.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mig-14)

HSP 1 Score: 336.65 bits (862), Expect = 8.723e-107
Identity = 214/544 (39.34%), Postives = 308/544 (56.62%), Query Frame = 3
Query:  138 GVVLETLSWKKLGIFIGIIFTCQFICFLIGGFIAPHPNGHTDVLTEKCIDRNPLSNPNKWFYNRLDGDEVTCKEKLPDEIQDDFINPFNLSAIQIVFAAQFPLPRNGVSLNMSRWFQQLIGILNLDIKYRKDIKMVNEFMLTLDVRLGRRNKGDK--EWTEIARSMEHRPLRCVLDEQATIKLNKGEIIDGYYYDCELLPLFSMGSCFYDEYLVNIRIPYDRK------HKINTELGKLQDLWVTEIHQNGGFTMVWFALKTTMFPLTLTALVFFWYRISLLDRNPNLLEQTIISLGVMMSILNFPIEWLSLRYNLSFWLVLSDIRQGGFYAMLLCFWVIFTGEHIIEDNVASQKSAKERLYYYWPQLIPVGAASCFLFIFELAERGVQLNNPFYSVWSNKTTAYIAIAFVAISVTCAPLYFIFLFYKIVRAIKQMLSKRSI-LSSLPEVRRKFYSGVIFRFTLFIIYTLLCATLTVIFFIVSQIDESQWKWGQKKLEY----TSAFITGVYGMWNFYVISILCLYAPSHK-YRNRNIISDTDD 1727
            G V+E LS +KL +    +   Q + FLIG + AP P+ + +     C D        +W +         C++    E+ +   + F+L   +IVF A+ P  R+G+ L  S WFQ L+G+L++D++Y +  K V    L L+VR+G R+K  K  EW E+  S   R L C + E         E   G  YDC++L LF +GS  Y  YL+NIRIP +++         N ++GKL  L + EIHQNGGFT+VW   KT M P+    L +++ RI+ L RNP LLE+ I+ LG+ + IL+FPIEW+SL Y + F L++SD+RQG FY +L  FW+IF GEH+I+DN       +  L  Y   L  +  AS  L I++L ERG+QL +PFYSVWS+ T + IA   + IS      YFIFLF+KI R    + SKRS  +    E RR    GVI+RF   +++TLLC+  T+  + + Q  E+Q    + +  +    TSAF TG +GM N YV+ +L +YAPSHK YR  + + D +D
Sbjct:    4 GAVIENLSNRKLFVIFAGLLVIQIMFFLIGAWYAPSPSSYMEFEMITCRDETK-GLSGEWIHRD------NCQQ--ISELSEYTPSSFDLR--EIVFIAKMPHTRDGIELEYSPWFQFLLGVLHVDVEYSEHFKYVAHAPLELEVRMGYRDKESKKNEWKELVTSNVTRILECTIAED--------EKKAGGTYDCDMLDLFELGSSSYPFYLINIRIPINQQACQFDNKSANCQIGKLTGLRLIEIHQNGGFTLVWLWTKTFMTPVVAICLWWYYNRINQLARNPLLLERAILLLGLSLVILDFPIEWISLTYRIPFLLLISDLRQGLFYTVLFSFWLIFAGEHLIDDNT------RNNLKSYRFNLSFIITASLGLLIYDLIERGIQLYDPFYSVWSSPTGSQIAYFAIFISAISTVAYFIFLFFKIARVWSTIKSKRSAQIYQTSENRRLKVEGVIYRFKFLMLFTLLCSAFTIAAYFMKQYGEAQLHGDEARDGFLTGSTSAFFTGAFGMCNIYVLLLLAMYAPSHKHYRGASQLIDEND 522          
BLAST of Evi/Wls vs. Ensembl Fly
Match: wls (gene:FBgn0036141 transcript:FBtr0076219)

HSP 1 Score: 427.557 bits (1098), Expect = 1.086e-141
Identity = 223/560 (39.82%), Postives = 327/560 (58.39%), Query Frame = 3
Query:  132 MPGVVLETLSWKKLGIFIGIIFTCQFICFLIGGFIAPHPNGHTDVLTEKCIDRNPLSNPNKWF-YNRLDGDEVTCKEKLPDEIQDDFINPFNLSAIQIVFAAQFPLPRNGVSLNMSRWFQQLIGILNLDIKYRKDIKM---VNEFMLTLDVRLGRRNKGDKE--WTEIARSMEHRPLRCVLDEQATIKLNKGEIIDGYYYDCELLPLFSMGSCFYDEYLVNIRIPYDRKHKINTELGKLQDLWVTEIHQNGGFTMVWFALKTTMFPLTLTALVFFWYRISLLDRNPNLLEQTIISLGVMMSILNFPIEWLSLRYNLSFWLVLSDIRQGGFYAMLLCFWVIFTGEHIIEDNVASQKSAKERLYYYWPQLIPVGAASCFLFIFELAERGVQLNNPFYSVWSNKTTAYIAIAFVAISVTCAPLYFIFLFYKIVRAIKQMLSKRSILSSLPEVRRKFYSGVIFRFTLFIIYTLLCATLTVIFFIVSQIDESQWKWGQK-KLEYTSAFITGVYGMWNFYVISILCLYAPSHKYRNRNIISDTDDLLSNTKEASESVVVQYYANDI 1790
            M G +LE LS +KL I +  +  CQ +CFL+GG  AP P GH  VL   C + +   N   +  Y+R  G    C     +E++ D     N    ++V   Q PLPR+   L+ SRW Q LIG+L ++  Y    ++     E  LT+D+RL  RNKGD +  W   A  +EHR L CV     T  +   E +    Y C+++PLF +G+  +  YL+N+R P D   ++N + G + DL +T IHQNGGFT +W  LKT +FP  +  +++FW R+ LL R+P LLE  +I LG  ++ LN P+E+LSL Y + + L+LSDIRQG FYAMLL FW++F GEH++  +  ++ + + R   YW  L  V      LF+F++ ERGVQL NPFYS+W+    A +A+ F+ ++   A +YF+FL Y I +  + +  KR+ L S+ + RR  Y G+I+RF   ++ TL+CA LTV  FI+ Q+ E QW W     ++ TSAF+TGVYGMWN Y+ ++L LYAPSHK       SD       T +++E++V    + +I
Sbjct:    1 MSGTILENLSGRKLSILVATLLLCQVLCFLLGGLYAPLPAGHVTVLGSLCREDHARQNDTSFLLYSRGAG---ACIPVTREEVEQDSTKMAN----ELVHVFQMPLPRDLRDLDYSRWQQNLIGVLQVEFGYDSSSELREPPRELQLTIDMRLAYRNKGDPDNGWKLYAHGVEHRYLDCV-----TSHVGPTETL----YSCDMIPLFELGALHHSFYLLNLRFPLDTPSQMNLQFGHMHDLTLTAIHQNGGFTQIWLLLKTMLFPFVVGIMIWFWRRVHLLQRSPALLEYMLIYLGAALTFLNLPLEYLSLVYEMPYMLLLSDIRQGIFYAMLLTFWLVFAGEHMLIQDAPNKSTIRSR---YWKHLSAVVVGCISLFVFDICERGVQLRNPFYSIWTTPLGAKVAMTFIVLAGVSAAIYFLFLCYMIWKVFRNIGDKRTSLPSMSQARRLHYEGLIYRFKFLMLATLVCAALTVAGFIMGQMAEGQWDWNDNVAIQPTSAFLTGVYGMWNIYIFALLILYAPSHKQWPTMHHSD------ETTQSNENIVASAASEEI 535          
BLAST of Evi/Wls vs. Ensembl Fly
Match: wls (gene:FBgn0036141 transcript:FBtr0076218)

HSP 1 Score: 410.609 bits (1054), Expect = 1.424e-134
Identity = 223/592 (37.67%), Postives = 327/592 (55.24%), Query Frame = 3
Query:  132 MPGVVLETLSWKKLGIFIGIIFTCQFICFLIGGFIAPHPNGHTDVLTEKCIDRNPLSNPNKWF-YNRLDGDEVTCKEKLPDEIQDDFINPFNLSAIQIVFAAQFPLPRNGVSLNMSRWFQQLIGILNLDIKYRKDIKM---VNEFMLTLDVRLGRRNKGDKE--WTEIARSMEHRPLRCVLDEQATIKLNKGEIIDGYYYDCELLPLFSMGSCFYDEYLVNIRIPYDRKHKINTELGKLQDLWVTEIHQNGGFTMVWFALKTTMFPLTLTALVFFWYRISLLDRNPNLLEQTIISLGVMMSILNFPIEWLSLRYNLSFWLVLSDIRQGGFYAMLLCFWVIFTGEHIIEDNVASQKSAKERLYYYWPQLIPVGAASCFLFIFELAERGVQLNNPFYSVWSNKTTAYIAIAFVAISVTCAPLYFIFLFYKIVRAIKQMLSKRSILSSLPEVRRKFYS--------------------------------GVIFRFTLFIIYTLLCATLTVIFFIVSQIDESQWKWGQK-KLEYTSAFITGVYGMWNFYVISILCLYAPSHKYRNRNIISDTDDLLSNTKEASESVVVQYYANDI 1790
            M G +LE LS +KL I +  +  CQ +CFL+GG  AP P GH  VL   C + +   N   +  Y+R  G    C     +E++ D     N    ++V   Q PLPR+   L+ SRW Q LIG+L ++  Y    ++     E  LT+D+RL  RNKGD +  W   A  +EHR L CV     T  +   E +    Y C+++PLF +G+  +  YL+N+R P D   ++N + G + DL +T IHQNGGFT +W  LKT +FP  +  +++FW R+ LL R+P LLE  +I LG  ++ LN P+E+LSL Y + + L+LSDIRQG FYAMLL FW++F GEH++  +  ++ + + R   YW  L  V      LF+F++ ERGVQL NPFYS+W+    A +A+ F+ ++   A +YF+FL Y I +  + +  KR+ L S+ + RR  Y                                 G+I+RF   ++ TL+CA LTV  FI+ Q+ E QW W     ++ TSAF+TGVYGMWN Y+ ++L LYAPSHK       SD       T +++E++V    + +I
Sbjct:    1 MSGTILENLSGRKLSILVATLLLCQVLCFLLGGLYAPLPAGHVTVLGSLCREDHARQNDTSFLLYSRGAG---ACIPVTREEVEQDSTKMAN----ELVHVFQMPLPRDLRDLDYSRWQQNLIGVLQVEFGYDSSSELREPPRELQLTIDMRLAYRNKGDPDNGWKLYAHGVEHRYLDCV-----TSHVGPTETL----YSCDMIPLFELGALHHSFYLLNLRFPLDTPSQMNLQFGHMHDLTLTAIHQNGGFTQIWLLLKTMLFPFVVGIMIWFWRRVHLLQRSPALLEYMLIYLGAALTFLNLPLEYLSLVYEMPYMLLLSDIRQGIFYAMLLTFWLVFAGEHMLIQDAPNKSTIRSR---YWKHLSAVVVGCISLFVFDICERGVQLRNPFYSIWTTPLGAKVAMTFIVLAGVSAAIYFLFLCYMIWKVFRNIGDKRTSLPSMSQARRLHYEVPLDQKVEDWAGIVYFYTKAFFFQLHKANESKGLIYRFKFLMLATLVCAALTVAGFIMGQMAEGQWDWNDNVAIQPTSAFLTGVYGMWNIYIFALLILYAPSHKQWPTMHHSD------ETTQSNENIVASAASEEI 567          
BLAST of Evi/Wls vs. Ensembl Zebrafish
Match: wls (Wnt ligand secretion mediator [Source:ZFIN;Acc:ZDB-GENE-040426-2161])

HSP 1 Score: 424.861 bits (1091), Expect = 1.140e-140
Identity = 219/543 (40.33%), Postives = 322/543 (59.30%), Query Frame = 3
Query:  132 MPGVVLETLSWKKLGIFIGIIFTCQFICFLIGGFIAPHPNGHTDVLTEKCIDRNPLSNPN-KWFYNRLDGDEVTCKEKLPDEIQDDFINPFNLSAIQIVFAAQFPLPRNGVSLNMSRWFQQLIGILNLDIKYRKDIKMVNEFMLTLDVRLGRRNKGDKEWTEIARSMEHRPLRCVLDEQATIKLNKGEIIDGYYYDCELLPLFSMGSCFYDEYLVNIRIPYDRKHKINTELGKLQDLWVTEIHQNGGFTMVWFALKTTMFPLTLTALVFFWYRISLLDRNPNLLEQTIISLGVMMSILNFPIEWLSLRYNLSFWLVLSDIRQGGFYAMLLCFWVIFTGEHIIEDNVASQKSAKERLYYYWPQLIPVGAASCFLFIFELAERGVQLNNPFYSVWSNKTTAYIAIAFVAISVTCAPLYFIFLFYKIVRAIKQMLSKRSILSSLPEVRRKFYSGVIFRFTLFIIYTLLCATLTVIFFIVSQIDESQWKWGQKKLEYTSAFITGVYGMWNFYVISILCLYAPSHKYRNRNIISDTDDLLSNTKEASE 1757
            M G ++E +S KKL I   I+   Q   F++GG IAP P      L  KC+D     + N KWF     G +   K K  DE     I   N     IVFA   P P       MS WFQ L+ IL+ DI ++   ++ +   +T+DVRL  R+    EWT++A S+E R L C      TI+ N+G +     YDC+LLP   +GS  +  YL+N+R+P + + K+N  +G++ D+ +  IHQNGGFT VWFA+KT + P  L  ++++W RI+ + R P LLE+ I +LG+ M+ +N P+EW S+ ++ ++ L+  DIRQG FYAMLL FW+IF GEH+++      ++ + R   YW Q+IP+   S  LFIF++ ERGVQL NPFYS+W++     +A+AF+ ++  CA LYF+FL + + +  + +  KRS L ++ + RR  Y G+IFRF   ++ TL CA +TVIFFI+SQ+ E  W WG   ++  SAF TG+YGMWN YV +++ LYAPSHK         + D   N+ E ++
Sbjct:    1 MAGAIIENMSTKKLVILGVILMLFQAFSFMVGGLIAPSPTAAVSYLATKCVDNEKTHHKNPKWFTPW--GPDQCSKIKDFDEAMVKKIEANN-----IVFAIHIPPPNT----EMSTWFQFLLLILHFDIAFKIQNQIADGASITIDVRLAYRDDKLSEWTQMAHSVEQRKLSCNFTAAKTIE-NEGRL-----YDCDLLPFMELGSVAHKYYLLNVRLPVNERKKVNIGIGEINDMRLVGIHQNGGFTKVWFAMKTFLTPSVLIIMIWYWKRITQMTRPPVLLEKVIFALGISMTFINIPVEWFSVGFDWTWMLLFGDIRQGIFYAMLLSFWIIFCGEHLMD------QTERNRFSVYWKQVIPIVFGSFCLFIFDMCERGVQLKNPFYSIWASDVGTELAMAFIIVAGICACLYFLFLCFMVFQVFRNISGKRSCLPAMTKARRLHYEGLIFRFKFLMLVTLACAAMTVIFFIISQVSEGHWLWGGHTVQVNSAFFTGIYGMWNLYVFALMFLYAPSHKRYGDE--QSSADQAGNSGEDTQ 518          
BLAST of Evi/Wls vs. Ensembl Xenopus
Match: wls (wntless Wnt ligand secretion mediator [Source:NCBI gene;Acc:549664])

