WD repeat-containing protein 6

Overview
NameWD repeat-containing protein 6
Smed IDSMED30011023
Length (bp)3528
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of WD repeat-containing protein 6 (SMED30011023) t-SNE clustered cells

Violin plots show distribution of expression levels for WD repeat-containing protein 6 (SMED30011023) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of WD repeat-containing protein 6 (SMED30011023) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for WD repeat-containing protein 6 (SMED30011023) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011023

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30011023SMESG000001845.1 SMESG000001835.1 SmedASXL_017194SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30011023SMESG000001845.1 SMESG000001835.1 SmedASXL_017194SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of WD repeat-containing protein 6 vs. Ensembl Human
Match: WDR6 (WD repeat domain 6 [Source:HGNC Symbol;Acc:HGNC:12758])

HSP 1 Score: 65.855 bits (159), Expect = 4.444e-10
Identity = 91/381 (23.88%), Postives = 159/381 (41.73%), Query Frame = 2
Query:   26 FLPVTCVKFMANSSQILSASGNEINL--LDYKH--KTVVDVQSIKNLKVIHGIELKDD---------IVIIYGGFVFCIFVLIDNKIRFTNIFQRHDDFILACMIYFYQEDKIKFSISLAHGSTHFYSFRTGVNQKLEELGEVGTADKSLLYCCHLFRNPVVDIVNNLFLAGGNVQNLITIWEIPTPFTTVKLPQASMLSRLAGHKGAIFGIHVNWIDGLLISMGDDRSVILWLAEGGLDLSANTLTDINWLRSTILIGHEARVWGGLSLPGDDTVMAWGEDCTLRFWSKDGTSRACIRPHTGRSIWTGDAIIKNGKYL-VVTGGNDGAVVVSEYARSPEKHQAVDSFRVDGDCKDFARRLIILEKG-LILVVTDFGIFYL 1123
             LPVT ++ + +  ++L+  G ++ +  LD+    + +  VQ++    +IHG  ++ +         +V ++G     +  +   +  F  ++ R   + ++  I+  +  +   +++L H S   Y    G       L EV   D+  L    L    + D    L +  G V N + +W   T     K P A    R++GH G IF +      GLL +  +DRSV +W   G L +    + +I         GH ARVW    L  ++ +++ GEDC    WS +G      R H GR I    AI  + +   V+TGG+D  + +        +   V +       +    + + L     +L VTD G  YL
Sbjct:   48 LLPVTGLECVGD--RLLAGEGPDVLVYSLDFGGHLRMIKRVQNLLGHYLIHGFRVRPEPNGDLDLEAMVAVFGSKGLRVVKISWGQGHFWELW-RSGLWNMSDWIWDARWLEGNIALALGHNSVVLYDPVVGCI-----LQEVPCTDRCTLSSACL----IGDAWKELTIVAGAVSNQLLVWYPATALADNK-PVAPD-RRISGHVGIIFSMSYLESKGLLATASEDRSVRIWKV-GDLRVPGGRVQNIGH-----CFGHSARVWQVKLL--ENYLISAGEDCVCLVWSHEGEILQAFRGHQGRGI---RAIAAHERQAWVITGGDDSGIRLWHLVGRGYRGLGVSALCFKSRSRPGTLKAVTLAGSWRLLAVTDTGALYL 403          
BLAST of WD repeat-containing protein 6 vs. Ensembl Human
Match: WDR6 (WD repeat domain 6 [Source:HGNC Symbol;Acc:HGNC:12758])

HSP 1 Score: 65.855 bits (159), Expect = 4.444e-10
Identity = 91/381 (23.88%), Postives = 159/381 (41.73%), Query Frame = 2
Query:   26 FLPVTCVKFMANSSQILSASGNEINL--LDYKH--KTVVDVQSIKNLKVIHGIELKDD---------IVIIYGGFVFCIFVLIDNKIRFTNIFQRHDDFILACMIYFYQEDKIKFSISLAHGSTHFYSFRTGVNQKLEELGEVGTADKSLLYCCHLFRNPVVDIVNNLFLAGGNVQNLITIWEIPTPFTTVKLPQASMLSRLAGHKGAIFGIHVNWIDGLLISMGDDRSVILWLAEGGLDLSANTLTDINWLRSTILIGHEARVWGGLSLPGDDTVMAWGEDCTLRFWSKDGTSRACIRPHTGRSIWTGDAIIKNGKYL-VVTGGNDGAVVVSEYARSPEKHQAVDSFRVDGDCKDFARRLIILEKG-LILVVTDFGIFYL 1123
             LPVT ++ + +  ++L+  G ++ +  LD+    + +  VQ++    +IHG  ++ +         +V ++G     +  +   +  F  ++ R   + ++  I+  +  +   +++L H S   Y    G       L EV   D+  L    L    + D    L +  G V N + +W   T     K P A    R++GH G IF +      GLL +  +DRSV +W   G L +    + +I         GH ARVW    L  ++ +++ GEDC    WS +G      R H GR I    AI  + +   V+TGG+D  + +        +   V +       +    + + L     +L VTD G  YL
Sbjct:   48 LLPVTGLECVGD--RLLAGEGPDVLVYSLDFGGHLRMIKRVQNLLGHYLIHGFRVRPEPNGDLDLEAMVAVFGSKGLRVVKISWGQGHFWELW-RSGLWNMSDWIWDARWLEGNIALALGHNSVVLYDPVVGCI-----LQEVPCTDRCTLSSACL----IGDAWKELTIVAGAVSNQLLVWYPATALADNK-PVAPD-RRISGHVGIIFSMSYLESKGLLATASEDRSVRIWKV-GDLRVPGGRVQNIGH-----CFGHSARVWQVKLL--ENYLISAGEDCVCLVWSHEGEILQAFRGHQGRGI---RAIAAHERQAWVITGGDDSGIRLWHLVGRGYRGLGVSALCFKSRSRPGTLKAVTLAGSWRLLAVTDTGALYL 403          
BLAST of WD repeat-containing protein 6 vs. Ensembl Human
Match: WDR6 (WD repeat domain 6 [Source:HGNC Symbol;Acc:HGNC:12758])

HSP 1 Score: 65.855 bits (159), Expect = 5.494e-10
Identity = 91/381 (23.88%), Postives = 159/381 (41.73%), Query Frame = 2
Query:   26 FLPVTCVKFMANSSQILSASGNEINL--LDYKH--KTVVDVQSIKNLKVIHGIELKDD---------IVIIYGGFVFCIFVLIDNKIRFTNIFQRHDDFILACMIYFYQEDKIKFSISLAHGSTHFYSFRTGVNQKLEELGEVGTADKSLLYCCHLFRNPVVDIVNNLFLAGGNVQNLITIWEIPTPFTTVKLPQASMLSRLAGHKGAIFGIHVNWIDGLLISMGDDRSVILWLAEGGLDLSANTLTDINWLRSTILIGHEARVWGGLSLPGDDTVMAWGEDCTLRFWSKDGTSRACIRPHTGRSIWTGDAIIKNGKYL-VVTGGNDGAVVVSEYARSPEKHQAVDSFRVDGDCKDFARRLIILEKG-LILVVTDFGIFYL 1123
             LPVT ++ + +  ++L+  G ++ +  LD+    + +  VQ++    +IHG  ++ +         +V ++G     +  +   +  F  ++ R   + ++  I+  +  +   +++L H S   Y    G       L EV   D+  L    L    + D    L +  G V N + +W   T     K P A    R++GH G IF +      GLL +  +DRSV +W   G L +    + +I         GH ARVW    L  ++ +++ GEDC    WS +G      R H GR I    AI  + +   V+TGG+D  + +        +   V +       +    + + L     +L VTD G  YL
Sbjct:   18 LLPVTGLECVGD--RLLAGEGPDVLVYSLDFGGHLRMIKRVQNLLGHYLIHGFRVRPEPNGDLDLEAMVAVFGSKGLRVVKISWGQGHFWELW-RSGLWNMSDWIWDARWLEGNIALALGHNSVVLYDPVVGCI-----LQEVPCTDRCTLSSACL----IGDAWKELTIVAGAVSNQLLVWYPATALADNK-PVAPD-RRISGHVGIIFSMSYLESKGLLATASEDRSVRIWKV-GDLRVPGGRVQNIGH-----CFGHSARVWQVKLL--ENYLISAGEDCVCLVWSHEGEILQAFRGHQGRGI---RAIAAHERQAWVITGGDDSGIRLWHLVGRGYRGLGVSALCFKSRSRPGTLKAVTLAGSWRLLAVTDTGALYL 373          
BLAST of WD repeat-containing protein 6 vs. Ensembl Human
Match: WDR6 (WD repeat domain 6 [Source:HGNC Symbol;Acc:HGNC:12758])