HSP 1 Score: 416.001 bits (1068), Expect = 3.969e-137
Identity = 218/539 (40.45%), Postives = 323/539 (59.93%), Query Frame = 3
Query:  132 MPGVVLETLSWKKLGIFIGIIFTCQFICFLIGGFIAPHPNGHTDVLTEKCIDRNPLSNPNKWFYNRLDGDEVTCKE-KLPDEIQDDFINPFNLSAIQIVFAAQFPLPRNGVSLNMSRWFQQLIGILNLDIKYRKDIKMVNEFMLTLDVRLGRRNKGDKEWTEIARSMEHRPLRCVLDEQATIKLNKGEIIDGYYYDCELLPLFSMGSCFYDEYLVNIRIPYDRKHKINTELGKLQDLWVTEIHQNGGFTMVWFALKTTMFPLTLTALVFFWYRISLLDRNPNLLEQTIISLGVMMSILNFPIEWLSLRYNLSFWLVLSDIRQGGFYAMLLCFWVIFTGEHIIEDNVASQKSAKERLYYYWPQLIPVGAASCFLFIFELAERGVQLNNPFYSVWSNKTTAYIAIAFVAISVTCAPLYFIFLFYKIVRAIKQMLSKRSILSSLPEVRRKFYSGVIFRFTLFIIYTLLCATLTVIFFIVSQIDESQWKWGQKKLEYTSAFITGVYGMWNFYVISILCLYAPSHKYRNRNIISDTDDLLSNTK 1745
            M G ++E +S KKL +    +   Q + FL+GG IAP P  + + +  KC+D     + +KWF   L   +  CK  +  DE  +  I      A  IVFAA  P         MS WFQ ++ +L LDI ++ +  + +  M+ L+V +  R+   +EW E+A SME R L C+L  + T+        +G  YDC+++PL  +GS  +  YL NIR+P   K K N  +G+++DL V  I QNGGFTMVWFA+KT + P  +  ++++W RI+++ R+P LLE+ I +LG  M+ +N P+EW S+ Y+ ++ L+  DIRQG FYAMLL FW+IF GEH+++      ++ + R+  YW Q+ P+   SC LFIF++ ERGVQL NPFYS+W+    A IA+AF+ ++  CA LYF+FL + + +  + +  K+S L  + + RR  Y G+IFRF   +I TL CA LTV+FFI +QI E  WK G   +E  SAF TG+YGMWN YV +++ LYAPSHK+      +D   + S  +
Sbjct:    1 MAGAIIENMSTKKLCMVGVALLLLQVLAFLVGGLIAPKPTSYVNPVAMKCVDIRKNHHSSKWF---LPWGKGQCKSIQTFDEATNGHI-----EANDIVFAAHIP----NSQFEMSPWFQFMLVVLQLDIAFKLNNYIEDNSMVNLNVSVAYRDDLKEEWKELASSMEQRKLNCILPVEKTVA------NEGRQYDCDVIPLMELGSVSHKYYLFNIRLPVSEKKKSNIAIGEIRDLHVVCIFQNGGFTMVWFAMKTFLTPCIIIIMIWYWRRITMMTRSPVLLEKVIFALGFSMTFINIPVEWFSIGYDWTWMLLFGDIRQGIFYAMLLSFWIIFCGEHMMD------QTERNRISVYWKQVGPIAFGSCCLFIFDMCERGVQLKNPFYSIWTTDVGAEIAMAFIIVAGICACLYFLFLCFMVYQVFRNISGKQSNLPEMSKARRLHYEGLIFRFKFLMIITLACAALTVVFFITTQITEGNWKLGDLSIELNSAFFTGIYGMWNLYVFALMFLYAPSHKHYEDGHSNDGAGMSSGEE 515          
BLAST of Evi/Wls vs. Ensembl Xenopus
Match: wls (wntless Wnt ligand secretion mediator [Source:NCBI gene;Acc:549664])

HSP 1 Score: 402.519 bits (1033), Expect = 4.639e-132
Identity = 204/506 (40.32%), Postives = 306/506 (60.47%), Query Frame = 3
Query:  231 FIAPHPNGHTDVLTEKCIDRNPLSNPNKWFYNRLDGDEVTCKE-KLPDEIQDDFINPFNLSAIQIVFAAQFPLPRNGVSLNMSRWFQQLIGILNLDIKYRKDIKMVNEFMLTLDVRLGRRNKGDKEWTEIARSMEHRPLRCVLDEQATIKLNKGEIIDGYYYDCELLPLFSMGSCFYDEYLVNIRIPYDRKHKINTELGKLQDLWVTEIHQNGGFTMVWFALKTTMFPLTLTALVFFWYRISLLDRNPNLLEQTIISLGVMMSILNFPIEWLSLRYNLSFWLVLSDIRQGGFYAMLLCFWVIFTGEHIIEDNVASQKSAKERLYYYWPQLIPVGAASCFLFIFELAERGVQLNNPFYSVWSNKTTAYIAIAFVAISVTCAPLYFIFLFYKIVRAIKQMLSKRSILSSLPEVRRKFYSGVIFRFTLFIIYTLLCATLTVIFFIVSQIDESQWKWGQKKLEYTSAFITGVYGMWNFYVISILCLYAPSHKYRNRNIISDTDDLLSNTK 1745
            F++P P  + + +  KC+D     + +KWF   L   +  CK  +  DE  +      ++ A  IVFAA  P         MS WFQ ++ +L LDI ++ +  + +  M+ L+V +  R+   +EW E+A SME R L C+L  + T+        +G  YDC+++PL  +GS  +  YL NIR+P   K K N  +G+++DL V  I QNGGFTMVWFA+KT + P  +  ++++W RI+++ R+P LLE+ I +LG  M+ +N P+EW S+ Y+ ++ L+  DIRQG FYAMLL FW+IF GEH+++      ++ + R+  YW Q+ P+   SC LFIF++ ERGVQL NPFYS+W+    A IA+AF+ ++  CA LYF+FL + + +  + +  K+S L  + + RR  Y G+IFRF   +I TL CA LTV+FFI +QI E  WK G   +E  SAF TG+YGMWN YV +++ LYAPSHK+      +D   + S  +
Sbjct:   24 FLSPKPTSYVNPVAMKCVDIRKNHHSSKWF---LPWGKGQCKSIQTFDEATNG-----HIEANDIVFAAHIP----NSQFEMSPWFQFMLVVLQLDIAFKLNNYIEDNSMVNLNVSVAYRDDLKEEWKELASSMEQRKLNCILPVEKTVA------NEGRQYDCDVIPLMELGSVSHKYYLFNIRLPVSEKKKSNIAIGEIRDLHVVCIFQNGGFTMVWFAMKTFLTPCIIIIMIWYWRRITMMTRSPVLLEKVIFALGFSMTFINIPVEWFSIGYDWTWMLLFGDIRQGIFYAMLLSFWIIFCGEHMMD------QTERNRISVYWKQVGPIAFGSCCLFIFDMCERGVQLKNPFYSIWTTDVGAEIAMAFIIVAGICACLYFLFLCFMVYQVFRNISGKQSNLPEMSKARRLHYEGLIFRFKFLMIITLACAALTVVFFITTQITEGNWKLGDLSIELNSAFFTGIYGMWNLYVFALMFLYAPSHKHYEDGHSNDGAGMSSGEE 505          
BLAST of Evi/Wls vs. Ensembl Xenopus
Match: wls (wntless Wnt ligand secretion mediator [Source:NCBI gene;Acc:549664])

HSP 1 Score: 397.512 bits (1020), Expect = 1.103e-130
Identity = 202/488 (41.39%), Postives = 300/488 (61.48%), Query Frame = 3
Query:  234 IAPHPNGHTDVLTEKCIDRNPLSNPNKWFYNRLDGDEVTCKE-KLPDEIQDDFINPFNLSAIQIVFAAQFPLPRNGVSLNMSRWFQQLIGILNLDIKYRKDIKMVNEFMLTLDVRLGRRNKGDKEWTEIARSMEHRPLRCVLDEQATIKLNKGEIIDGYYYDCELLPLFSMGSCFYDEYLVNIRIPYDRKHKINTELGKLQDLWVTEIHQNGGFTMVWFALKTTMFPLTLTALVFFWYRISLLDRNPNLLEQTIISLGVMMSILNFPIEWLSLRYNLSFWLVLSDIRQGGFYAMLLCFWVIFTGEHIIEDNVASQKSAKERLYYYWPQLIPVGAASCFLFIFELAERGVQLNNPFYSVWSNKTTAYIAIAFVAISVTCAPLYFIFLFYKIVRAIKQMLSKRSILSSLPEVRRKFYSGVIFRFTLFIIYTLLCATLTVIFFIVSQIDESQWKWGQKKLEYTSAFITGVYGMWNFYVISILCLYAPSHKY 1694
            +AP P  + + +  KC+D     + +KWF   L   +  CK  +  DE  +      ++ A  IVFAA  P         MS WFQ ++ +L LDI ++ +  + +  M+ L+V +  R+   +EW E+A SME R L C+L  + T+        +G  YDC+++PL  +GS  +  YL NIR+P   K K N  +G+++DL V  I QNGGFTMVWFA+KT + P  +  ++++W RI+++ R+P LLE+ I +LG  M+ +N P+EW S+ Y+ ++ L+  DIRQG FYAMLL FW+IF GEH+++      ++ + R+  YW Q+ P+   SC LFIF++ ERGVQL NPFYS+W+    A IA+AF+ ++  CA LYF+FL + + +  + +  K+S L  + + RR  Y G+IFRF   +I TL CA LTV+FFI +QI E  WK G   +E  SAF TG+YGMWN YV +++ LYAPSHK+
Sbjct:    1 LAPKPTSYVNPVAMKCVDIRKNHHSSKWF---LPWGKGQCKSIQTFDEATNG-----HIEANDIVFAAHIP----NSQFEMSPWFQFMLVVLQLDIAFKLNNYIEDNSMVNLNVSVAYRDDLKEEWKELASSMEQRKLNCILPVEKTVA------NEGRQYDCDVIPLMELGSVSHKYYLFNIRLPVSEKKKSNIAIGEIRDLHVC-IFQNGGFTMVWFAMKTFLTPCIIIIMIWYWRRITMMTRSPVLLEKVIFALGFSMTFINIPVEWFSIGYDWTWMLLFGDIRQGIFYAMLLSFWIIFCGEHMMD------QTERNRISVYWKQVGPIAFGSCCLFIFDMCERGVQLKNPFYSIWTTDVGAEIAMAFIIVAGICACLYFLFLCFMVYQVFRNISGKQSNLPEMSKARRLHYEGLIFRFKFLMIITLACAALTVVFFITTQITEGNWKLGDLSIELNSAFFTGIYGMWNLYVFALMFLYAPSHKH 463          
BLAST of Evi/Wls vs. Ensembl Xenopus
Match: wls (wntless Wnt ligand secretion mediator [Source:NCBI gene;Acc:549664])

HSP 1 Score: 367.081 bits (941), Expect = 1.235e-119
Identity = 175/410 (42.68%), Postives = 260/410 (63.41%), Query Frame = 3
Query:  516 IKYRKDIKMVNEFMLTLDVRLGRRNKGDKEWTEIARSMEHRPLRCVLDEQATIKLNKGEIIDGYYYDCELLPLFSMGSCFYDEYLVNIRIPYDRKHKINTELGKLQDLWVTEIHQNGGFTMVWFALKTTMFPLTLTALVFFWYRISLLDRNPNLLEQTIISLGVMMSILNFPIEWLSLRYNLSFWLVLSDIRQGGFYAMLLCFWVIFTGEHIIEDNVASQKSAKERLYYYWPQLIPVGAASCFLFIFELAERGVQLNNPFYSVWSNKTTAYIAIAFVAISVTCAPLYFIFLFYKIVRAIKQMLSKRSILSSLPEVRRKFYSGVIFRFTLFIIYTLLCATLTVIFFIVSQIDESQWKWGQKKLEYTSAFITGVYGMWNFYVISILCLYAPSHKYRNRNIISDTDDLLSNTK 1745
            ++  K   + +  M+ L+V +  R+   +EW E+A SME R L C+L  + T+        +G  YDC+++PL  +GS  +  YL NIR+P   K K N  +G+++DL V  I QNGGFTMVWFA+KT + P  +  ++++W RI+++ R+P LLE+ I +LG  M+ +N P+EW S+ Y+ ++ L+  DIRQG FYAMLL FW+IF GEH+++      ++ + R+  YW Q+ P+   SC LFIF++ ERGVQL NPFYS+W+    A IA+AF+ ++  CA LYF+FL + + +  + +  K+S L  + + RR  Y G+IFRF   +I TL CA LTV+FFI +QI E  WK G   +E  SAF TG+YGMWN YV +++ LYAPSHK+      +D   + S  +
Sbjct:   11 LRREKRQVLADNSMVNLNVSVAYRDDLKEEWKELASSMEQRKLNCILPVEKTVA------NEGRQYDCDVIPLMELGSVSHKYYLFNIRLPVSEKKKSNIAIGEIRDLHVVCIFQNGGFTMVWFAMKTFLTPCIIIIMIWYWRRITMMTRSPVLLEKVIFALGFSMTFINIPVEWFSIGYDWTWMLLFGDIRQGIFYAMLLSFWIIFCGEHMMD------QTERNRISVYWKQVGPIAFGSCCLFIFDMCERGVQLKNPFYSIWTTDVGAEIAMAFIIVAGICACLYFLFLCFMVYQVFRNISGKQSNLPEMSKARRLHYEGLIFRFKFLMIITLACAALTVVFFITTQITEGNWKLGDLSIELNSAFFTGIYGMWNLYVFALMFLYAPSHKHYEDGHSNDGAGMSSGEE 408          
BLAST of Evi/Wls vs. Ensembl Mouse
Match: Wls (wntless WNT ligand secretion mediator [Source:MGI Symbol;Acc:MGI:1915401])