HSP 1 Score: 65.0846 bits (157), Expect = 9.003e-10
Identity = 71/268 (26.49%), Postives = 107/268 (39.93%), Query Frame = 2
Query:  326 KFSISLAHGSTHFYSFRTGVNQKLEELGEVGTADKSLLYCCHLFRNPVVDIVNNLFLAGGNVQNLITIWEIPTPFTTVKLPQASMLSRLAGHKGAIFGIHVNWIDGLLISMGDDRSVILWLAEGGLDLSANTLTDINWLRSTILIGHEARVWGGLSLPGDDTVMAWGEDCTLRFWSKDGTSRACIRPHTGRSIWTGDAIIKNGKYL-VVTGGNDGAVVVSEYARSPEKHQAVDSFRVDGDCKDFARRLIILEKG-LILVVTDFGIFYL 1123
              +++L H S   Y    G       L EV   D+  L    L    + D    L +  G V N + +W   T     K    +   R++GH G IF +      GLL +  +DRSV +W   G L +    + +I         GH ARVW    L  ++ +++ GEDC    WS +G      R H GR I    AI  + +   V+TGG+D  + +        +   V +       +    + + L     +L VTD G  YL
Sbjct:   77 NIALALGHNSVVLYDPVVGCI-----LQEVPCTDRCTLSSACL----IGDAWKELTIVAGAVSNQLLVWYPATALADNK--PVAPDRRISGHVGIIFSMSYLESKGLLATASEDRSVRIWKV-GDLRVPGGRVQNIGH-----CFGHSARVWQVKLL--ENYLISAGEDCVCLVWSHEGEILQAFRGHQGRGI---RAIAAHERQAWVITGGDDSGIRLWHLVGRGYRGLGVSALCFKSRSRPGTLKAVTLAGSWRLLAVTDTGALYL 322          
BLAST of WD repeat-containing protein 6 vs. Ensembl Fly
Match: CG33172 (gene:FBgn0053172 transcript:FBtr0308092)

HSP 1 Score: 65.0846 bits (157), Expect = 3.968e-10
Identity = 74/283 (26.15%), Postives = 111/283 (39.22%), Query Frame = 2
Query:  314 EDKIKFSISLAHGSTHFYSFRTGVNQKLEELGEVGTADKSLLYCCHLFRNPVVDIVNNLFLAGGNVQNLITIWEIPTPFTTVKLPQASM-----LSRLAGHKGAIFGIHVNWIDGLLISMGDDRSVILWLAEGGLDLSANTLTDINWLRSTILIGHEARVWGGLSLPGDDT--VMAWGEDCTLRFWSKDGTSRACIRPHTGRSIW----TGDAIIKNGKYLVVTGGNDGAVVVSEYARSPEKHQAVDSFRVDGDCKDFARRLIILEKGLILVVTDFGIFYLIR 1129
            ED+ +F +  +H +  +  +    N     L      D S+LY   L  +      N L +  GN    + +W+  T F T   P++ M     L R+  H G I  I  +    LL++  DDRSV  W  +   D    T  +I  + S    GH +RV   + L  DD   V + GED  +  WS  G      R   G  IW    + DA I    Y   + GN     + E    P+    + S    GD  +F R L  +   +I+ ++     Y  R
Sbjct:  107 EDRKRFVLHTSHSALLYMEYDLTSNADCTVLELARCTDSSILYYTKLHGSSF----NKLAIISGNAFGELLVWQ--TQFPTESDPKSVMKTYPLLLRIEAHNGVIHSIEFDLQSQLLVTTSDDRSVKFWNIQKSGDW---TTAEIKPMFSC--YGHSSRVMCVVILKIDDRTFVASGGEDSYVCIWSSSGELILKRRQQFGAPIWRLGFSQDAEI---LYSTSSTGNLVGQNLKEVLNRPKIESTILSSL--GDANEFVRNLKFVNNEIIVGLSSLNRLYYTR 373          

HSP 2 Score: 59.6918 bits (143), Expect = 1.591e-8
Identity = 65/289 (22.49%), Postives = 129/289 (44.64%), Query Frame = 2
Query: 1895 VLIERPCGGGHREWDYSVWSDSARLAFIQAQAVNVVSWYGHCAQPI------VVKPHLHGKEINFCSFIG--RGTDIVLLTGSEDCSLAVITMTADCILQSVQRIHGHISSVRCVSELPT----GD----LMVSAGGRGQIIFWQ-------RC----LRDYSLRSIASALLPKLVNIDTDSRIMDICPIPHDIQQI--VIIADSCGSLTF----LCLPPGFNRPQFLYLYRLSQSCITNVAFINS--LLVACSTDGKVYWFPKGLPTTDKSEHKAQQIGKSGLQGMDV 2656
            +L++  CGGGHR WD+ +    ++L+    +   V  +       +      +   + H +  N    I     +D  +L+  +D  + V  +T D + Q  + +H HIS+VR +  +P     GD    L+ S GGR Q+   Q       +C    +  ++L ++A++    +     ++R+M I  + H    +  + +A   G+++     L  P   +   F+ +    Q C   + +I S  +L+  +T+G+VY F + L TT    +   Q+  +G+  +D+
Sbjct:  604 ILLQLACGGGHRCWDFRLSDGDSQLSIAYVKQKRVYFYRNSLYNAVDNRLKDIEPNNWHVRNCNTLRLITPRNQSDPFILSAGDDNIIKVTQVTNDSLSQRAE-MHSHISTVRSLQAIPYKSNGGDSSTWLVFSVGGRSQLCISQLSIDASNKCWISEISSHTLHNVAASKTSTI-----EARLMAIDVVQHSDGDLFSIYVAGGDGNISHYIWELETPNQLDLKHFVDI----QRCPLGIQWIASKGMLLVSTTNGEVYGFDRTLETT----YFQLQLHVTGINTIDI 878          
BLAST of WD repeat-containing protein 6 vs. Ensembl Zebrafish
Match: wdr6 (WD repeat domain 6 [Source:ZFIN;Acc:ZDB-GENE-081104-368])

HSP 1 Score: 63.1586 bits (152), Expect = 2.141e-9
Identity = 105/398 (26.38%), Postives = 150/398 (37.69%), Query Frame = 2
Query:   32 PVTCVKFMANSSQILSASGNEINL--LDYKHKTVVDVQSIKNLKVIHGIE----------------------LKDDIVIIYG-GFVFCIFVLIDNKIRFTNIFQRHDDFILACMIYFYQEDKIKFSISLAHGSTHFYSFRTGVNQKLEELGEVGTADKSLLYCCHLFRNPVVDIVNNLFLAGGNVQNLITIWEIPTPFTTVKLPQASMLSRLAGHKGAIFGIHVNWIDGLLISMGDDRSVILWLAEGGLDLSANTLTD-INWLRSTILIGHEARVWGGLSLPGDDTVMAWGED--CTLRFWSKDGTSRACIRPHTG---RSIWTGDAIIKNGKYLVVTGGNDGAVVVSEYA-------RSPEKHQAVDSFRVDGDCKDFARRLIILEKGLILVVTDFG 1111
            P+T ++F+     +L+  G  +++  L    K    +  ++N + IHGI                        K DI++  G G     F      ++         D++L    +  Q   +   ISLAH +       +G       +      +  LLY   L   P  D V    L GG V N + +W    P  T    Q+ +  RL GH G IF +      G L S  DDRSV LW + G L   A    +    LR  +L GH+ARV+     P    + + GED  C L  W  +G      R H     R++   +  I      V TGG DG V +   A        + E+ Q    FR  G C    R +   E   ILV TD G
Sbjct:   46 PITALEFLGEDF-LLTGEGPILSVYSLQASPKKCASINVLQNYR-IHGIRPYKKHQSGGIPFSGASSASDNSYKGDIIVFGGKGVRLVSFESEGQCLKLIGPLLELQDWVLDIHCFKRQPHSL-LGISLAHNAIMLLEAESG-----NIISFYSCVETCLLYSA-LMVGPNWDSV---VLVGGTVFNQLVLWR---PAGTKLSGQSQVERRLLGHSGVIFSLCYLQESGWLASASDDRSVRLW-SVGTLGGDAGCGKESPTCLR--VLYGHQARVFCVKLTP--SRLFSAGEDGACLLWEWGGEGKVGCAFRGHKSGGVRALAVSEGSISCRAGWVATGGADGGVRLWRVAEGKKISEETQEETQLDLGFRGHG-CPKVVRLVGEGESNAILVCTDQG 422          
BLAST of WD repeat-containing protein 6 vs. Ensembl Zebrafish
Match: wdr6 (WD repeat domain 6 [Source:ZFIN;Acc:ZDB-GENE-081104-368])