HSP 1 Score: 422.165 bits (1084), Expect = 1.245e-139
Identity = 211/524 (40.27%), Postives = 316/524 (60.31%), Query Frame = 3
Query:  132 MPGVVLETLSWKKLGIFIGIIFTCQFICFLIGGFIAPHPNGHTDVLTEKCIDRNPLSNPNKWFY----NRLDGDEVTCKEKLPDEIQDDFINPFNLSAIQIVFAAQFPLPRNGVSLNMSRWFQQLIGILNLDIKYRKDIKMVNEFMLTLDVRLGRRNKGDKEWTEIARSMEHRPLRCVLDEQATIKLNKGEIIDGYYYDCELLPLFSMGSCFYDEYLVNIRIPYDRKHKINTELGKLQDLWVTEIHQNGGFTMVWFALKTTMFPLTLTALVFFWYRISLLDRNPNLLEQTIISLGVMMSILNFPIEWLSLRYNLSFWLVLSDIRQGGFYAMLLCFWVIFTGEHIIEDNVASQKSAKERLYYYWPQLIPVGAASCFLFIFELAERGVQLNNPFYSVWSNKTTAYIAIAFVAISVTCAPLYFIFLFYKIVRAIKQMLSKRSILSSLPEVRRKFYSGVIFRFTLFIIYTLLCATLTVIFFIVSQIDESQWKWGQKKLEYTSAFITGVYGMWNFYVISILCLYAPSHK 1691
            M G ++E +S KKL I  GI+   Q + FL+GG IAP P         KC+D     +  +W      N+ D      +E +P EI+ +           IVF+   PLP    S+ MS WFQ ++ IL LDI ++ + ++     +++DV LG R+    EWTE+A     R L+C      T +       +G YY+C++LP   +GS  +  YL+NIR+P + K KIN  +G+++D+ +  IHQNGGFT VWFA+KT + P     +V++W RI+++ R P LLE+ I +LG+ M+ +N P+EW S+ ++ ++ L+  DIRQG FYAMLL FW+IF GEH+++ +       +  +  YW Q+ P+   S  LFIF++ ERGVQL NPFYS+W+      +A+AF+ ++  C  LYF+FL + + +  + +  K+S L ++ +VRR  Y G+IFRF   ++ TL CA +TVIFFIVSQ+ E  WKWG   ++ +SAF TG+YGMWN YV +++ LYAPSHK
Sbjct:    1 MAGAIIENMSTKKLCIVGGILLVFQIVAFLVGGLIAPAPTTAVPYTAIKCVDVRKNHHKTRWLAPWGPNKCDKIR-DIEEAIPREIEAN----------DIVFSVHIPLP----SMEMSPWFQFMLFILQLDIAFKLNNQIRENAEISMDVSLGYRDDMFSEWTEMAHERVPRKLKCTFTSPKTPEH------EGRYYNCDVLPFMEIGSVAHKYYLLNIRLPVNEKKKINVGIGEIKDIRLVGIHQNGGFTKVWFAMKTFLTPSIFIIMVWYWRRITMMSRPPVLLEKVIFALGISMTFINIPVEWFSIGFDWTWMLLFGDIRQGIFYAMLLSFWIIFCGEHMMDQH------ERNHIAGYWKQVGPIAVGSFCLFIFDMCERGVQLTNPFYSIWTTDVGTELAMAFIIVAGICLCLYFLFLCFMVFQVFRNISGKQSSLPAMSKVRRLHYEGLIFRFKFLMLITLACAAMTVIFFIVSQVSEGHWKWGGVTVQVSSAFFTGIYGMWNLYVFALMFLYAPSHK 497          
BLAST of Evi/Wls vs. Ensembl Mouse
Match: Wls (wntless WNT ligand secretion mediator [Source:MGI Symbol;Acc:MGI:1915401])

HSP 1 Score: 422.165 bits (1084), Expect = 1.245e-139
Identity = 211/524 (40.27%), Postives = 316/524 (60.31%), Query Frame = 3
Query:  132 MPGVVLETLSWKKLGIFIGIIFTCQFICFLIGGFIAPHPNGHTDVLTEKCIDRNPLSNPNKWFY----NRLDGDEVTCKEKLPDEIQDDFINPFNLSAIQIVFAAQFPLPRNGVSLNMSRWFQQLIGILNLDIKYRKDIKMVNEFMLTLDVRLGRRNKGDKEWTEIARSMEHRPLRCVLDEQATIKLNKGEIIDGYYYDCELLPLFSMGSCFYDEYLVNIRIPYDRKHKINTELGKLQDLWVTEIHQNGGFTMVWFALKTTMFPLTLTALVFFWYRISLLDRNPNLLEQTIISLGVMMSILNFPIEWLSLRYNLSFWLVLSDIRQGGFYAMLLCFWVIFTGEHIIEDNVASQKSAKERLYYYWPQLIPVGAASCFLFIFELAERGVQLNNPFYSVWSNKTTAYIAIAFVAISVTCAPLYFIFLFYKIVRAIKQMLSKRSILSSLPEVRRKFYSGVIFRFTLFIIYTLLCATLTVIFFIVSQIDESQWKWGQKKLEYTSAFITGVYGMWNFYVISILCLYAPSHK 1691
            M G ++E +S KKL I  GI+   Q + FL+GG IAP P         KC+D     +  +W      N+ D      +E +P EI+ +           IVF+   PLP    S+ MS WFQ ++ IL LDI ++ + ++     +++DV LG R+    EWTE+A     R L+C      T +       +G YY+C++LP   +GS  +  YL+NIR+P + K KIN  +G+++D+ +  IHQNGGFT VWFA+KT + P     +V++W RI+++ R P LLE+ I +LG+ M+ +N P+EW S+ ++ ++ L+  DIRQG FYAMLL FW+IF GEH+++ +       +  +  YW Q+ P+   S  LFIF++ ERGVQL NPFYS+W+      +A+AF+ ++  C  LYF+FL + + +  + +  K+S L ++ +VRR  Y G+IFRF   ++ TL CA +TVIFFIVSQ+ E  WKWG   ++ +SAF TG+YGMWN YV +++ LYAPSHK
Sbjct:    1 MAGAIIENMSTKKLCIVGGILLVFQIVAFLVGGLIAPAPTTAVPYTAIKCVDVRKNHHKTRWLAPWGPNKCDKIR-DIEEAIPREIEAN----------DIVFSVHIPLP----SMEMSPWFQFMLFILQLDIAFKLNNQIRENAEISMDVSLGYRDDMFSEWTEMAHERVPRKLKCTFTSPKTPEH------EGRYYNCDVLPFMEIGSVAHKYYLLNIRLPVNEKKKINVGIGEIKDIRLVGIHQNGGFTKVWFAMKTFLTPSIFIIMVWYWRRITMMSRPPVLLEKVIFALGISMTFINIPVEWFSIGFDWTWMLLFGDIRQGIFYAMLLSFWIIFCGEHMMDQH------ERNHIAGYWKQVGPIAVGSFCLFIFDMCERGVQLTNPFYSIWTTDVGTELAMAFIIVAGICLCLYFLFLCFMVFQVFRNISGKQSSLPAMSKVRRLHYEGLIFRFKFLMLITLACAAMTVIFFIVSQVSEGHWKWGGVTVQVSSAFFTGIYGMWNLYVFALMFLYAPSHK 497          
BLAST of Evi/Wls vs. UniProt/SwissProt
Match: sp|Q2LZ37|WLS_DROPS (Protein wntless OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=wls PE=3 SV=2)

HSP 1 Score: 446.047 bits (1146), Expect = 8.452e-148
Identity = 230/560 (41.07%), Postives = 338/560 (60.36%), Query Frame = 3
Query:  132 MPGVVLETLSWKKLGIFIGIIFTCQFICFLIGGFIAPHPNGHTDVLTEKCIDRNPLSNPNKWF-YNRLDGDEVTCKEKLPDEIQDDFINPFNLSAIQIVFAAQFPLPRNGVSLNMSRWFQQLIGILNLDIKYRKDIKM---VNEFMLTLDVRLGRRNKGDKE--WTEIARSMEHRPLRCVLDEQATIKLNKGEIIDGYYYDCELLPLFSMGSCFYDEYLVNIRIPYDRKHKINTELGKLQDLWVTEIHQNGGFTMVWFALKTTMFPLTLTALVFFWYRISLLDRNPNLLEQTIISLGVMMSILNFPIEWLSLRYNLSFWLVLSDIRQGGFYAMLLCFWVIFTGEHIIEDNVASQKSAKERLYYYWPQLIPVGAASCFLFIFELAERGVQLNNPFYSVWSNKTTAYIAIAFVAISVTCAPLYFIFLFYKIVRAIKQMLSKRSILSSLPEVRRKFYSGVIFRFTLFIIYTLLCATLTVIFFIVSQIDESQWKWGQK-KLEYTSAFITGVYGMWNFYVISILCLYAPSHKYRNRNIISDTDDLLSNTKEASESVVVQYYANDI 1790
            M G +LE LS +KL I +G +  CQ +CFL+GG  AP P GHT+VL   C + +   N   +F Y+R +G   +C +   +E++ D +   N    QIV   Q PLPR+   L+ SRW Q LIG+L ++  Y    ++     E  LT+D+RL  RNKGD +  W   A  +EHR L CV        +   E +    Y C+++PLF +G+  +  YL+N+R P D   ++N + G + DL +T IHQNGGFT VW  LKT +FP  +  +V+FW R+ LL R+P LLE  ++ LG  ++ LN P+E+LSL   + + L+LSDIRQG FYAMLL FW++F GEH++  + +++ + + R   YW  L  V      LF+F+++ERGVQL NPFYS+W+    A +A++F+ ++   A +YF+FL Y I +  K +  KR+ L S+ + RR  Y G+I+RF   ++ TLLCA LTV  FI+ Q+ E QWKW    +++ TSAF+TGVYGMWN Y+ ++L LYAPSHK       SD       T +++E++V    + +I
Sbjct:    1 MSGTILENLSGRKLSILVGSLLLCQVLCFLLGGLYAPVPAGHTNVLGSLCRENHARQNDTSFFLYSRGEG---SCTQVTREEVEQDSMKLAN----QIVHVFQMPLPRDSRVLDYSRWQQNLIGVLQVEFGYDSSSELREPPKELQLTIDMRLAYRNKGDPDHAWKLYAHGVEHRYLDCV-----AAHIGSSETL----YTCDMIPLFELGALHHSFYLLNLRFPLDTPKQMNLQFGHMHDLTLTAIHQNGGFTHVWLMLKTLLFPFVVGIMVWFWRRVHLLQRSPALLEYMLLYLGGALTFLNLPLEYLSLTIEMPYMLLLSDIRQGIFYAMLLSFWLVFAGEHMLIQDSSNKSTIRSR---YWKHLSAVVVGCISLFVFDISERGVQLRNPFYSIWTTPLGAKVAMSFILLAGVSAAVYFLFLCYMISKVFKNIGDKRTSLPSMSQARRLHYEGLIYRFKFLMLATLLCAALTVTGFIMGQMAEGQWKWNDDVEIQLTSAFLTGVYGMWNIYIFALLILYAPSHKQWPTMHHSD------ETTQSNENIVASAASEEI 535          
BLAST of Evi/Wls vs. UniProt/SwissProt
Match: sp|B4GZN1|WLS_DROPE (Protein wntless OS=Drosophila persimilis OX=7234 GN=wls PE=3 SV=1)

HSP 1 Score: 445.277 bits (1144), Expect = 1.836e-147
Identity = 230/560 (41.07%), Postives = 337/560 (60.18%), Query Frame = 3
Query:  132 MPGVVLETLSWKKLGIFIGIIFTCQFICFLIGGFIAPHPNGHTDVLTEKCIDRNPLSNPNKWF-YNRLDGDEVTCKEKLPDEIQDDFINPFNLSAIQIVFAAQFPLPRNGVSLNMSRWFQQLIGILNLDIKYRKDIKM---VNEFMLTLDVRLGRRNKGDKE--WTEIARSMEHRPLRCVLDEQATIKLNKGEIIDGYYYDCELLPLFSMGSCFYDEYLVNIRIPYDRKHKINTELGKLQDLWVTEIHQNGGFTMVWFALKTTMFPLTLTALVFFWYRISLLDRNPNLLEQTIISLGVMMSILNFPIEWLSLRYNLSFWLVLSDIRQGGFYAMLLCFWVIFTGEHIIEDNVASQKSAKERLYYYWPQLIPVGAASCFLFIFELAERGVQLNNPFYSVWSNKTTAYIAIAFVAISVTCAPLYFIFLFYKIVRAIKQMLSKRSILSSLPEVRRKFYSGVIFRFTLFIIYTLLCATLTVIFFIVSQIDESQWKWGQK-KLEYTSAFITGVYGMWNFYVISILCLYAPSHKYRNRNIISDTDDLLSNTKEASESVVVQYYANDI 1790
            M G +LE LS +KL I +G +  CQ +CFL+GG  AP P GHT+VL   C + +   N   +F Y+R +G   +C +   +E++ D +   N    QIV   Q PLPR+   L+ SRW Q LIG+L ++  Y    ++     E  LT+D+RL  RNKGD +  W   A  +EHR L CV        +   E +    Y C+++PLF +G+  +  YL+N+R P D   ++N + G + DL +T IHQNGGFT VW  LKT +FP  +  +V+FW R+ LL R+P LLE  ++ LG  ++ LN P+E+LSL   + + L+LSDIRQG FYAMLL FW++F GEH++  +  ++ + + R   YW  L  V      LF+F+++ERGVQL NPFYS+W+    A +A++F+ ++   A +YF+FL Y I +  K +  KR+ L S+ + RR  Y G+I+RF   ++ TLLCA LTV  FI+ Q+ E QWKW    +++ TSAF+TGVYGMWN Y+ ++L LYAPSHK       SD       T +++E++V    + +I
Sbjct:    1 MSGTILENLSGRKLSILVGSLLLCQVLCFLLGGLYAPVPAGHTNVLGSLCRENHARQNDTSFFLYSRGEG---SCTQVTREEVEQDSMKLAN----QIVHVFQMPLPRDSRVLDYSRWQQNLIGVLQVEFGYDSSSELREPPKELQLTIDMRLAYRNKGDPDHAWKLYAHGVEHRYLDCV-----AAHIGSSETL----YTCDMIPLFELGALHHSFYLLNLRFPLDTPKQMNLQFGHMHDLTLTAIHQNGGFTHVWLMLKTLLFPFVVGIMVWFWRRVHLLQRSPALLEYMLLYLGGALTFLNLPLEYLSLTIEMPYMLLLSDIRQGIFYAMLLSFWLVFAGEHMLIQDSHNKSTIRSR---YWKHLSAVVVGCISLFVFDISERGVQLRNPFYSIWTTPLGAKVAMSFILLAGVSAAVYFLFLCYMISKVFKNIGDKRTSLPSMSQARRLHYEGLIYRFKFLMLATLLCAALTVTGFIMGQMAEGQWKWNDDVEIQLTSAFLTGVYGMWNIYIFALLILYAPSHKQWPTMHHSD------ETTQSNENIVASAASEEI 535          
BLAST of Evi/Wls vs. UniProt/SwissProt
Match: sp|Q5ZLR1|WLS_CHICK (Protein wntless homolog OS=Gallus gallus OX=9031 GN=WLS PE=2 SV=1)

HSP 1 Score: 429.483 bits (1103), Expect = 1.042e-141
Identity = 222/548 (40.51%), Postives = 330/548 (60.22%), Query Frame = 3
Query:  132 MPGVVLETLSWKKLGIFIGIIFTCQFICFLIGGFIAPHPNGHTDVLTEKCIDRNPLSNPNKWFYNRLDGDEVTCKEKLPDEIQDDFINPFNLSAIQIVFAAQFPLPRNGVSLNMSRWFQQLIGILNLDIKYRKDIKMVNEFMLTLDVRLGRRNKGDKEWTEIARSMEHRPLRCVLDEQATIKLNKGEIIDGYYYDCELLPLFSMGSCFYDEYLVNIRIPYDRKHKINTELGKLQDLWVTEIHQNGGFTMVWFALKTTMFPLTLTALVFFWYRISLLDRNPNLLEQTIISLGVMMSILNFPIEWLSLRYNLSFWLVLSDIRQGGFYAMLLCFWVIFTGEHIIEDNVASQKSAKERLYYYWPQLIPVGAASCFLFIFELAERGVQLNNPFYSVWSNKTTAYIAIAFVAISVTCAPLYFIFLFYKIVRAIKQMLSKRSILSSLPEVRRKFYSGVIFRFTLFIIYTLLCATLTVIFFIVSQIDESQWKWGQKKLEYTSAFITGVYGMWNFYVISILCLYAPSHKYRNRNIISDTDDLLSNTKEASESVVVQY 1775
            M G ++E +S +KL I  GI+   Q I FL+GG IAP P      ++ KCID     +  KW    +      C EKL D   D+ ++   + A  IVFA   PLP    S  MS WFQ ++ I+ LDI ++ D  +     +TLDV L  R+    +W EIA ++E R L+C      T++       +G +YDC+ LP   +GS  +  YL+NIR+P + +  IN  +G+++D+ +  IHQNGGFT VWFA+KT + P  L  +V++W RI+L+ R P LLE+ I +LG+ M+ +N P+EW S+ ++ ++ L+  DIRQG FYAMLL FW+IF GEH+++ N       + RL  YW Q+ P+   S  LFIF++ ERGVQL NPFYS+W+ +    +A+AF+ ++  C  LYF+FL + + +  + +  K+S L ++ + RR  Y G+IFRF   ++ TL CA +TVIFFIVSQ+ E  WKWG   ++  SAF TG+YGMWN YV +++ LYAPSHK    +  S+ D  +S+ +E   +  + +
Sbjct:    1 MAGAIIENMSTRKLCIVGGILLVFQVIAFLVGGLIAPSPTTAVPYMSVKCIDVRKNHHKTKWL---MPWGPNHC-EKLKD--FDEAVSR-QIEANDIVFAVHIPLP----SKEMSPWFQFMLFIMQLDIAFKMDNDLKENAEITLDVSLAYRDDMFNDWEEIAHAIEIRKLKCTFGSPKTLES------EGRHYDCDFLPFMEIGSVAHKYYLINIRLPVNERKGINVGIGEVKDIRLVGIHQNGGFTKVWFAMKTFLTPSILIIMVWYWRRITLMTRAPVLLEKVIFALGISMTFINIPVEWFSIGFDWTWMLLFGDIRQGIFYAMLLSFWIIFCGEHMMDQN------ERNRLSGYWKQVGPIAVGSFCLFIFDMCERGVQLKNPFYSIWTTEVGTELAMAFIIVAGICLCLYFLFLCFMVFQVFRNISGKQSSLPAMSKARRLHYEGLIFRFKFLMLITLACAAMTVIFFIVSQVTEGHWKWGDITIQVNSAFFTGIYGMWNLYVFALMFLYAPSHKNYGED-QSNGDLGVSSGEELQLTTTITH 524          
BLAST of Evi/Wls vs. UniProt/SwissProt
Match: sp|B4QPR1|WLS_DROSI (Protein wntless OS=Drosophila simulans OX=7240 GN=wls PE=3 SV=2)

HSP 1 Score: 427.557 bits (1098), Expect = 1.088e-140
Identity = 223/560 (39.82%), Postives = 327/560 (58.39%), Query Frame = 3
Query:  132 MPGVVLETLSWKKLGIFIGIIFTCQFICFLIGGFIAPHPNGHTDVLTEKCIDRNPLSNPNKWF-YNRLDGDEVTCKEKLPDEIQDDFINPFNLSAIQIVFAAQFPLPRNGVSLNMSRWFQQLIGILNLDIKYRKDIKM---VNEFMLTLDVRLGRRNKGDKE--WTEIARSMEHRPLRCVLDEQATIKLNKGEIIDGYYYDCELLPLFSMGSCFYDEYLVNIRIPYDRKHKINTELGKLQDLWVTEIHQNGGFTMVWFALKTTMFPLTLTALVFFWYRISLLDRNPNLLEQTIISLGVMMSILNFPIEWLSLRYNLSFWLVLSDIRQGGFYAMLLCFWVIFTGEHIIEDNVASQKSAKERLYYYWPQLIPVGAASCFLFIFELAERGVQLNNPFYSVWSNKTTAYIAIAFVAISVTCAPLYFIFLFYKIVRAIKQMLSKRSILSSLPEVRRKFYSGVIFRFTLFIIYTLLCATLTVIFFIVSQIDESQWKWGQK-KLEYTSAFITGVYGMWNFYVISILCLYAPSHKYRNRNIISDTDDLLSNTKEASESVVVQYYANDI 1790
            M G +LE LS +KL I +  +  CQ +CFL+GG  AP P GH  VL   C + +   N   +  Y+R  G    C     +E++ D     N    ++V   Q PLPR+   L+ SRW Q LIG+L ++  Y    ++     E  LT+D+RL  RNKGD +  W   A  +EHR L CV     T  +   E +    Y C+++PLF +G+  +  YL+N+R P D   ++N + G + DL +T IHQNGGFT +W  LKT +FP  +  +++FW R+ LL R+P LLE  +I LG  ++ LN P+E+LSL Y + + L+LSDIRQG FYAMLL FW++F GEH++  +  ++ + + R   YW  L  V      LF+F++ ERGVQL NPFYS+W+    A +A+ F+ ++   A +YF+FL Y I +  + +  KR+ L S+ + RR  Y G+I+RF   ++ TL+CA LTV  FI+ Q+ E QW W     ++ TSAF+TGVYGMWN Y+ ++L LYAPSHK       SD       T +++E++V    + +I
Sbjct:    1 MSGTILENLSGRKLSILVATLLLCQVLCFLLGGLYAPLPAGHVTVLGSLCREDHARQNDTSFLLYSRGAG---ACIPVTREEVEQDSTKMAN----ELVHVFQMPLPRDLRDLDYSRWQQNLIGVLQVEFGYDSSSELREPPRELQLTIDMRLAYRNKGDPDNGWKLYAHGVEHRYLDCV-----TSHVGPTETL----YSCDMIPLFELGALHHSFYLLNLRFPLDTPSQMNLQFGHMHDLTLTAIHQNGGFTQIWLLLKTMLFPFVVGIMIWFWRRVHLLQRSPALLEYMLIYLGAALTFLNLPLEYLSLVYEMPYMLLLSDIRQGIFYAMLLTFWLVFAGEHMLIQDAPNKSTIRSR---YWKHLSAVVVGCISLFVFDICERGVQLRNPFYSIWTTPLGAKVAMTFIVLAGVSAAIYFLFLCYMIWKVFRNIGDKRTSLPSMSQARRLHYEGLIYRFKFLMLATLVCAALTVAGFIMGQMAEGQWDWNDNVAIQPTSAFLTGVYGMWNIYIFALLILYAPSHKQWPTMHHSD------ETTQSNENIVASAASEEI 535          
BLAST of Evi/Wls vs. UniProt/SwissProt
Match: sp|B4HEB1|WLS_DROSE (Protein wntless OS=Drosophila sechellia OX=7238 GN=wls PE=3 SV=2)