HSP 1 Score: 63.1586 bits (152), Expect = 2.220e-9
Identity = 105/398 (26.38%), Postives = 150/398 (37.69%), Query Frame = 2
Query:   32 PVTCVKFMANSSQILSASGNEINL--LDYKHKTVVDVQSIKNLKVIHGIE----------------------LKDDIVIIYG-GFVFCIFVLIDNKIRFTNIFQRHDDFILACMIYFYQEDKIKFSISLAHGSTHFYSFRTGVNQKLEELGEVGTADKSLLYCCHLFRNPVVDIVNNLFLAGGNVQNLITIWEIPTPFTTVKLPQASMLSRLAGHKGAIFGIHVNWIDGLLISMGDDRSVILWLAEGGLDLSANTLTD-INWLRSTILIGHEARVWGGLSLPGDDTVMAWGED--CTLRFWSKDGTSRACIRPHTG---RSIWTGDAIIKNGKYLVVTGGNDGAVVVSEYA-------RSPEKHQAVDSFRVDGDCKDFARRLIILEKGLILVVTDFG 1111
            P+T ++F+     +L+  G  +++  L    K    +  ++N + IHGI                        K DI++  G G     F      ++         D++L    +  Q   +   ISLAH +       +G       +      +  LLY   L   P  D V    L GG V N + +W    P  T    Q+ +  RL GH G IF +      G L S  DDRSV LW + G L   A    +    LR  +L GH+ARV+     P    + + GED  C L  W  +G      R H     R++   +  I      V TGG DG V +   A        + E+ Q    FR  G C    R +   E   ILV TD G
Sbjct:   18 PITALEFLGEDF-LLTGEGPILSVYSLQASPKKCASINVLQNYR-IHGIRPYKKHQSGGIPFSGASSASDNSYKGDIIVFGGKGVRLVSFESEGQCLKLIGPLLELQDWVLDIHCFKRQPHSL-LGISLAHNAIMLLEAESG-----NIISFYSCVETCLLYSA-LMVGPNWDSV---VLVGGTVFNQLVLWR---PAGTKLSGQSQVERRLLGHSGVIFSLCYLQESGWLASASDDRSVRLW-SVGTLGGDAGCGKESPTCLR--VLYGHQARVFCVKLTP--SRLFSAGEDGACLLWEWGGEGKVGCAFRGHKSGGVRALAVSEGSISCRAGWVATGGADGGVRLWRVAEGKKISEETQEETQLDLGFRGHG-CPKVVRLVGEGESNAILVCTDQG 394          
BLAST of WD repeat-containing protein 6 vs. Ensembl Xenopus
Match: basp1 (brain abundant membrane attached signal protein 1 [Source:Xenbase;Acc:XB-GENE-6258618])

HSP 1 Score: 91.6633 bits (226), Expect = 5.990e-18
Identity = 97/385 (25.19%), Postives = 169/385 (43.90%), Query Frame = 2
Query:   32 PVTCVKFMANSSQILSASGNEINLLDYKHKTVVDVQSIKNL---KVIHGIELKDD--------IVIIYG--GFVFCIFVLIDNKIRFTNIF---QRHD-----DFILACMIYFYQEDKIKFSISLAHGSTHFYSFRTGVNQKLEELGEVGTADKSLLYCCHLFRNPVVDIVNNLFLAGGNVQNLITIWEIPTPFTTVKLPQASMLSRLAGHKGAIFGIHVNWIDGLLISMGDDRSVILWLAEGGLDLSANTLTDINWLRSTILIGHEARVWGGLSLPGDDTVMAWGEDCTLRFWSKDGTSRACIRPHTGRSIWTGDAIIKNGKYLVVTGGNDGAVVVSEYARSPEKHQAVDSFRVDGDCKDFARRLI-ILEKGLILVVTDFGIFY 1120
            P+T ++F+ +   +LS  G  + +   +   ++  +  +N+     IHGI+L           IV ++G  G +     + D+ +  T I    + HD      ++  C+     +      ++L H S   Y F +G     + L EV  A+K +LY    + +   ++V    L  G V N + +W +  P  T K  +     R++GH G IF I      GLL S  DDRS+ +W      DL A +  D+  L   +L GH++RVW    L   + +++ GED     W+  G   +  + H GR I      ++  + LV TGG D A+ + +      +   + S +        A + I +++  L++V+TD G  Y
Sbjct:    9 PITALEFVGD--HLLSGEGPYLTVYSLEKDHLISHRKRQNVLQGYTIHGIKLNSSATVEGEPMIVAVFGSKGLIVLQLNISDDDVSLTEICMLRELHDWIWDVQWLGDCL-----KPAAYLGLALGHNSVALYDFLSG-----KVLKEVHCAEKCILYSACFYGHSWEELV----LVSGTVFNQLVVWGVSDP--TNKDGRTEPRQRISGHNGVIFSIFYKKKRGLLASASDDRSLRIWDVG---DLVAKSF-DVKCL--LVLYGHQSRVWSVKLL--HENIISIGEDSACIVWNYQGDIVSHFKGHKGRGIRA--VAVQGREDLVATGGADSAIRLWQINGKSSRSNELLSLQFSSSHSPGAPKAIAMVDTTLLIVMTDLGSIY 365          

HSP 2 Score: 60.4622 bits (145), Expect = 1.868e-8
Identity = 74/314 (23.57%), Postives = 135/314 (42.99%), Query Frame = 2
Query: 1790 WTCRIESSGD-ELIITGFKSILFRRLAVHSSGQHPIVLIERPCGGGHREWDYSVWSDSARLAFIQAQAVNVVSWYGHC---AQPIVVKPHLHGKEINFCSFIGRGTDI----VLLTGSEDCSLAVITMTADC-ILQSVQRIHGHISSVRCVSELPT----------GDLMVSAGGRGQIIFWQRCLRD--------YSLRSIASALLP----------KLVNIDTDSRIMDICPIPHDIQ-----QIVIIADSC--GSLTFLCLPPGFNRPQFLYLYRLSQSCITNV-AFIN-------SLLVACSTDGKV-YW 2572
            W  R+  + D  L++ GF +  F   +  ++ +   V    PCGGGHR W Y     +   A+I  ++ ++ ++  H     Q I+ +P +HG+EI    + G         VLLT SED ++ ++   A    L  +  I  HISSV+ ++   T            ++ SAGGR +I  +   +            +  +AS  L           +LV +D ++R M I  +  +++      +V +A +C  GS+ F  +     +   +      Q C+  +  F++        LL + +TDG++ +W
Sbjct:  621 WIERLSFTADGNLLVMGFHATDFVVWSTRTNEKLHCV----PCGGGHRSWSYRKEEHTEVFAYI--KSCDIFAYLSHPVGKTQSILKEP-VHGREITCVKYAGSLKTYEHLHVLLTSSEDTTVNILCFNAATNSLYQLSTISDHISSVKALALAQTKPCFQQDSSLSAVLFSAGGRAEIECYHIQINQGKDEESVLCQVIHLASHRLDEHWDRMKNKHRLVKMDPETRYMAITVVGEEVRDNPPSSLVFLAAACSDGSVRFFAVCTNSRKMLLVAESFYHQRCVLKIRPFVHRFVGGKRDLLCSAATDGRIAFW 927          
BLAST of WD repeat-containing protein 6 vs. Ensembl Mouse
Match: Wdr6 (WD repeat domain 6 [Source:MGI Symbol;Acc:MGI:1930140])