HSP 1 Score: 427.172 bits (1097), Expect = 1.656e-140
Identity = 223/560 (39.82%), Postives = 327/560 (58.39%), Query Frame = 3
Query:  132 MPGVVLETLSWKKLGIFIGIIFTCQFICFLIGGFIAPHPNGHTDVLTEKCIDRNPLSNPNKWF-YNRLDGDEVTCKEKLPDEIQDDFINPFNLSAIQIVFAAQFPLPRNGVSLNMSRWFQQLIGILNLDIKYRKDIKM---VNEFMLTLDVRLGRRNKGDKE--WTEIARSMEHRPLRCVLDEQATIKLNKGEIIDGYYYDCELLPLFSMGSCFYDEYLVNIRIPYDRKHKINTELGKLQDLWVTEIHQNGGFTMVWFALKTTMFPLTLTALVFFWYRISLLDRNPNLLEQTIISLGVMMSILNFPIEWLSLRYNLSFWLVLSDIRQGGFYAMLLCFWVIFTGEHIIEDNVASQKSAKERLYYYWPQLIPVGAASCFLFIFELAERGVQLNNPFYSVWSNKTTAYIAIAFVAISVTCAPLYFIFLFYKIVRAIKQMLSKRSILSSLPEVRRKFYSGVIFRFTLFIIYTLLCATLTVIFFIVSQIDESQWKWGQK-KLEYTSAFITGVYGMWNFYVISILCLYAPSHKYRNRNIISDTDDLLSNTKEASESVVVQYYANDI 1790
            M G +LE LS +KL I +  +  CQ +CFL+GG  AP P GH  VL   C + +   N   +  Y+R  G    C     +E++ D     N    ++V   Q PLPR+   L+ SRW Q LIG+L ++  Y    ++     E  LT+D+RL  RNKGD +  W   A  +EHR L CV     T  +   E +    Y C+++PLF +G+  +  YL+N+R P D   ++N + G + DL +T IHQNGGFT +W  LKT +FP  +  +++FW R+ LL R+P LLE  +I LG  ++ LN P+E+LSL Y + + L+LSDIRQG FYAMLL FW++F GEH++  +  ++ + + R   YW  L  V      LF+F++ ERGVQL NPFYS+W+    A +A+ F+ ++   A +YF+FL Y I +  + +  KR+ L S+ + RR  Y G+I+RF   ++ TL+CA LTV  FI+ Q+ E QW W     ++ TSAF+TGVYGMWN Y+ ++L LYAPSHK       SD       T +++E++V    + +I
Sbjct:    1 MSGTILENLSGRKLSILVATLLLCQVLCFLLGGLYAPLPAGHVTVLGSLCREDHARQNDTGFLLYSRGAG---ACIPVTREEVEQDSTKMAN----ELVHVFQMPLPRDLRDLDYSRWQQNLIGVLQVEFGYDSSSELREPPRELQLTIDMRLAYRNKGDPDNGWKLYAHGVEHRYLDCV-----TSHVGPTETL----YSCDMIPLFELGALHHSFYLLNLRFPLDTPSQMNLQFGHMHDLTLTAIHQNGGFTQIWLLLKTMLFPFVVGIMIWFWRRVHLLQRSPALLEYMLIYLGAALTFLNLPLEYLSLVYEMPYMLLLSDIRQGIFYAMLLTFWLVFAGEHMLIQDAPNKSTIRSR---YWKHLSAVVVGCISLFVFDICERGVQLRNPFYSIWTTPLGAKVAMTFIVLAGVSAAIYFLFLCYMIWKVFRNIGDKRTSLPSMSQARRLHYEGLIYRFKFLMLATLVCAALTVAGFIMGQMAEGQWDWNDNVAIQPTSAFLTGVYGMWNIYIFALLILYAPSHKQWPAMHHSD------ETTQSNENIVASAASEEI 535          
BLAST of Evi/Wls vs. TrEMBL
Match: C3U5A9 (Evi/Wls OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1123.61 bits (2905), Expect = 0.000e+0
Identity = 551/566 (97.35%), Postives = 553/566 (97.70%), Query Frame = 3
Query:  132 MPGVVLETLSWKKLGIFIGIIFTCQFICFLIGGFIAPHPNGHTDVLTEKCIDRNPLSNPNKWFYNRLDGDEVTCKEKLPDEIQDDFINPFNLSAIQIVFAAQFPLPRNGVSLNMSRWFQQLIGILNLDIKYRKDIKMVNEFMLTLDVRLGRRNKGDKEWTEIARSMEHRPLRCVLDEQATIKLNKGEIIDGYYYDCELLPLFSMGSCFYDEYLVNIRIPYDRKHKINTELGKLQDLWVTEIHQNGGFTMV-WFALKTTMFPLTLTALVFFWYRISLLDRNPNLLEQTIISLGVMMSILNFPIEWLSL----RYNLSFWLVLSDIRQGGFYAMLLCFWVIFTGEHIIEDNVASQKSAKERLYYYWPQLIPVGAASCFLFIFELAERGVQLNNPFYSVWSNKTTAYIAIAFVAISVTCAPLYFIFLFYKIVRAIKQMLSKRSILSSLPEVRRKFYSGVIFRFTLFIIYTLLCATLTVIFFIVSQIDESQWKWGQKKLEYTSAFITGVYGMWNFYVISILCLYAPSHKYRNRNIISDTDDLLSNTKEASESVVVQYYANDISNDGIIEG 1814
            MPGVVLETLSWKKLGIFIGIIFTCQFICFLIGGFIAPHPNGHTDVLTEKCIDRNPLSNPNKWFYNRLDGDEVTCKEKLPDEIQDDFINPFNLSAIQIVFAAQFPLPRNGVSLNMSRWFQQLIGILNLDIKY        EFMLTLDVRLGRRNKGDKEWTEIARSMEHRPLRCVLDEQATIKLNKGEIIDGYYYDCELLPLFS+GSCFYDEYLVNIRIPYDRKHKINTELGKLQDLWVTEIHQNGGFTMV WFALKTTMFPLTLTALVFFWYRISLLDRNPNLLEQTIISLGVMMSILNFPIEWLSL    RYNLSFWLVLSDIRQGGFYAMLLCFWVIFTGEHIIEDNVASQKSAKERLY+YWPQLIPVGAASCFLFIFELAERGVQLNNPFYSVWSNKTTAYIAIAFVAISVTCAPLYFIFLFYKIVRAIKQMLSKRSILSSLPEVRRKFYSGVIFRFTLFIIYTLLCATLTVIFFIVSQIDESQWKWGQKKLEYTSAFITGVYGMWNFYVISILCLYAPSHKYRNRNIISDTDDLLSNTKEASESVVVQYYANDISNDGIIEG
Sbjct:    1 MPGVVLETLSWKKLGIFIGIIFTCQFICFLIGGFIAPHPNGHTDVLTEKCIDRNPLSNPNKWFYNRLDGDEVTCKEKLPDEIQDDFINPFNLSAIQIVFAAQFPLPRNGVSLNMSRWFQQLIGILNLDIKY--------EFMLTLDVRLGRRNKGDKEWTEIARSMEHRPLRCVLDEQATIKLNKGEIIDGYYYDCELLPLFSLGSCFYDEYLVNIRIPYDRKHKINTELGKLQDLWVTEIHQNGGFTMVVWFALKTTMFPLTLTALVFFWYRISLLDRNPNLLEQTIISLGVMMSILNFPIEWLSLYVLFRYNLSFWLVLSDIRQGGFYAMLLCFWVIFTGEHIIEDNVASQKSAKERLYFYWPQLIPVGAASCFLFIFELAERGVQLNNPFYSVWSNKTTAYIAIAFVAISVTCAPLYFIFLFYKIVRAIKQMLSKRSILSSLPEVRRKFYSGVIFRFTLFIIYTLLCATLTVIFFIVSQIDESQWKWGQKKLEYTSAFITGVYGMWNFYVISILCLYAPSHKYRNRNIISDTDDLLSNTKEASESVVVQYYANDISNDGIIEG 558          
BLAST of Evi/Wls vs. TrEMBL
Match: T1D151 (Evi/Wls OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 847.425 bits (2188), Expect = 0.000e+0
Identity = 411/611 (67.27%), Postives = 494/611 (80.85%), Query Frame = 3
Query:  132 MPGVVLETLSWKKLGIFIGIIFTCQFICFLIGGFIAPHPNGHTDVLTEKCIDRNPLSNPNKWFYNRLDGDEVTCKEKLPDEIQDDFINPF---NLSAIQIVFAAQFPLPRNGVSLNMSRWFQQLIGILNLDIKYRKDIKMVNEFMLTLDVRLGRRNKGDKEWTEIARSMEHRPLRCVLDEQATIKLNKGEIIDGYYYDCELLPLFSMGSCFYDEYLVNIRIPYDRKHKINTELGKLQDLWVTEIHQNGGFTMVWFALKTTMFPLTLTALVFFWYRISLLDRNPNLLEQTIISLGVMMSILNFPIEWLSLRYNLSFWLVLSDIRQGGFYAMLLCFWVIFTGEHIIED----NVASQKSAKERLYYYWPQLIPVGAASCFLFIFELAERGVQLNNPFYSVWSNKTTAYIAIAFVAISVTCAPLYFIFLFYKIVRAIKQMLSKRSILSSLPEVRRKFYSGVIFRFTLFIIYTLLCATLTVIFFIVSQIDESQWKWGQKKLEYTSAFITGVYGMWNFYVISILCLYAPSHKYRNRNIISDTDDLLSNTKEASESVVVQYYANDIS-NDGIIEGXXXXXXXXXXXXXXXXXXXQKLNTISEQSQSISNPLETMVFL 1940
            M GVVLE LSW+KLG+ +  +F  Q ICFL+GG IAP PNGHTDVLTEKC+D +P +N  KWFY R  G   TCK  + D   +DF  P    N+SA QIVF AQFPLPR+G +LNMSRWFQQLI +LN+DIKY ++I+M  E +LTLDVRLG RNK D EWTE+ARS E RP++CVLD+    K  K E +DGYYYDC++LPLFS+GSC Y+EY+VNIR+P D K K+NT LGKLQDLWV EIHQNGGFTMVWF +KT MFPLTL+AL+FFW RI+LL R PNLLEQTIISLG+ MSILNFP+EWLSLR+NLSFWL+LSDIRQG FYAMLLCFWVIFTGEH++++    ++AS K+AKE+LY YWPQLIPVGAASCFLFIFELAERGVQL+NPFYSVWS+  TA+IAIAFV ++  C PLYF FL YK+++ I+QMLSKRS+L SLPEVR++FY+GVI+RFT+FIIYTLLCATLT+IFFIVSQ+DES WKWG+KKLEYTSAFITGVYGMWNFYVISILCLYAPSHKYRN+   +DTDDLLS     SE   V+YY ++   +DG+++        K T      ++ Q++ TIS++++S  NPLET+VFL
Sbjct:    1 MSGVVLEILSWRKLGVLVVSLFLAQVICFLLGGLIAPSPNGHTDVLTEKCLDPDPRNNYEKWFYTRKIGKGETCKHIISD---NDFGKPNYGNNMSASQIVFTAQFPLPRDGFNLNMSRWFQQLIAVLNVDIKYMEEIRMEEETLLTLDVRLGYRNKEDVEWTEMARSREVRPMKCVLDDNLKEKYKKRESLDGYYYDCDILPLFSLGSCHYEEYIVNIRLPVDEKKKLNTGLGKLQDLWVIEIHQNGGFTMVWFVMKTVMFPLTLSALIFFWRRINLLPRKPNLLEQTIISLGIAMSILNFPVEWLSLRFNLSFWLILSDIRQGAFYAMLLCFWVIFTGEHMLDNSESHSIASYKNAKEQLYNYWPQLIPVGAASCFLFIFELAERGVQLSNPFYSVWSHSATAHIAIAFVVMAGICGPLYFAFLLYKVIKVIRQMLSKRSVLPSLPEVRKRFYTGVIYRFTIFIIYTLLCATLTIIFFIVSQVDESNWKWGEKKLEYTSAFITGVYGMWNFYVISILCLYAPSHKYRNQQATTDTDDLLS----GSEVTAVRYYVSESRPDDGLVQ------TVKCTKKSVKNETSQQVTTISQRNESGVNPLETLVFL 598          
BLAST of Evi/Wls vs. TrEMBL
Match: A0A0X3NS12 (Protein wntless homolog OS=Schistocephalus solidus OX=70667 GN=WLS PE=4 SV=1)

HSP 1 Score: 588.186 bits (1515), Expect = 0.000e+0
Identity = 298/571 (52.19%), Postives = 388/571 (67.95%), Query Frame = 3
Query:  132 MPGVVLETLSWKKLGIF-IGIIFTCQFICFLIGGFIAPHPNGHTDVLTEKCIDRNPLS-NPNKWFYNRLDGDEVTCKEKLPDEIQDDFINPFNLSAIQIVFAAQFPLPRNGVSLNMSRWFQQLIGILNLDIKYRKDIKMVNEFMLTLDVRLGRRNKGDK--EWTEIARSMEHRPLRCVLDEQATIKLNKGEIID-GYYYDCELLPLFSMGSCFYDEYLVNIRIPYDRKHKINTELGKLQDLWVTEIHQNGGFTMVWFALKTTMFPLTLTALVFFWYRISLLDRNPNLLEQTIISLGVMMSILNFPIEWLSLRYNLSFWLVLSDIRQGGFYAMLLCFWVIFTGEHIIED--NVASQKSAKERLY---YYWPQLIPVGAASCFLFIFELAERGVQLNNPFYSVWSNKTTAYIAIAFVAISVTCAPLYFIFLFYKIVRAIKQMLSKRSILSSLPEVRRKFYSGVIFRFTLFIIYTLLCATLTVIFFIVSQIDESQWKWGQKKLEYTSAFITGVYGMWNFYVISILCLYAPSHKYRNRNIISDTDDLL-SNTKEASESVVVQYYANDISNDGIIE 1811
            M GVVLETL+ KKL  F IG++   Q   FLIGG IAP P     +L  KC+DR   + N   W Y R   +  +CKE LPD    D + P +++A +IVF AQFP  R+G  L M+RWFQQL+ +L LDIKY    ++ ++ +LT D+RLG RN+GD   +W EIA S E RPL C LD  AT + ++   ID GYYYDCE+LPLFS+GSC +D YLVN+RIP D K+ INT +G LQD+W+ EIHQNGGFT VWFALKT +FP T+ ALVFFW R+  L R P+L+E+TI +LG+++S+ N PIEWLSLRYN+SFWL+LSD+RQG FYA L CFW++FTGEH+++    V+++  A   L    YYWP+L+ VG     L IFELAERGVQL+NPFYS+WS+   A +  A V I   CA  YF++L   + R + Q+ +K  +L+ L   +R +YS +I+RF   ++YT+ CA LTVIFFI SQ +E QWKWG   LEYTSAFITGVYGMWN YVISILCLYAPSHK+R+       + L+ S+  +A  +    +  +  S D I +
Sbjct:    1 MAGVVLETLNSKKLIAFGIGLLL-AQAAFFLIGGLIAPAPTTTEQILMSKCVDRETTTGNKANWLYLR-PAENASCKEFLPDSYLSDKM-PSDVTADRIVFVAQFPHQRDGYDLKMTRWFQQLLAVLMLDIKYHHMSQVKSDALLTFDIRLGYRNRGDASDDWKEIAHSRETRPLSCSLDAVATKQASESNSIDDGYYYDCEVLPLFSLGSCHHDYYLVNVRIPVDLKNNINTGIGMLQDVWMVEIHQNGGFTKVWFALKTFLFPPTMAALVFFWRRVIELQRPPSLMERTIFALGIVLSLFNLPIEWLSLRYNVSFWLILSDVRQGAFYATLACFWLVFTGEHLMDSPHGVSTRSPAGAYLAISRYYWPKLLLVGGTCTALSIFELAERGVQLHNPFYSMWSHPAVARLGYASVVIGGLCAAAYFLYLSVLVFRGLWQIFTKHRLLAGLTSEQRAYYSSLIYRFAALLVYTVFCAALTVIFFIFSQANEDQWKWGSHSLEYTSAFITGVYGMWNAYVISILCLYAPSHKFRSAEGQQMLEHLIVSDASQAGLAAEEPFSVDSTSADPITQ 568          
BLAST of Evi/Wls vs. TrEMBL
Match: A0A4Z2CZT9 (Protein wntless OS=Schistosoma japonicum OX=6182 GN=EWB00_006122 PE=4 SV=1)