HSP 1 Score: 74.3294 bits (181), Expect = 9.169e-13
Identity = 84/301 (27.91%), Postives = 121/301 (40.20%), Query Frame = 2
Query:  332 SISLAHGSTHFYSFRTGVNQKLEELGEVGTADKSLLYCCHLFRNPVVDIVNNLFLAGGNVQNLITIWEIPTPFTTVKLPQASMLSRLAGHKGAIFGIHVNWIDGLLISMGDDRSVILWLAEGGLDLSANTLTDINWLRSTILIGHEARVWGGLSLPGDDTVMAWGEDCTLRFWSKDGTSRACIRPHTGRSIWTGDAIIKNGKYL-VVTGGNDGAVVVSEYARSPEKHQAVDSFRVDGDCKDFARRLIILEKG-LILVVTDFGIFYLIREQEREKSGRQSMMERVNCDIADDLLNHYCFMFA 1228
            +++L H S   Y    G       L +V   D+  L    L    V D    L +  G V N + IW   T  T  K    +   R++GH G IF +      GLL +  +DRSV LW   G L +    + +I         GH ARVW    L  ++ +++ GEDC    WS +G      R H GR I    AI  + +   VVTGG+D  + +   A        V S       +  A + + L     +L VTD G  YL    + E    + ++E       D+    YC + A
Sbjct:  130 AVALGHNSVVLYDPVIGCM-----LQDVPCTDRCTLSSACL----VGDTWKELTIVAGAVSNELLIWYPATALTDNK--PVAPDRRVSGHVGVIFSMSYLESKGLLATASEDRSVRLWKV-GDLRVPGGRVQNIGH-----CFGHSARVWQVKLL--ENYLISAGEDCVCLVWSHEGEILQAFRGHRGRGI---RAIATHERQAWVVTGGDDSGIRLWHLAGRGYPGLGVSSLSFKSPSRPGALKAVTLAGSWRVLAVTDVGSLYLY---DLEVKSWEQLLE-------DNRFRSYCLLEA 398          
BLAST of WD repeat-containing protein 6 vs. UniProt/SwissProt
Match: sp|Q5XFW6|WDR6_RAT (WD repeat-containing protein 6 OS=Rattus norvegicus OX=10116 GN=Wdr6 PE=1 SV=2)