HSP 1 Score: 582.408 bits (1500), Expect = 0.000e+0
Identity = 285/563 (50.62%), Postives = 392/563 (69.63%), Query Frame = 3
Query:  132 MPGVVLETLSWKKLGIFIGIIFTCQFICFLIGGFIAPHPNGHTDVLTEKCIDRNPLSNPNKWFYNRLDGDEVTCKEKLPDEIQDDFINPFNLSAIQIVFAAQFPLPRNGVSLNMSRWFQQLIGILNLDIKYRKDIKMVNEFMLTLDVRLGRRNKGDKE--WTEIARSMEHRPLRCVLDEQATIKLNKGEIID-GYYYDCELLPLFSMGSCFYDEYLVNIRIPYDRKHKINTELGKLQDLWVTEIHQNGGFTMVWFALKTTMFPLTLTALVFFWYRISLLDRNPNLLEQTIISLGVMMSILNFPIEWLSLRYNLSFWLVLSDIRQGGFYAMLLCFWVIFTGEHIIEDNVASQKSAKERLYY-----YWPQLIPVGAASCFLFIFELAERGVQLNNPFYSVWSNKTTAYIAIAFVAISVTCAPLYFIFLFYKIVRAIKQMLSKRSILSSLPEVRRKFYSGVIFRFTLFIIYTLLCATLTVIFFIVSQIDESQWKWGQKKLEYTSAFITGVYGMWNFYVISILCLYAPSHKYR--------NRNIISDTDDLLSNTKEASESVVVQ 1772
            M GVVLETL+  KL  F  ++   Q   FLIGG IAP PN    +L  KCIDR+   +  KW + R   +E +C+E LPD   ++F+ P ++ A  IVF AQFP PR+G+ L M+RWFQQ+IG+L LDIK +   ++ N   +T D+RLG RN+ D    W E+ARS+E RPL+C LD +A         +D G+YYDCE+LPLF++ SC ++EYL+N+RIP D K KIN  +G +QD+W+ EIHQNGGFT VWF+LKT  FP+ L AL+FF +R+  L+R PN+LE+TI  LG+ +SILN P+EWLSL+YN SFWL+LSD+RQG FYA L+CFW++FTGEH++ ++  +++S+K    +     YWP+++ V +    LFIFELAERGVQ+ NPFYS+WS+   A + +  + I   CA  Y I+L   IV+A  Q+L+KR +L++LP  +R++YSG+I+RF + + YT+LCA LTV FFI +Q+ E QWKWG+K +EYTSAFITGVYGMWN YV+++LCLY+PSHK+R        NR II + + + + T  A  S  VQ
Sbjct:    1 MAGVVLETLNIWKLVTFGCLMLAVQICFFLIGGLIAPAPNTTDQILMSKCIDRS--KDALKWHFARPISNE-SCQEILPDGDIEEFVPP-DVDASSIVFIAQFPHPRDGMDLRMTRWFQQVIGVLMLDIKQKYSKELENT-QITFDLRLGYRNRDDPRHVWHELARSVEVRPLKCSLDPEAKRHQEHSHALDEGFYYDCEVLPLFTLASCHHEEYLLNLRIPVDEKRKINVGIGSIQDVWMVEIHQNGGFTKVWFSLKTFSFPIVLLALIFFGHRVRELERPPNILEKTIFILGICLSILNCPVEWLSLKYNFSFWLILSDVRQGLFYATLVCFWLVFTGEHMMHESSENRRSSKPSNCFGLSGLYWPRILLVASCCAALFIFELAERGVQIRNPFYSIWSHPVAAKMGLTSIVIGALCAFAYMIYLTVLIVKAFLQVLAKRRLLNNLPTEQRRYYSGIIYRFMVLLTYTILCAGLTVAFFIFNQVTEDQWKWGEKSVEYTSAFITGVYGMWNVYVVAVLCLYSPSHKFRSVAGQQLYNRLIIKNPNAITTTTTVADASATVQ 558          
BLAST of Evi/Wls vs. TrEMBL
Match: A0A564YNL7 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS7899 PE=4 SV=1)

HSP 1 Score: 578.17 bits (1489), Expect = 0.000e+0
Identity = 284/547 (51.92%), Postives = 378/547 (69.10%), Query Frame = 3
Query:  132 MPGVVLETLSWKKLGIFIGIIFTCQFICFLIGGFIAPHPNGHTDVLTEKCIDR--NPLSNPNKWFYNRLDGDEVTCKEKLPDEIQDDFINPFNLSAIQIVFAAQFPLPRNGVSLNMSRWFQQLIGILNLDIKYRKDIKMVNEFMLTLDVRLGRRNKGDK--EWTEIARSMEHRPLRCVLDEQATIKLNKGEIIDGYYYDCELLPLFSMGSCFYDEYLVNIRIPYDRKHKINTELGKLQDLWVTEIHQNGGFTMVWFALKTTMFPLTLTALVFFWYRISLLDRNPNLLEQTIISLGVMMSILNFPIEWLSLRYNLSFWLVLSDIRQGGFYAMLLCFWVIFTGEHIIEDNVASQKSAKERL-YYYWPQLIPVGAASCFLFIFELAERGVQLNNPFYSVWSNKTTAYIAIAFVAISVTCAPLYFIFLFYKIVRAIKQMLSKRSILSSLPEVRRKFYSGVIFRFTLFIIYTLLCATLTVIFFIVSQIDESQWKWGQKKLEYTSAFITGVYGMWNFYVISILCLYAPSHKYRNRNIISDTDDLLSNTKEASE 1757
            M GVVLETL+ KKL  F   I   Q   FLIGG I+P PN H  +L  KC+DR   P +  +KWF+ R      TC+E L +E  ++     N++A  IVF AQFP PR+G  L M+RWFQQ++ +L LDIK + DI++  + +LT DVRLG RN GD   EW EIA S E RPL C LD Q   +   G + +  +YDCE+LPLF++GSC +  YLVNIRIP D  +K+N E+G LQD+W+ EIHQNGGFTMVWFALKT +FP+ L  ++FFW R+S L R P ++E+TI +LG+++ I N PIEWLSL++N SFWLVLSD+RQG FYA L CFW++FTGEH+++     +   +  +  YYWP+L+ VG     + IFELAERGVQL+NPFYS+WS+   A +  A V +   CA  YF++L   + RA+ Q+ +KR +L SL   +R +YSG+I+RFT  ++YT+LCA LTVIF+I SQ +E QWKWG  ++EYTSAFITGVYGMWN YV++ILCLYAPSHK+R+       ++LL +++   E
Sbjct:    1 MVGVVLETLNSKKLIAFGVFILLAQTSFFLIGGLISPAPNTHEQILLSKCVDRETTPENRNDKWFFLRPRSSNQTCREILENEPLEEIGPKMNITADNIVFVAQFPHPRSGFDLKMTRWFQQVMAVLILDIKQKYDIEVKKDALLTFDVRLGYRNDGDPPGEWKEIAHSTEVRPLSCALDRQDYSR--PGSVEEFKFYDCEVLPLFTLGSCHHQTYLVNIRIPMDIDNKVNHEIGLLQDVWMVEIHQNGGFTMVWFALKTFLFPIGLGTVIFFWGRVSELGRPPTIMERTIFALGLVLCIFNCPIEWLSLKFNASFWLVLSDLRQGAFYATLACFWLVFTGEHLMDSPHGDRNQTRFGVSVYYWPKLLLVGGCCSAMSIFELAERGVQLHNPFYSIWSHPLAAKLGYASVILGGLCAAAYFLYLAVMVGRALWQIFAKRRLLPSLQPDQRVYYSGLIYRFTALLLYTILCAALTVIFYIFSQANEEQWKWGAHRIEYTSAFITGVYGMWNAYVVTILCLYAPSHKFRSPRGNQMMENLLVSSETYGE 545          
BLAST of Evi/Wls vs. Ensembl Cavefish
Match: wls (Wnt ligand secretion mediator [Source:NCBI gene;Acc:103034086])

HSP 1 Score: 416.001 bits (1068), Expect = 1.944e-137
Identity = 213/541 (39.37%), Postives = 323/541 (59.70%), Query Frame = 3
Query:  132 MPGVVLETLSWKKLGIFIGIIFTCQFICFLIGGFIAPHPNGHTDVLTEKCIDR-NPLSNPNKWFYNRLDGDEVTCKEKLPDEIQD-DFINPFNLSAIQIVFAAQFPLPRNGVSLNMSRWFQQLIGILNLDIKYRKDIKMVNEFMLTLDVRLGRRNKGDKEWTEIARSMEHRPLRCVLDEQATIKLNKGEIIDGYYYDCELLPLFSMGSCFYDEYLVNIRIPYDRKHKINTELGKLQDLWVTEIHQNGGFTMVWFALKTTMFPLTLTALVFFWYRISLLDRNPNLLEQTIISLGVMMSILNFPIEWLSLRYNLSFWLVLSDIRQGGFYAMLLCFWVIFTGEHIIEDNVASQKSAKERLYYYWPQLIPVGAASCFLFIFELAERGVQLNNPFYSVWSNKTTAYIAIAFVAISVTCAPLYFIFLFYKIVRAIKQMLSKRSILSSLPEVRRKFYSGVIFRFTLFIIYTLLCATLTVIFFIVSQIDESQWKWGQKKLEYTSAFITGVYGMWNFYVISILCLYAPSHKYRNRNIISDTDDLLSNTKE 1748
            M G ++E +S KKL I   ++   Q   F++GG IAP P      +  KC+D         KWF        V    K  D+I+D +      + A  IVFA   P+P       MS WFQ ++ IL  DI ++   ++ +  M+T+DV L  R+    EWTE+A S+E R L C      TI+       +G +Y+C++LP   +GS F+  YL+NIR+P + + K+N  +G+++D+ +  IHQNGGFT VWFA+KT + P  L  ++++W RI+++ R P LLE+ I +LG+ M+ +N P+EW S+ +  ++ L+ SDIRQG FYAMLL FW+IF GEH+++      ++ + R   YW Q+ P+   S  LFIF++ ERGVQL NPF+S+W++     +A+AF+ ++  CA LYF+FL + + +  + +  KRS L ++ + RR  Y G+IFRF   ++ TL CA +TVIFFI+SQ++E  W WG   ++  SAF TG+YGMWN YV +++ LYAPSHK         + D + N+ E
Sbjct:    1 MAGAIIENMSTKKLVILGVLLLLFQAFSFMVGGLIAPSPTTAIHYMATKCVDNVKGHHQAKKWF--------VPWGPKKCDKIRDFEEAMAKRIEANNIVFAVHIPMPDK----EMSPWFQFMLVILQFDIAFKMHNQIEDGAMVTVDVGLAYRDSTVSEWTEMAHSVELRKLSCNFTTAKTIEN------EGRHYECDVLPFMEIGSVFHKYYLLNIRLPVNERKKVNVGIGEIKDIRLVGIHQNGGFTKVWFAMKTFLTPSILIIMIWYWRRITMMSRPPVLLEKVIFALGISMTFINIPVEWFSVGFEWTWMLLFSDIRQGIFYAMLLSFWIIFCGEHLMD------QTERNRFSMYWKQVGPIVFGSFCLFIFDMCERGVQLTNPFFSIWASDVGTELAMAFIIVAGICACLYFLFLCFMVYQVFRNISGKRSSLPAMTKARRLHYEGLIFRFKFLMLVTLACAAMTVIFFIISQVNEGHWHWGDYTVQVNSAFFTGIYGMWNLYVFALMFLYAPSHKRYGDE--QSSGDQVGNSGE 515          
BLAST of Evi/Wls vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001775.1 (pep scaffold:Pmarinus_7.0:GL486156:725:5327:-1 gene:ENSPMAG00000001604.1 transcript:ENSPMAT00000001775.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 169.859 bits (429), Expect = 1.315e-48
Identity = 101/250 (40.40%), Postives = 140/250 (56.00%), Query Frame = 3
Query:  237 APHPNGHTDVLTEKCIDRNPLSNPNKWFYNRLDGDEVTCKEKLPDEIQDDFINPFNLSAIQIVFAAQFPLPRNGVSLNMSRWFQQLIGILNLDIKYRKDIKMVNEFMLTLDVRLGRRNKGDKEWTEIARSMEHRPLRCVLDEQATIKLNKGEIIDGYYYDCELLPLFSMGSCFYDEYLVNIRIPYDRKHKINTELGKLQDLWVTEIHQNGGFTMVWFALKTTMFPLTLTALVFFWYRISLLDRNPNLLEQ 986
            AP+P      L  KC+ R   S PN W      G     K +  DE  +  I      A +IVF+   P P     L M+ WFQ L+ +L  DI+Y K   +V++  +TL+V++G ++     WTE+ARS+EHR L C      T   N+G +     Y+CE+LPL  +GS  +  YLVN+R+P   +  IN  +GK+ D+ +T IHQNGGFT VWFA+KT + PL L  LV+FW R+S L R P LLE+
Sbjct:    1 APNPTAAMRYLATKCV-RERDSGPNSWLEPW--GPAACVKLRDLDEATERRI-----EANRIVFSIHMPHP----GLEMNAWFQYLLVVLEFDIQYWKHNPIVDKAEVTLEVKMGYKDSHADNWTELARSVEHRRLNCQFSHTMTSD-NEGRL-----YECEMLPLLELGSIGHKYYLVNMRLPTSEQRNINMGIGKILDINLTGIHQNGGFTQVWFAMKTFLTPLVLVTLVWFWRRLSQLARPPVLLEK 232          
BLAST of Evi/Wls vs. Ensembl Nematostella
Match: NVWNTLESS (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S129])

HSP 1 Score: 364.385 bits (934), Expect = 2.668e-118
Identity = 203/523 (38.81%), Postives = 302/523 (57.74%), Query Frame = 3
Query:  138 GVVLETLSWKKL---GIFIGIIFTCQFICFLIGGFIAPHPNGHTDVLTEKCIDRNPLSNPNKWFYNRLDGDEVTCKEKLPDEIQDDFINPFNLSAIQIVFAAQFPLPRNGVSLNMSRWFQQLIGILNLDIKYRKDIKMVNEFMLTLDVRLGRRNKGDK--EWTEIARSMEHRPLRCVLDEQATIKLNKGEIIDGYYYDCELLPLFSMGSCFYDEYLVNIRIPYDRKHKINTELGKLQDLWVTEIHQNGGFTMVWFALKTTMFPLTLTALVFFWYRISLLDRNPNLLEQTIISLGVMMSILNFPIEWLSLRYNLSFWLVLSDIRQGGFYAMLLCFWVIFTGEHIIEDNVASQKSAKERLYYYWPQLIPVGAASCFLFIFELAERGVQLNNPFYSVWSNKTTAYIAIAFVAISVTCAPLYFIFLFYKIVRAIKQMLSKRSILSSLPEVRRKFYSGVIFRFTLFIIYTLLCATLTVIFFIVSQIDESQWKWGQKK--LEYTSAFITGVYGMWNFYVISILCLYAPS 1685
             V+LETLS +KL   G+ I ++ +  FI    GG IAP P      +   C    P      W  +RL   +            D    P N     IVFA QFP P     L MSRW Q ++  + L+I+Y +D K  +  + T + RL  ++K D   EW E+A S E R L C           + +   G  Y C  +P F +GS +++ YLVN+ +P  R    N  +GK+ ++   EIHQNGGFT VWFA+KT + P ++  L++F  ++  L R P LLE+T+  LGV+   LNFPIEW +L  ++ F L+ +DIRQG FYAML+CFW+IFTGEH+++      +S + +L  YW Q+  +G     L +F++ ERG QL+NPFYS+W+ +  + +A AF+  +  CA +YF+FL   +++    +  KR+  + +   RR  Y G+I+RF   ++ TLLCA LTVIFF++S ++E+QWK+G ++  +E +SA  TG+YGMWN YV++++ LYAPS
Sbjct:    2 AVILETLSVRKLVLLGLGIVVVLSAFFIA---GGKIAPSPTTAMVHIAHICRADKPSQPQEPWTCHRLPNMDAA--------KADPKATPQN-----IVFAIQFPHP----GLEMSRWHQFIVSSVRLEIEYDEDQKYDSYPVWTFEARLYYKDKNDTSTEWKEMATSTEERSLVC--------NFTRSKSAGGGIYQCADIPFFEIGSVYHEYYLVNLLLPAHRNK--NRFIGKVAEVNFVEIHQNGGFTRVWFAMKTIVTPFSIAMLLWFAKKVKGLSREPLLLEKTMFILGVVAVFLNFPIEWFTLWVDMPFMLLFTDIRQGLFYAMLMCFWIIFTGEHLLD------QSERNKLKVYWRQVGCIGFGCLCLLVFDMCERGYQLHNPFYSIWATELGSKLAYAFIICAGICACVYFLFLCVMVIKVFWNIRGKRATFAKMSRARRLHYEGLIYRFEFLMVITLLCAALTVIFFVISNVNEAQWKFGSEESTVEISSALFTGIYGMWNTYVLTLMYLYAPS 488          
BLAST of Evi/Wls vs. Ensembl Medaka
Match: wls (Wnt ligand secretion mediator [Source:NCBI gene;Acc:101161440])

HSP 1 Score: 409.453 bits (1051), Expect = 8.918e-135
Identity = 208/520 (40.00%), Postives = 310/520 (59.62%), Query Frame = 3
Query:  132 MPGVVLETLSWKKLGIFIGIIFTCQFICFLIGGFIAPHPNGHTDVLTEKCIDRNPLSNPNKWFYNRLDGDEVTCKEKLPDEIQDDFINPFNLSAIQIVFAAQFPLPRNGVSLNMSRWFQQLIGILNLDIKYRKDIKMVNEFMLTLDVRLGRRNKGDKEWTEIARSMEHRPLRCVLDEQATIKLNKGEIIDGYYYDCELLPLFSMGSCFYDEYLVNIRIPYDRKHKINTELGKLQDLWVTEIHQNGGFTMVWFALKTTMFPLTLTALVFFWYRISLLDRNPNLLEQTIISLGVMMSILNFPIEWLSLRYNLSFWLVLSDIRQGGFYAMLLCFWVIFTGEHIIEDNVASQKSAKERLYYYWPQLIPVGAASCFLFIFELAERGVQLNNPFYSVWSNKTTAYIAIAFVAISVTCAPLYFIFLFYKIVRAIKQMLSKRSILSSLPEVRRKFYSGVIFRFTLFIIYTLLCATLTVIFFIVSQIDESQWKWGQKKLEYTSAFITGVYGMWNFYVISILCLYAPSHK 1691
            M G ++E +S +KL I    +   Q + F++GG IAP P    + L  KC+D         WF   +      C EKL    +D       + A  IVFA   P P+      MS WFQ ++ IL  +I ++ + ++    +  ++V L  R+    +WTE+ARS E R L C      T++       +G +Y+C+LLP   +GS  +  YL+NIR+P + + KIN  LG+++D+    IHQNGGFT VWFA+KT +    L  ++++W RISLL R P LLE+ I +LG+ M+ +N P+EW S+ +N ++ L+  DIRQG FY+MLL FW+IF GEH+++      +  + R   YW Q+ P+   S  LFIF++ ERGVQL NPFYS+W++     +A+AF+ ++  CA LYF+FL + + +  + +  KR+ L ++ + RR  Y G+IFRF   ++ TL CA +TVIFFI+SQ++E  W WG   ++  SAF TG+YGMWN YV +I+ LYAPSHK
Sbjct:    1 MAGAIIENMSTRKLVIVGVTLLLFQALAFMVGGLIAPSPTTPLNYLATKCVDTGKNQQETTWF---MPWGPNQC-EKL-QSFEDAMAK--RIEANNIVFAVHIPPPKK----EMSPWFQFMLVILQFNIAFKMNNQIEEGAVANIEVGLAYRDDTVSKWTEMARSSEQRRLNCNFTTAKTVE------NEGRHYECDLLPFMELGSVAHKYYLLNIRLPVNERKKINVGLGEIKDIHFISIHQNGGFTKVWFAMKTFLTASILIIMIWYWRRISLLTRAPVLLEKVIFALGISMTFINIPVEWFSIGFNWTWMLLFGDIRQGIFYSMLLSFWIIFCGEHLMD------QMDRNRFSVYWKQVGPIVFGSFCLFIFDMCERGVQLTNPFYSIWASDVGTELAMAFIIVAGICACLYFLFLCFMVYQVFRNISGKRTSLPAMSKARRLHYEGLIFRFKFLMLVTLACAAMTVIFFIISQVNEGHWHWGDYTVQVNSAFFTGIYGMWNLYVFAIMFLYAPSHK 497          
BLAST of Evi/Wls vs. Ensembl Medaka
Match: wls (Wnt ligand secretion mediator [Source:NCBI gene;Acc:101161440])

HSP 1 Score: 408.683 bits (1049), Expect = 2.455e-134
Identity = 208/520 (40.00%), Postives = 310/520 (59.62%), Query Frame = 3
Query:  132 MPGVVLETLSWKKLGIFIGIIFTCQFICFLIGGFIAPHPNGHTDVLTEKCIDRNPLSNPNKWFYNRLDGDEVTCKEKLPDEIQDDFINPFNLSAIQIVFAAQFPLPRNGVSLNMSRWFQQLIGILNLDIKYRKDIKMVNEFMLTLDVRLGRRNKGDKEWTEIARSMEHRPLRCVLDEQATIKLNKGEIIDGYYYDCELLPLFSMGSCFYDEYLVNIRIPYDRKHKINTELGKLQDLWVTEIHQNGGFTMVWFALKTTMFPLTLTALVFFWYRISLLDRNPNLLEQTIISLGVMMSILNFPIEWLSLRYNLSFWLVLSDIRQGGFYAMLLCFWVIFTGEHIIEDNVASQKSAKERLYYYWPQLIPVGAASCFLFIFELAERGVQLNNPFYSVWSNKTTAYIAIAFVAISVTCAPLYFIFLFYKIVRAIKQMLSKRSILSSLPEVRRKFYSGVIFRFTLFIIYTLLCATLTVIFFIVSQIDESQWKWGQKKLEYTSAFITGVYGMWNFYVISILCLYAPSHK 1691
            M G ++E +S +KL I    +   Q + F++GG IAP P    + L  KC+D         WF   +      C EKL    +D       + A  IVFA   P P+      MS WFQ ++ IL  +I ++ + ++    +  ++V L  R+    +WTE+ARS E R L C      T++       +G +Y+C+LLP   +GS  +  YL+NIR+P + + KIN  LG+++D+    IHQNGGFT VWFA+KT +    L  ++++W RISLL R P LLE+ I +LG+ M+ +N P+EW S+ +N ++ L+  DIRQG FY+MLL FW+IF GEH+++      +  + R   YW Q+ P+   S  LFIF++ ERGVQL NPFYS+W++     +A+AF+ ++  CA LYF+FL + + +  + +  KR+ L ++ + RR  Y G+IFRF   ++ TL CA +TVIFFI+SQ++E  W WG   ++  SAF TG+YGMWN YV +I+ LYAPSHK
Sbjct:    1 MAGAIIENMSTRKLVIVGVTLLLFQALAFMVGGLIAPSPTTPLNYLATKCVDTGKNQQETTWF---MPWGPNQC-EKL-QSFEDAMAK--RIEANNIVFAVHIPPPKK----EMSPWFQFMLVILQFNIAFKMNNQIEEGAVANIEVGLAYRDDTVSKWTEMARSSEQRRLNCNFTTAKTVE------NEGRHYECDLLPFMELGSVAHKYYLLNIRLPVNERKKINVGLGEIKDIHFISIHQNGGFTKVWFAMKTFLTASILIIMIWYWRRISLLTRAPVLLEKVIFALGISMTFINIPVEWFSIGFNWTWMLLFGDIRQGIFYSMLLSFWIIFCGEHLMD------QMDRNRFSVYWKQVGPIVFGSFCLFIFDMCERGVQLTNPFYSIWASDVGTELAMAFIIVAGICACLYFLFLCFMVYQVFRNISGKRTSLPAMSKARRLHYEGLIFRFKFLMLVTLACAAMTVIFFIISQVNEGHWHWGDYTVQVNSAFFTGIYGMWNLYVFAIMFLYAPSHK 497          
BLAST of Evi/Wls vs. Ensembl Medaka
Match: wls (Wnt ligand secretion mediator [Source:NCBI gene;Acc:101161440])

HSP 1 Score: 358.607 bits (919), Expect = 2.380e-116
Identity = 171/395 (43.29%), Postives = 253/395 (64.05%), Query Frame = 3
Query:  564 LDVRLGRRNKGDKEWTEIARSMEHRPLRCVLDEQATIKLNKGEIIDGYYYDCELLPLFSMGSCFYDEYLVNIRIPYDRKHKINTELGKLQDLWVTEIHQNGGFTMVWFALKTTMFPLTLTALVFFWYRISLLDRNPNLLEQTIISLGVMMSILNFPIEWLSLRYNLSFWLVLSDIRQGGFYAMLLCFWVIFTGEHIIEDNVASQKSAKERLYYYWPQLIPVGAASCFLFIFELAERGVQLNNPFYSVWSNKTTAYIAIAFVAISVTCAPLYFIFLFYKIVRAIKQMLSKRSILSSLPEVRRKFYSGVIFRFTLFIIYTLLCATLTVIFFIVSQIDESQWKWGQKKLEYTSAFITGVYGMWNFYVISILCLYAPSHKYRNRNIISDTDDLLSNTKE 1748
            ++V L  R+    +WTE+ARS E R L C      T++       +G +Y+C+LLP   +GS  +  YL+NIR+P + + KIN  LG+++D+    IHQNGGFT VWFA+KT +    L  ++++W RISLL R P LLE+ I +LG+ M+ +N P+EW S+ +N ++ L+  DIRQG FY+MLL FW+IF GEH+++      +  + R   YW Q+ P+   S  LFIF++ ERGVQL NPFYS+W++     +A+AF+ ++  CA LYF+FL + + +  + +  KR+ L ++ + RR  Y G+IFRF   ++ TL CA +TVIFFI+SQ++E  W WG   ++  SAF TG+YGMWN YV +I+ LYAPSHK   R     + D  +N+ E
Sbjct:   43 IEVGLAYRDDTVSKWTEMARSSEQRRLNCNFTTAKTVE------NEGRHYECDLLPFMELGSVAHKYYLLNIRLPVNERKKINVGLGEIKDIHFISIHQNGGFTKVWFAMKTFLTASILIIMIWYWRRISLLTRAPVLLEKVIFALGISMTFINIPVEWFSIGFNWTWMLLFGDIRQGIFYSMLLSFWIIFCGEHLMD------QMDRNRFSVYWKQVGPIVFGSFCLFIFDMCERGVQLTNPFYSIWASDVGTELAMAFIIVAGICACLYFLFLCFMVYQVFRNISGKRTSLPAMSKARRLHYEGLIFRFKFLMLVTLACAAMTVIFFIISQVNEGHWHWGDYTVQVNSAFFTGIYGMWNLYVFAIMFLYAPSHK---RYGDEQSSDAGANSGE 422          
BLAST of Evi/Wls vs. Planmine SMEST
Match: SMESG000068488.1 (SMESG000068488.1)