HSP 1 Score: 90.5077 bits (223), Expect = 7.108e-17
Identity = 172/734 (23.43%), Postives = 273/734 (37.19%), Query Frame = 2
Query:  332 SISLAHGSTHFYSFRTGVNQKLEELGEVGTADKSLLYCCHLFRNPVVDIVNNLFLAGGNVQNLITIWEIPTPFTTVKLPQASMLS---RLAGHKGAIFGIHVNWIDGLLISMGDDRSVILWLAEGGLDLSANTLTDINWLRSTILIGHEARVWGGLSLPGDDTVMAWGEDCTLRFWSKDGTSRACIRPHTGRSIWTGDAIIKNGKYL-VVTGGNDGAVVVSEYARSPEKHQAVDSFRVDGDCKDFARRLIILEKG-LILVVTDFGIFYLIREQEREKSGRQSMMERVNCDIADDLLNHYCFMFAHNAHR---VVLLGNASGQLFVTKLKF-TESGSPNLITLETFKLGHKIMAIGAFIDTDTLVSLNNGQMVRVVRHSAD--------KFNIFDLLTVTGDGWAACWTQWWRQEGCQQVLHLVCGDRDGWLHAFQ----LAGKSDSQPQLIA------------------------TSKRKLSEKSGITCLLWHEQHQRIYVGTKSGDVFSXXXXXXXXXXXXXRNP-DMIGWTCRIESSGD-ELIITGFKSILFRRLAVHSSGQHPIVLIERPCGGGHREWDYSVWSDSARLAFIQAQAVNVVSWYGHCAQP-IVVKPHLHGKEINFCSFIGRGT--------------------------DIVLLTGSEDCSLAVITM-TADCILQSVQRIHGHISSVRCVS----ELPTGD---------LMVSAGGRGQI 2269
            +++L H S   Y    G       L +V   D+  L    L    + D    L +  G V N + +W     +    LP    ++   R++GH G IF +      GLL +  +DRSV +W   G L +    + +I         GH ARVW    L  ++ +++ GEDC    WS +G      R H GR I    AI  + +   V+TGG+D  + +            V S       +  A + + L     +L VTD G  YL    + E    + ++E       D+    YC + A        +  L N  G + V  +   T +   NL   +   L   +      +    L++   G +V  +  SA         K     LL  +   W  C       +       LVCGDR G +  F     L  K    P+ I                         +S   L  K G+T +  H  +  +Y   + G  + L   G     V+ +     + W   +  + D  +++ GF +  F    V S   H  + I   CGGGHR W +S    +   A+++   V +    G C +P ++++  LHG+EI     +G  T                          DIV +TGSED ++ V+ + T      ++  +  HISSVR ++      P G           +VSAGGR ++
Sbjct:  130 ALALGHNSVVLYDPVIGCM-----LQDVPCTDRCTLSSACL----IGDTWKELTIVAGAVSNELLVW-----YPATALPDNKPVAPDRRVSGHVGVIFSMSYLESKGLLATASEDRSVRIWKV-GDLRVPGGRVQNIGH-----CFGHSARVWQVKLL--ENYLISAGEDCVCLVWSHEGEILQAFRGHQGRGI---RAIAAHERQTWVITGGDDSGIRLWHLVGRGYPGLGVSSLSFKSPSRPGALKAVTLAGSWRVLAVTDVGGLYLY---DLEVKCWEQLLE-------DNRFQSYCLLEAAPGPEGFGLCALANGEGLVKVVPINTPTAAVDQNLFQGKVHSLSWALRGYEELL----LLASGPGGVVACLEISAAPTGKAIFVKERCRYLLPPSKQRWHTCSAFLPPGD------FLVCGDRRGSVLLFPARPCLFKKPGVGPKAITAAEAPQAGSSSGGSESVVTGLGPVSSLHSLHGKQGVTSVTCHGGY--VYSTGRDGSYYQLFVHGGRLQPVLRQKACRGMNWIAGLRMAPDGSMVVLGFHANEF---VVWSPRSHEKLHIVN-CGGGHRSWAFSDTEAAMAFAYLKDGDVMLYRALGGCIRPNVILREGLHGREITCVKRVGTVTLGPEFEVPNLEHPDSLEPGSEGPGLIDIV-ITGSEDTTVCVLALPTTTGAAHALTAVCNHISSVRALAVWGVGTPGGPQDSHPGLTAQVVSAGGRAEM 811          
BLAST of WD repeat-containing protein 6 vs. UniProt/SwissProt
Match: sp|Q99ME2|WDR6_MOUSE (WD repeat-containing protein 6 OS=Mus musculus OX=10090 GN=Wdr6 PE=1 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 6.414e-12
Identity = 84/301 (27.91%), Postives = 121/301 (40.20%), Query Frame = 2
Query:  332 SISLAHGSTHFYSFRTGVNQKLEELGEVGTADKSLLYCCHLFRNPVVDIVNNLFLAGGNVQNLITIWEIPTPFTTVKLPQASMLSRLAGHKGAIFGIHVNWIDGLLISMGDDRSVILWLAEGGLDLSANTLTDINWLRSTILIGHEARVWGGLSLPGDDTVMAWGEDCTLRFWSKDGTSRACIRPHTGRSIWTGDAIIKNGKYL-VVTGGNDGAVVVSEYARSPEKHQAVDSFRVDGDCKDFARRLIILEKG-LILVVTDFGIFYLIREQEREKSGRQSMMERVNCDIADDLLNHYCFMFA 1228
            +++L H S   Y    G       L +V   D+  L    L    V D    L +  G V N + IW   T  T  K    +   R++GH G IF +      GLL +  +DRSV LW   G L +    + +I         GH ARVW    L  ++ +++ GEDC    WS +G      R H GR I    AI  + +   VVTGG+D  + +   A        V S       +  A + + L     +L VTD G  YL    + E    + ++E       D+    YC + A
Sbjct:  130 AVALGHNSVVLYDPVIGCM-----LQDVPCTDRCTLSSACL----VGDTWKELTIVAGAVSNELLIWYPATALTDNK--PVAPDRRVSGHVGVIFSMSYLESKGLLATASEDRSVRLWKV-GDLRVPGGRVQNIGH-----CFGHSARVWQVKLL--ENYLISAGEDCVCLVWSHEGEILQAFRGHRGRGI---RAIATHERQAWVVTGGDDSGIRLWHLAGRGYPGLGVSSLSFKSPSRPGALKAVTLAGSWRVLAVTDVGSLYLY---DLEVKSWEQLLE-------DNRFRSYCLLEA 398          
BLAST of WD repeat-containing protein 6 vs. UniProt/SwissProt
Match: sp|Q08924|WDR6_YEAST (Regulator of Ty1 transposition protein 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RTT10 PE=1 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 7.730e-12
Identity = 83/352 (23.58%), Postives = 149/352 (42.33%), Query Frame = 2
Query:   32 PVTCVKFMANSSQILSASGNEINLLDYKHKTVVDVQSIKNLKVIHGIELKDD-IVIIYGGFVFCIFVLID--NKIRFTNIFQRHDDFILACMIYFYQEDKIKFSISLAHGSTHFYSFRTGVNQKLEELGEVGTADKSLLYCCHLFRNPVVDIV--NNLFLAGGNVQNLITIWEIPTPFTTVKLPQASMLSRLAGHKGAIFGIHVNWIDGLLISMGDDRSVILWLAEGGLDLSANTLTDINWLRSTILIGHEARVWGGLSLPGDDTVMAWGEDCTLRFW----SKDGTSRACI----RPHTGRSIWTGDAIIKNGKYLVVTGGNDGAVVVSEYARSPEKHQAVDSFRVDGDCK 1048
            P  CVKF   +  +L+  G  I++ DY   T+++   + +   +HG+ L  +  ++ YG     I  L D   K    +  + + D+I      F   D ++  +   +           V  +    GE     +S+LY      + ++ +   + +++  G V   + IW++   F+  K+        L GH+G+IF ++++     + S  DDRS+ LW  E G  LS      + W        H AR+W  +    D  +++  EDCT R W    S++  +   I      H  +SIW  D  +K+ + + VT GNDG + + +  +         SF +D   K
Sbjct:    9 PALCVKFY--NDYVLAGYGPFIHVYDYHSATLINKCRLFHYNKVHGLSLSSEGKILAYGARSVTIVELEDVLKKESLVDFERINSDWITGATFSF---DNLQIYLLTCYNKVLICDLNCEVLFRKSLGGE-----RSILY------SGIIKVFGPDKVYVNAGTVMGGVIIWDL---FSETKI------HNLLGHEGSIFYVNLSNNGRYVASCSDDRSIRLWDLETGKQLS------VGW-------SHTARIWNLMFFDNDSKLISVSEDCTCRVWNIIESRENVAELSISNVYEVHLIKSIWGVD--VKDDEMIAVTSGNDGRLKLIDLLQLKRHGDEETSFSLDDIAK 320          
BLAST of WD repeat-containing protein 6 vs. UniProt/SwissProt