HSP 1 Score: 1201.04 bits (3106), Expect = 0.000e+0
Identity = 601/603 (99.67%), Postives = 602/603 (99.83%), Query Frame = 3
Query:  132 MPGVVLETLSWKKLGIFIGIIFTCQFICFLIGGFIAPHPNGHTDVLTEKCIDRNPLSNPNKWFYNRLDGDEVTCKEKLPDEIQDDFINPFNLSAIQIVFAAQFPLPRNGVSLNMSRWFQQLIGILNLDIKYRKDIKMVNEFMLTLDVRLGRRNKGDKEWTEIARSMEHRPLRCVLDEQATIKLNKGEIIDGYYYDCELLPLFSMGSCFYDEYLVNIRIPYDRKHKINTELGKLQDLWVTEIHQNGGFTMVWFALKTTMFPLTLTALVFFWYRISLLDRNPNLLEQTIISLGVMMSILNFPIEWLSLRYNLSFWLVLSDIRQGGFYAMLLCFWVIFTGEHIIEDNVASQKSAKERLYYYWPQLIPVGAASCFLFIFELAERGVQLNNPFYSVWSNKTTAYIAIAFVAISVTCAPLYFIFLFYKIVRAIKQMLSKRSILSSLPEVRRKFYSGVIFRFTLFIIYTLLCATLTVIFFIVSQIDESQWKWGQKKLEYTSAFITGVYGMWNFYVISILCLYAPSHKYRNRNIISDTDDLLSNTKEASESVVVQYYANDISNDGIIEGXXXXXXXXXXXXXXXXXXXQKLNTISEQSQSISNPLETMVFL 1940
            MPGVVLETLSWKKLGIFIGIIFTCQFICFLIGGFIAPHPNGHTDVLTEKCIDRNPLSNPNKWFYNRLDGDEVTCKEKLPDEIQDDFINPFNLSAIQIVFAAQFPLPRNGVSLNMSRWFQQLIGILNLDIKYRKDIKMVNEFMLTLDVRLGRRNKGDKEWTEIARSMEHRPLRCVLDEQATIKLNKGEIIDGYYYDCELLPLFS+GSCFYDEYLVNIRIPYDRKHKINTELGKLQDLWVTEIHQNGGFTMVWFALKTTMFPLTLTALVFFWYRISLLDRNPNLLEQTIISLGVMMSILNFPIEWLSLRYNLSFWLVLSDIRQGGFYAMLLCFWVIFTGEHIIEDNVASQKSAKERLYYYWPQLIPVGAASCFLFIFELAERGVQLNNPFYSVWSNKTTAYIAIAFVAISVTCAPLYFIFLFYKIVRAIKQMLSKRSILSSLPEVRRKFYSGVIFRFTLFIIYTLLCATLTVIFFIVSQIDESQWKWGQKKLEYTSAFITGVYGMWNFYVISILCLYAPSHKYRNRNIISDTDDLLSNTKEASESVVVQYYANDISNDGIIEGVTFKNKSKKTTSVKSEQS QKLNTISEQSQSISNPLETMVFL
Sbjct:    1 MPGVVLETLSWKKLGIFIGIIFTCQFICFLIGGFIAPHPNGHTDVLTEKCIDRNPLSNPNKWFYNRLDGDEVTCKEKLPDEIQDDFINPFNLSAIQIVFAAQFPLPRNGVSLNMSRWFQQLIGILNLDIKYRKDIKMVNEFMLTLDVRLGRRNKGDKEWTEIARSMEHRPLRCVLDEQATIKLNKGEIIDGYYYDCELLPLFSLGSCFYDEYLVNIRIPYDRKHKINTELGKLQDLWVTEIHQNGGFTMVWFALKTTMFPLTLTALVFFWYRISLLDRNPNLLEQTIISLGVMMSILNFPIEWLSLRYNLSFWLVLSDIRQGGFYAMLLCFWVIFTGEHIIEDNVASQKSAKERLYYYWPQLIPVGAASCFLFIFELAERGVQLNNPFYSVWSNKTTAYIAIAFVAISVTCAPLYFIFLFYKIVRAIKQMLSKRSILSSLPEVRRKFYSGVIFRFTLFIIYTLLCATLTVIFFIVSQIDESQWKWGQKKLEYTSAFITGVYGMWNFYVISILCLYAPSHKYRNRNIISDTDDLLSNTKEASESVVVQYYANDISNDGIIEGVTFKNKSKKTTSVKSEQSTQKLNTISEQSQSISNPLETMVFL 603          
The following BLAST results are available for this feature:
BLAST of Evi/Wls vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WLS3.850e-14040.69Wnt ligand secretion mediator [Source:HGNC Symbol;... [more]
WLS1.442e-13640.08Wnt ligand secretion mediator [Source:HGNC Symbol;... [more]
WLS1.603e-11443.39Wnt ligand secretion mediator [Source:HGNC Symbol;... [more]
WLS3.038e-4135.42Wnt ligand secretion mediator [Source:HGNC Symbol;... [more]
WLS1.743e-3938.95Wnt ligand secretion mediator [Source:HGNC Symbol;... [more]
back to top
BLAST of Evi/Wls vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mig-148.723e-10739.34pep chromosome:WBcel235:II:13741742:13749983:1 gen... [more]
back to top
BLAST of Evi/Wls vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
wls1.086e-14139.82gene:FBgn0036141 transcript:FBtr0076219[more]
wls1.424e-13437.67gene:FBgn0036141 transcript:FBtr0076218[more]
back to top
BLAST of Evi/Wls vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
wls1.140e-14040.33Wnt ligand secretion mediator [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Evi/Wls vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
wls3.969e-13740.45wntless Wnt ligand secretion mediator [Source:NCBI... [more]
wls4.639e-13240.32wntless Wnt ligand secretion mediator [Source:NCBI... [more]
wls1.103e-13041.39wntless Wnt ligand secretion mediator [Source:NCBI... [more]
wls1.235e-11942.68wntless Wnt ligand secretion mediator [Source:NCBI... [more]
back to top
BLAST of Evi/Wls vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Wls1.245e-13940.27wntless WNT ligand secretion mediator [Source:MGI ... [more]
Wls1.245e-13940.27wntless WNT ligand secretion mediator [Source:MGI ... [more]
back to top
BLAST of Evi/Wls vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2LZ37|WLS_DROPS8.452e-14841.07Protein wntless OS=Drosophila pseudoobscura pseudo... [more]
sp|B4GZN1|WLS_DROPE1.836e-14741.07Protein wntless OS=Drosophila persimilis OX=7234 G... [more]
sp|Q5ZLR1|WLS_CHICK1.042e-14140.51Protein wntless homolog OS=Gallus gallus OX=9031 G... [more]
sp|B4QPR1|WLS_DROSI1.088e-14039.82Protein wntless OS=Drosophila simulans OX=7240 GN=... [more]
sp|B4HEB1|WLS_DROSE1.656e-14039.82Protein wntless OS=Drosophila sechellia OX=7238 GN... [more]
back to top
BLAST of Evi/Wls vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C3U5A90.000e+097.35Evi/Wls OS=Schmidtea mediterranea OX=79327 PE=2 SV... [more]
T1D1510.000e+067.27Evi/Wls OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
A0A0X3NS120.000e+052.19Protein wntless homolog OS=Schistocephalus solidus... [more]
A0A4Z2CZT90.000e+050.62Protein wntless OS=Schistosoma japonicum OX=6182 G... [more]
A0A564YNL70.000e+051.92Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
back to top
BLAST of Evi/Wls vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
wls1.944e-13739.37Wnt ligand secretion mediator [Source:NCBI gene;Ac... [more]
back to top
BLAST of Evi/Wls vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000001775.11.315e-4840.40pep scaffold:Pmarinus_7.0:GL486156:725:5327:-1 gen... [more]
back to top
BLAST of Evi/Wls vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Evi/Wls vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
NVWNTLESS2.668e-11838.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Evi/Wls vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
wls8.918e-13540.00Wnt ligand secretion mediator [Source:NCBI gene;Ac... [more]
wls2.455e-13440.00Wnt ligand secretion mediator [Source:NCBI gene;Ac... [more]
wls2.380e-11643.29Wnt ligand secretion mediator [Source:NCBI gene;Ac... [more]
back to top
BLAST of Evi/Wls vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000068488.10.000e+099.67SMESG000068488.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30011055
GenBankACJ64863.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011055 ID=SMED30011055|Name=Evi/Wls|organism=Schmidtea mediterranea sexual|type=transcript|length=2183bp
TTGAAATCGGCGAATTCAAACATCGGTTTCTCATAATTTTGAGAGGATTA
TATAAATCGAATTGAAGTGTCTTGTATAATTCGTTTCTCTTCAACTGTTG
TTATTTTTTTTCAATTGTCAATTTATAATCAATGCCGGGTGTTGTTTTGG
AAACTCTAAGTTGGAAAAAATTAGGAATTTTCATAGGTATCATATTTACT
TGTCAGTTTATTTGCTTCCTCATTGGCGGATTTATTGCTCCACATCCAAA
TGGGCATACGGATGTTCTTACAGAAAAATGTATCGACCGAAATCCATTGT
CGAATCCTAATAAATGGTTTTATAATCGATTGGATGGAGATGAGGTTACC
TGCAAAGAGAAATTGCCGGATGAAATACAAGATGATTTCATAAATCCCTT
CAATCTTTCAGCAATTCAAATCGTTTTTGCTGCTCAATTTCCGCTTCCAA
GAAATGGCGTTAGCTTAAATATGAGCCGATGGTTTCAGCAATTAATAGGA
ATTTTAAATTTGGATATAAAATATCGAAAAGATATAAAGATGGTAAATGA
ATTCATGTTGACCTTAGATGTGAGGCTAGGTCGAAGAAATAAAGGGGATA
AAGAATGGACCGAAATAGCAAGGTCCATGGAGCATCGACCTCTCAGATGT
GTTTTAGATGAACAAGCCACAATAAAATTGAATAAAGGAGAAATAATTGA
TGGCTACTATTATGATTGCGAACTTCTTCCGTTGTTTTCAATGGGTAGCT
GTTTTTATGACGAATATTTGGTGAATATTCGCATTCCATATGACAGAAAA
CATAAAATTAATACTGAATTGGGTAAGCTACAGGATCTATGGGTAACAGA
AATACATCAAAATGGCGGTTTCACAATGGTCTGGTTTGCTCTGAAAACTA
CGATGTTTCCTTTAACATTAACAGCTCTAGTATTTTTTTGGTACAGAATC
TCATTATTAGACAGAAACCCAAACTTGCTTGAACAAACAATAATTTCGTT
AGGAGTTATGATGTCTATTTTAAATTTCCCAATCGAATGGTTATCACTAA
GGTACAATTTATCGTTTTGGTTGGTTCTCAGTGATATTCGCCAGGGAGGC
TTTTATGCAATGCTTCTTTGTTTTTGGGTGATTTTTACTGGTGAACACAT
TATCGAAGATAATGTGGCATCACAAAAGAGTGCCAAGGAACGCCTTTATT
ATTATTGGCCTCAGCTGATTCCAGTTGGAGCTGCATCGTGTTTTTTATTT
ATTTTTGAATTAGCTGAACGAGGAGTACAACTGAACAATCCTTTTTACAG
TGTTTGGTCGAATAAAACTACTGCTTATATTGCCATTGCATTTGTGGCGA
TTTCAGTCACTTGTGCACCATTATATTTTATATTCCTTTTCTACAAAATC
GTGAGAGCCATTAAACAAATGCTAAGTAAACGAAGCATTCTGTCCAGCTT
GCCAGAAGTTCGAAGAAAATTTTATTCTGGTGTCATCTTTAGATTTACTC
TGTTTATCATCTACACCCTTTTGTGTGCAACCTTAACCGTTATATTTTTT
ATCGTCAGTCAGATTGATGAAAGTCAATGGAAATGGGGTCAGAAAAAACT
CGAATATACATCGGCATTTATAACGGGTGTTTATGGCATGTGGAATTTCT
ACGTCATATCAATCCTATGCTTGTATGCTCCTTCCCACAAATATCGGAAT
AGAAATATAATATCTGATACCGATGATTTATTATCAAACACTAAAGAAGC
CAGTGAATCTGTGGTGGTTCAATATTATGCCAACGATATCTCCAATGACG
GCATCATCGAAGGAGTTACTTTCAAAAACAAGTCAAAGAAAACCACATCT
GTAAAAAGTGAACAAAGTGTACAAAAATTGAACACAATTTCTGAGCAAAG
TCAGTCCATTTCCAATCCTCTGGAGACCATGGTTTTCCTAAGCAAACCAT
CTAAAGACTAATCCGATATCTCAGACAAAGAAACCTCAAATTAACGAAAA
TTAATGAAGCATTTTGCATGAGAAAATAGCATTTTGAAATTCATTTTCTT
TCTCTTTATTTTGCTATCATGCGCGATAGAAAAAAAAGAAACTTTTTTTA
TATTGAAAAGCATTTTAATATCTCATCTGGCGTCACTATAAATGTGTGTA
ATAAATATTTTTATTTTACATTTTATATCAGTA
back to top

protein sequence of SMED30011055-orf-1

>SMED30011055-orf-1 ID=SMED30011055-orf-1|Name=SMED30011055-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=610bp
MPGVVLETLSWKKLGIFIGIIFTCQFICFLIGGFIAPHPNGHTDVLTEKC
IDRNPLSNPNKWFYNRLDGDEVTCKEKLPDEIQDDFINPFNLSAIQIVFA
AQFPLPRNGVSLNMSRWFQQLIGILNLDIKYRKDIKMVNEFMLTLDVRLG
RRNKGDKEWTEIARSMEHRPLRCVLDEQATIKLNKGEIIDGYYYDCELLP
LFSMGSCFYDEYLVNIRIPYDRKHKINTELGKLQDLWVTEIHQNGGFTMV
WFALKTTMFPLTLTALVFFWYRISLLDRNPNLLEQTIISLGVMMSILNFP
IEWLSLRYNLSFWLVLSDIRQGGFYAMLLCFWVIFTGEHIIEDNVASQKS
AKERLYYYWPQLIPVGAASCFLFIFELAERGVQLNNPFYSVWSNKTTAYI
AIAFVAISVTCAPLYFIFLFYKIVRAIKQMLSKRSILSSLPEVRRKFYSG
VIFRFTLFIIYTLLCATLTVIFFIVSQIDESQWKWGQKKLEYTSAFITGV
YGMWNFYVISILCLYAPSHKYRNRNIISDTDDLLSNTKEASESVVVQYYA
NDISNDGIIEGVTFKNKSKKTTSVKSEQSVQKLNTISEQSQSISNPLETM
VFLSKPSKD*
back to top
Aliases
The feature 'Evi/Wls' has the following synonyms
Synonym
Evi
Wls
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000025nervous system
PLANA:0000044cephalic ganglia
PLANA:0000062esophagus
PLANA:0000072mouth
PLANA:0000097ventral nerve cord
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000421tail
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR009551Wntless
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0016055Wnt signaling pathway
Vocabulary: molecular function
TermDefinition
GO:0017147Wnt-protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePFAMPF06664MIG-14_Wnt-bdcoord: 195..519
e-value: 1.5E-76
score: 257.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 572..591
NoneNo IPR availableTMHMMTMhelixcoord: 453..475
NoneNo IPR availableTMHMMTMhelixcoord: 15..37
NoneNo IPR availableTMHMMTMhelixcoord: 313..335
NoneNo IPR availableTMHMMTMhelixcoord: 251..273
NoneNo IPR availableTMHMMTMhelixcoord: 398..420
NoneNo IPR availableTMHMMTMhelixcoord: 356..378
NoneNo IPR availableTMHMMTMhelixcoord: 495..517
IPR009551Protein wntlessPANTHERPTHR13449INTEGRAL MEMBRANE PROTEIN GPR177coord: 1..539