Match: sp|Q9USZ0|WDR6_SCHPO (Uncharacterized WD repeat-containing protein C1306.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1306.02 PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 8.740e-11
Identity = 79/329 (24.01%), Postives = 136/329 (41.34%), Query Frame = 2
Query:   32 PVTCVKFMANSSQILSASGNEINLLDYKHKTVVDVQSIKNLKV-----IHGIELKDDIVIIYGGFVFCIFVLIDNKIRFTNIFQRHDDFILACMIYFYQEDKIKFSISLAHGSTHFYSFRTGVNQKLEELGEVGTADKSLLYCCHLFRNPVVDIV-NNLFLAGGNVQNLITIWEIPTPFTTVKLPQ-ASMLSRLAGHKGAIFGIHVNWIDGLLISMGDDRSVILWLAEGGLDLSANTLTDINWLRSTILIGHEARVWGGLSLPGDDTVMAWGEDCTLRFWS---KDGTSRACIRPHTGRSIWTGDAIIKNGKYLVVTGGNDGAVVVSEY 988
            PVT +  + N   +  A G  + + D   ++  +   IK++ +     IHG+      + ++GG  F +  +  +++     + R  D+I          ++ KF +  +    H  S   G     E    +      LL+C        V I  N +++A  +    I +W+    F     P   S+ + L GH+GA F +  +     L S+ +DR++ LW  E    L A               GH ARVW  + LP  + +    ED TLR W+   K  T+      H G+ IW+   ++ +   ++ TGGNDG+V   +Y
Sbjct:   18 PVTSLALIHNDKFLCCAQGPCLRIYDVS-ESRHESDLIKSILLPFHNRIHGMLPCKQGLFVWGGTYFAVVDVETSQV----YYDRISDWIFNAA---ELGEENKFCVVTSKNQVHLLSLSKG---SWEVTNTISCEKTPLLFCA------TVQISGNEIYIASASAFQQIYVWK----FNYNNPPSCVSIDTYLVGHEGACFDLKFSSDGRYLCSVSEDRTLRLWSIESSPFLIATGF------------GHSARVWRCVFLPNKE-IATVSEDLTLRLWTWNDKTLTNTYTYTGHRGKHIWS--LVVSSANPIIYTGGNDGSVRSWDY 310          
BLAST of WD repeat-containing protein 6 vs. UniProt/SwissProt
Match: sp|Q5RB07|WDR6_PONAB (WD repeat-containing protein 6 OS=Pongo abelii OX=9601 GN=WDR6 PE=2 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 4.501e-9
Identity = 89/381 (23.36%), Postives = 158/381 (41.47%), Query Frame = 2
Query:   26 FLPVTCVKFMANSSQILSASGNEINL--LDYKH--KTVVDVQSIKNLKVIHGIELKDD---------IVIIYGGFVFCIFVLIDNKIRFTNIFQRHDDFILACMIYFYQEDKIKFSISLAHGSTHFYSFRTGVNQKLEELGEVGTADKSLLYCCHLFRNPVVDIVNNLFLAGGNVQNLITIWEIPTPFTTVKLPQASMLSRLAGHKGAIFGIHVNWIDGLLISMGDDRSVILWLAEGGLDLSANTLTDINWLRSTILIGHEARVWGGLSLPGDDTVMAWGEDCTLRFWSKDGTSRACIRPHTGRSIWTGDAIIKNGKYL-VVTGGNDGAVVVSEYARSPEKHQAVDSFRVDGDCKDFARRLIILEKG-LILVVTDFGIFYL 1123
             LPVT ++ + +  ++L+  G ++ +  LD+    + +  VQ++    +IHG  ++ +         +V ++G     +  +   +  F  ++ R   + ++  I+  +  +   +++L H S   Y    G       L EV   D+  L    L    + D    L +  G V N + +W   T     K    +   R++GH G IF +      GLL +  +DRSV +W   G L +    + +I         GH ARVW    L  ++ +++ GEDC    WS +G      R H GR I    AI  + +   V+TGG+D  + +        +   V +       +    + + L     +L VTD G  YL
Sbjct:   18 LLPVTGLECVGD--RLLAGEGPDVLVYSLDFGGHLRMIKRVQNLLGHYLIHGFRIRPEPNGDLDLEAMVAVFGSKGLRVVKISWGQGHFRELW-RSGLWNMSDWIWDARWLEGNIALALGHNSVVLYDPVVGCI-----LQEVPCTDRCTLSSACL----IGDAWKELTIVAGAVSNQLLVWYPATALADNK--PVAPDRRISGHVGIIFSMSYLESKGLLATASEDRSVRIWKV-GDLRVPGGRVQNIGH-----CFGHSARVWQVKLL--ENYLISAGEDCVCLVWSHEGEILQAFRGHQGRGI---RAIAAHERQAWVITGGDDSGIRLWHLVGRGYRGLGVSALCFKSRSRPGTLKAVTLAGSWRLLAVTDTGALYL 373          
BLAST of WD repeat-containing protein 6 vs. TrEMBL
Match: A0A2J7PV43 (WD_REPEATS_REGION domain-containing protein OS=Cryptotermes secundus OX=105785 GN=B7P43_G16418 PE=4 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 8.445e-43
Identity = 213/919 (23.18%), Postives = 384/919 (41.78%), Query Frame = 2
Query:   35 VTCVKFMANSSQILSASGNEINLLDYKHKTVVDVQSIKNLKVIHGI-ELKDDIVIIYGGFVFCIFVLIDNKIRFTNIFQRHDDFILACMIYFYQEDKIKF---------SISLAHGSTHFYSFRTGVNQKLEELGEVGTADKSLLYCCHLFRNPVVDIVNNLFLAGGNVQNLITIWEIPT-PFTTVKLPQASMLSRLAGHKGAIFGIHVNWIDGLLISMGDDRSVILWLAEGGLDLSANTLTDINWLRSTI-----LIGHEARVWGGLSLPGDDTVMAWGEDCTLRFWSKDGTSRACIRPHTGRSIWTGDAIIKNGKYLVVTGGNDGAV---------VVSEYARSPEKHQAVDSFRVDGDCKDFARRLIILEKGLILVVTDFGIFYLIREQEREKSGRQSMMERVNCDIADDLLNHYCFMFAHNAHRVVLLGNASGQLFVTKLKFTESGSPNLITLETFKLGHKIMAIGAFIDTDTLVSLNNGQMVRVVR----HSADKFNIFDLLTVTGDGWAACWTQWWRQEGCQQVLHLVCGDRDGWLHAFQLAGKSDSQPQLIATSKRKLSEKSGITCLLWHEQHQRIYVGTKSGDVFSXXXXXXXXXXXXXRNPDM-IGWTCRIESSGDELIITGFKSILFRRLAVHSSGQHPIVLIERPCGGGHREWDYSVWSDSARLAFIQAQAVNVVSWYGHCAQPIVVKPHL----HGKEINFCSFIGRGTDI------VLLTGSEDCSLAVITMTADCILQSVQRIHGHISSVRCVSELPTGD--LMVSAGGRGQIIFWQ-------------RC-------LRDYSLRSIASALLPKLVNIDTDSRIMDICPI------PHDIQQIVIIADSC--GSLTFLCLPPGFNRPQFLYLYRLSQSCITNVAFINS-----LLVACSTDGKV 2566
            VT VKF+     I++  G  I++ + +    +  + I   + +H I   ++  + + GG +  IF L           +R  +F+L+    +  +D I++         +I  AH     ++ RTG  ++     E+      +LYC  L      D+V    +  G V   I IW   +    TV  P   +L  L GH G IF +  +     + S  DDRSV LW  +  L    N +T   W  +TI     + GH ARVW  + +  D+ +++ GED  L  W  DG+ +   + H G ++W+ D      K L+VTGG DG +          V  +          D   + G   +F RR+ +  K  ++ +TD G         R +   + M +       D+ L  YC +      + V L +  G + + K   +  G   ++ +E   +  +I ++  ++ +D L+S     ++ + +        K N F+L             + W      +   LVCGDR+G +H F++     +  Q  + S  K+  + G++ L+W+     +Y   + G V        +  +  L    + + W      S   L++ GF++  F  +  H   ++ + +   PCGGGHR WD+++   + R  +++ + V++ +    C    ++KP L    H K+I+    I    D       +LL+ SED ++ +  ++   +L +V  +  HISSVR ++     D  L+ S GGR Q+  W+             +C       L+D S ++     L     +D ++R MD+C +      P   +++V++A  C  G L        +N  + +  +     CI  V+ I +     + V  +TDG V
Sbjct:   15 VTTVKFIGQ--WIIAGIGGCIHVFETQSGKFITREKIFEGQRVHNIFAGRNQNIAVIGGKMVRIFKL-----------EREGNFVLSTYASWAADDWIQYLHWLDCGNIAIVTAHNVVSLWNSRTGEKER-----EIFCEVNCILYCALLDGLSWSDLV----VFTGTVFQQILIWAPASVEEDTVNSP---VLHTLKGHDGVIFSVSYDPDSNYICSTSDDRSVRLWSVDLQLSDDCNRVT--QWKEATITLLHTMYGHTARVWRNIII--DNVIISVGEDSCLCVWRTDGSLQKYWKTHQGANVWSVDC--SKEKNLIVTGGGDGGISLWPLHTESAVPNFLTFSGNLFTQDFCSMKGQNGNFPRRIGLTSKDNVVAITDSGCLLYCTVVGRGQGNWKLMHQ-------DEKLASYCLLEMSPCRQYVALASMDGHILIFKDCSSVHGKGLILNVEEKAVVGRIFSL-HWLSSDNLLSCGPNGILEMWKLGHPQWLQKMNEFELPKSK---------ERWISAAALRENFLVCGDRNGSIHLFKIVDNQTNSIQCPSQSFYKIHGRLGVSSLIWYGNC--LYSTGRDGTVRRYLMLENEGRLECLNADKLPMEWPATTSLSAFGLLVLGFRAANF-VIWSHVERRNVLTI---PCGGGHRSWDWTLEGHTFRFIYVKDKMVHMYT----CMMNEIIKPALQSGFHSKQISCIRQIPLLKDETGNSHNLLLSASEDTTVRLSVISNSNVLHTVTVLQSHISSVRALAVYQMRDSVLVFSGGGRAQLKVWKLVIQSAQGSVPQVKCQELSSHMLKDSSKKN-KKPWLSVERTVDPETRYMDLCAVVLQCQDPDKTERVVLLAAGCSDGFLRIFGFDTFYNELRLVGKHSFHNRCILKVSLIQTESFRHVAVTMATDGIV 874          
BLAST of WD repeat-containing protein 6 vs. TrEMBL
Match: A0A2J7PV31 (WD_REPEATS_REGION domain-containing protein OS=Cryptotermes secundus OX=105785 GN=B7P43_G16418 PE=4 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 5.019e-41
Identity = 201/865 (23.24%), Postives = 364/865 (42.08%), Query Frame = 2
Query:   35 VTCVKFMANSSQILSASGNEINLLDYKHKTVVDVQSIKNLKVIHGI-ELKDDIVIIYGGFVFCIFVLIDNKIRFTNIFQRHDDFILACMIYFYQEDKIKF---------SISLAHGSTHFYSFRTGVNQKLEELGEVGTADKSLLYCCHLFRNPVVDIVNNLFLAGGNVQNLITIWEIPT-PFTTVKLPQASMLSRLAGHKGAIFGIHVNWIDGLLISMGDDRSVILWLAEGGLDLSANTLTDINWLRSTI-----LIGHEARVWGGLSLPGDDTVMAWGEDCTLRFWSKDGTSRACIRPHTGRSIWTGDAIIKNGKYLVVTGGNDGAV---------VVSEYARSPEKHQAVDSFRVDGDCKDFARRLIILEKGLILVVTDFGIFYLIREQEREKSGRQSMMERVNCDIADDLLNHYCFMFAHNAHRVVLLGNASGQLFVTKLKFTESGSPNLITLETFKLGHKIMAIGAFIDTDTLVSLNNGQMVRVVR----HSADKFNIFDLLTVTGDGWAACWTQWWRQEGCQQVLHLVCGDRDGWLHAFQLAGKSDSQPQLIATSKRKLSEKSGITCLLWHEQHQRIYVGTKSGDVFSXXXXXXXXXXXXXRNPDM-IGWTCRIESSGDELIITGFKSILFRRLAVHSSGQHPIVLIERPCGGGHREWDYSVWSDSARLAFIQAQAVNVVSWYGHCAQPIVVKPHL----HGKEINFCSFIGRGTDI------VLLTGSEDCSLAVITMTADCILQSVQRIHGHISSVRCVSELPTGD--LMVSAGGRGQIIFWQ-------------RC-------LRDYSLRSIASALLPKLVNIDTDSRIMDICPI------PHDIQQIVIIADSC 2425
            VT VKF+     I++  G  I++ + +    +  + I   + +H I   ++  + + GG +  IF L           +R  +F+L+    +  +D I++         +I  AH     ++ RTG  ++     E+      +LYC  L      D+V    +  G V   I IW   +    TV  P   +L  L GH G IF +  +     + S  DDRSV LW  +  L    N +T   W  +TI     + GH ARVW  + +  D+ +++ GED  L  W  DG+ +   + H G ++W+ D      K L+VTGG DG +          V  +          D   + G   +F RR+ +  K  ++ +TD G         R +   + M +       D+ L  YC +      + V L +  G + + K   +  G   ++ +E   +  +I ++  ++ +D L+S     ++ + +        K N F+L             + W      +   LVCGDR+G +H F++     +  Q  + S  K+  + G++ L+W+     +Y   + G V        +  +  L    + + W      S   L++ GF++  F  +  H   ++ + +   PCGGGHR WD+++   + R  +++ + V++ +    C    ++KP L    H K+I+    I    D       +LL+ SED ++ +  ++   +L +V  +  HISSVR ++     D  L+ S GGR Q+  W+             +C       L+D S ++     L     +D ++R MD+C +      P   +++V++A  C
Sbjct:   15 VTTVKFIGQ--WIIAGIGGCIHVFETQSGKFITREKIFEGQRVHNIFAGRNQNIAVIGGKMVRIFKL-----------EREGNFVLSTYASWAADDWIQYLHWLDCGNIAIVTAHNVVSLWNSRTGEKER-----EIFCEVNCILYCALLDGLSWSDLV----VFTGTVFQQILIWAPASVEEDTVNSP---VLHTLKGHDGVIFSVSYDPDSNYICSTSDDRSVRLWSVDLQLSDDCNRVT--QWKEATITLLHTMYGHTARVWRNIII--DNVIISVGEDSCLCVWRTDGSLQKYWKTHQGANVWSVDC--SKEKNLIVTGGGDGGISLWPLHTESAVPNFLTFSGNLFTQDFCSMKGQNGNFPRRIGLTSKDNVVAITDSGCLLYCTVVGRGQGNWKLMHQ-------DEKLASYCLLEMSPCRQYVALASMDGHILIFKDCSSVHGKGLILNVEEKAVVGRIFSL-HWLSSDNLLSCGPNGILEMWKLGHPQWLQKMNEFELPKSK---------ERWISAAALRENFLVCGDRNGSIHLFKIVDNQTNSIQCPSQSFYKIHGRLGVSSLIWYGNC--LYSTGRDGTVRRYLMLENEGRLECLNADKLPMEWPATTSLSAFGLLVLGFRAANF-VIWSHVERRNVLTI---PCGGGHRSWDWTLEGHTFRFIYVKDKMVHMYT----CMMNEIIKPALQSGFHSKQISCIRQIPLLKDETGNSHNLLLSASEDTTVRLSVISNSNVLHTVTVLQSHISSVRALAVYQMRDSVLVFSGGGRAQLKVWKLVIQSAQGSVPQVKCQELSSHMLKDSSKKN-KKPWLSVERTVDPETRYMDLCAVVLQCQDPDKTERVVLLAAGC 820          
BLAST of WD repeat-containing protein 6 vs. TrEMBL
Match: T1JG63 (WD_REPEATS_REGION domain-containing protein OS=Strigamia maritima OX=126957 PE=4 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 2.466e-37
Identity = 166/639 (25.98%), Postives = 275/639 (43.04%), Query Frame = 2
Query:  488 LFLAGGNVQNLITIWEIPTPFTTVKLPQASMLSRLAGHKGAIFGIHVNWIDGLLISMGDDRSVILW----LAEGGLDLSANTLTDINWLRSTILIGHEARVWGGLSLPGDDTVMAWGEDCTLRFWSKDGTSRACIRPHTGRSIWTGDAIIKNGKYLVVTGGNDGAVVVSEYARSPEKHQAV----------DSFRVDGDCKDFARRLIILEKGLILVVTDFGIFYLIREQEREKSGRQSMMERVNCDIADDLLNHYCFMFAHNAHRVVLLGNASGQLFVTKLKFTESGSPNLITLETFKLGHKIMAIGAFIDTDTLVSLNNGQMVRVVRHSADKFNIFDLLTVTGDGWAACWTQWWRQEG-CQQVLHLVCGDRDGWLHAFQLAGKSDSQPQLIATSKRKL---SEKSGITCLLWHEQHQRIYVGTKSG--DVFSXXXXXXXXXXXXXRNPDMIGWTCRIESSGDELIITGFKSILFRRLAVHSSGQHPIVLIERPCGGGHREWDYSVWSDSARLAFIQAQAVNVVSWYGHCAQPIVVKPHLHGKEINFCSFIGRGTDI-------VLLTGSEDCSLAVITMTADCILQS---VQRIHGHISSVRCVSEL-----------PTGDLMVSAGGRGQIIFWQ 2281
            L + GG V + + IW  P+  +  K  +  ++ RL GH+G IF +  N    L+ S  DDRSV LW     ++ G +L+++     +    ++L GH ARVW   ++P    +++ GED  L  W   G     I+ H G  IW+    + + +  V +GG+D  + +   +++   +  V              V  + +DF R + +L+   ILV+T+ G+ Y             S  ++ +  + D++   YC +      + V LG+ SGQ+ V      E        +       KI+AI        L     G M+  + H  +      L          C  +W        Q   +VCGDRDG +H F   G+  +  Q I+   + L      +G+  ++ H  + RIY   + G   +FSL   GL ++  + +  + + W  RI    D + I GF     R+  +  S +    +   PCGGGHR WD+ + +D  RL +I+   V           P +++P LHG+ I  CS +   + +       V  T SED ++ +I    +        V  +HGHISSVR ++             P+  L++SAGGR Q+  WQ
Sbjct:  182 LAVLGGTVFHDVIIW-CPSEHSVSK-EKKRVIHRLQGHEGVIFSVAYNACLQLICSTSDDRSVRLWSVVIPSKSGSELTSDEWASASINLKSVLYGHTARVWK--AIPLGHCLVSAGEDSFLCVWDYKGAVMQKIQAHNGGKIWS--VAVDDCETWVASGGSDAGIQLWPISQNALTNSRVPVSVPLPILSSPSNVLIEAEDFPRTIALLDIQHILVMTNEGMLYC----------HDSATDQWSVLVNDNIYRSYCLLVPDPFGQYVALGSLSGQILVINTDIREGSIAAFQCVRQQIYSDKILAICWLDQKRLLTCGTQGNML--LWHLCNSGGCLQLTLHRDFLLPMCKQRWISTAAFIPQNSRIVCGDRDGNVHLFAYDGRCMTSEQPISVPLQSLFGIHTLNGVAHVVHH--NGRIYTAGRDGIVKIFSLKEGGLVEERGI-KVSNCLDWISRILFIKDTMYILGFH----RKDFIVWSWEQQCSVFTLPCGGGHRSWDFKMSTDGVRLVYIRGNEVLQCYVDSSFHIPYILRPSLHGRRI--CSLLHLFSVMKDTEELNVCATASEDNTIKIIAFMCNKNCDKWHLVCTLHGHISSVRTLAACTVYTEEEEDSQPSQLLLLSAGGRAQVKLWQ 793          
BLAST of WD repeat-containing protein 6 vs. TrEMBL
Match: A0A067R4E2 (WD_REPEATS_REGION domain-containing protein (Fragment) OS=Zootermopsis nevadensis OX=136037 GN=L798_09044 PE=4 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 5.611e-35
Identity = 176/717 (24.55%), Postives = 298/717 (41.56%), Query Frame = 2
Query:  605 GAIFGIHVNWIDGLLISMGDDRSVILWLAEGGLDLSANTLTDINWLRSTIL---IGHEARVWGGLSLPGDDTVMAWGEDCTLRFWSKDGTSRACIRPHTGRSIWTGDAIIKNGKYLVVTGGNDGAV---------VVSEYARSPEKHQAVDSFRVDGDCKDFARRLIILEKGLILVVTDFGIFYLIREQEREKSGRQSMMERVNCDIADDLLNHYCFMFAHNAHRVVLLGNASGQLFVTKLKFTE-SGSPNLITLETFKLGHKIMAIGAFIDTDTLVSLNNGQMVRVVR----HSADKFNIFDLLTVTGDGWAACWTQWWRQEGCQQVLHLVCGDRDGWLHAFQLAGKSDSQPQLIATSKRKLSEKSGITCLLWHEQHQRIYVGTKSGDVFSXXXXXXXXXXXXXRNPD--MIGWTCRIESSGDELIITGFKSILFRRLAVHSSGQHPIVLIERPCGGGHREWDYSVWSDSARLAFIQAQAVNVVSWYGHCAQPIVVKP----HLHGKEINFCS--FIGRGTDI---VLLTGSEDCSLAVITMTADCILQSVQRIHGHISSVR--CVSELPTGDLMVSAGGRGQIIFWQ-------------RC-------LRDYSLRSIASALLPKLVNIDTDSRIMDICPIPHDIQQI------VIIADSC--GSLTFLCLPPGFNRPQFLYLYRLSQSCITNVAFINS-----LLVACSTDGKV 2566
            G IF +  +     + S  DDRSV LW  +  L   +N +T     + T+L    GH ARVW  + +  DD +++ GED  L  WS DG+ +   + H G S+W+ D      K L+VTGG DG +          V       E     +   V G  ++F RR+ +  K  I+ +T  G        +  +   + + +       D+ L  YC +      + V LG+  G + V K   +   G   +++ E   +  +I ++  ++ +D L+S     ++ + +    H   K   F+L             QW      ++   LVCGDR+G +H F+++       Q  + S  K+    G++ L W+  +  +Y   + G          ++  +   N D   I W      S   L++ GF+++ F    V  S      L+  PCGGGHR WD+     + RL +++ + V++ +    C     VKP      H K I       +    +I   +LL+ SED ++ +  ++   + Q++  +  HISSVR   V +L    L+ S GGR Q+  W+             +C       LRD S R+     L     +D ++R MD+C +   ++        V++A  C  G L         +  + L  Y     CI  V+ I +     + +  +TDGKV
Sbjct:    1 GVIFSVSYDAASQYICSTSDDRSVRLWSVDLQLSDGSNRVTQWKEAKITLLRSMYGHTARVWRNIMV--DDVIISVGEDSCLCVWSVDGSLQKYWKTHQGASVWSVDC--SKEKNLIVTGGADGGISLWPLHTDRAVPNLLAFHEHLYGQEFTSVKGHNQNFPRRIGLTSKNNIVAITGNGCLLYCTLLDSGQGNWKVIHQ-------DEKLASYCLLEMSPCRQYVALGSMDGYILVFKEDCSSVQGKYLILSDEEKAVTGRIFSL-RWLSSDNLLSCGPHGLLEMWKLGFSHQMKKVAEFELPRSK--------EQWISAAALREKF-LVCGDRNGSIHLFEVSDDQSCSVQFPSQSFYKIHGHLGVSSLTWYGNY--LYSTGRDG-ALRCYMMLENESRLECLNADKLQIDWPAATSLSAFGLLVLGFRAVNF----VVWSHTERRTLLTVPCGGGHRSWDWIFEGHTFRLIYLKDKMVHMYT----CMMDEFVKPVIQNGFHSKHITCVRQVLLKDKANINHSLLLSASEDTTIRLAVISHSNVPQTLTVLQSHISSVRTLAVCQLHDSVLVFSGGGRAQLKVWKLVIHATQEFIPIVKCQELTSHMLRDPSKRN-KKPWLSVERTVDPETRYMDLCAVALQLRDTDQRGTAVLLAAGCSDGFLRIFGFYTLCSELRLLGKYSFHDRCILKVSLIQTENFRHIALTMATDGKV 684          
BLAST of WD repeat-containing protein 6 vs. TrEMBL
Match: A0A3L8D9J6 (WD_REPEATS_REGION domain-containing protein OS=Ooceraea biroi OX=2015173 GN=DMN91_011075 PE=4 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 1.263e-31
Identity = 204/845 (24.14%), Postives = 348/845 (41.18%), Query Frame = 2
Query:  110 YKHKTVVDVQSIKNLKVIHGIEL-KDDIVIIYGGFVFCIF-VLIDNKIRFTN-IFQRHDDFILACMIYFYQEDKIKFSISLAHGSTHFYSFRTGVNQKLEELGEVGTADKSLLYC---CHLFRNPVVDIVN-NLFLAGGNVQNLITIWEIPT-PFTTVKLPQASMLSRLAGHKGAIFGIHVNWIDGLLISMGDDRSVILWLAEGGLDLSANTLTDINWLRSTI-----LIGHEARVWGGLSLPGDDTVMAWGEDCTLRFWSKDGTSRACIRPHTGRSIWTGDAIIKNGKYLVVTGGNDGAVVV--SEYARSPEKHQAVDSFRVDGDCKDFARRLIILEKGLILVVTDFGIFYLIREQEREKSGRQSMMERVNCDIADDLLNHYCFMFAHNAHRVVLLGNASGQLFVTKLKFTESGSPNLITLETFKLGHKIMAIGAF----IDTDTLVSLNNGQMVRVVRHSADKFNIFDLLT-VTGDGWAACWTQWWRQEGCQQVLHLVCGDRDGWLHAFQLAGKS-DSQP-QLIATSKRKLSEKS-----GITCLLWHEQHQRIYVGTKSGDVFSXXXXXXXXXXXXXRNPDMIGWTCRIESSGDELIITGFKSILFRRLAVHSSGQHPIVLIERPCGGGHREWDYSVWSDSARLAFIQAQAVNVVSWYGHCAQPIVVKPHLHGKEINFCSFIGR-GTDIVLLTGSEDCSLAVITMTADC-----ILQSVQRIHGHISSVRCVSELPTGD----------LMVSAGGRGQIIFWQRCLR---------DYSLRSIASALL--------------PKLVNIDTDSRIMDICP-IPHDIQQIVIIADSCGSLTFL 2443
            Y+ K+ +D     N   IHGI L  ++ + ++G    C+  +L + +I F      + +D+I+A + +   + + + +I  AH     Y+   G ++              ++YC   C L+   +    + NL +  G V   I IW+I   P +   +P   +L RL GHKG IF +       L+ S  DDR+V LW      +   +  +D+NW  + I     +  H ARVW   ++  +D ++  GED  +  WS  G     +  H G  IW+ D I +NG+  + TGG DG+V    +   R+  K  ++ S     D  +  + +  L  G IL+  D G   L  ++E         +E+            YC M        V L +  G++ + K    E  S N   L    +  +IM    F    +  DTLV+      +R+       F + D  T V          + W          LVCGDR G +HAF+++  S D++P Q  +    K+  +S     G       +   R Y    SGD          + +++ R    + W     ++   +++ GFK + F    +     H  +LI  PCGGGHR WD ++   +A  A+++ + V  + +     +  +++   H KE      + R     V ++GSEDCSL +   +A          ++    GH+S V+C+S +   +          L+ SAGGR Q+  W+   +         D S   + S +L               +   ++ ++R MDIC   P +  + V+I  +C    +L
Sbjct:   36 YQLKSNLDCLYPNN---IHGIVLGPNNKLAVFGAKSICVCSILKEEEIIFKKQTTDQFNDWIIA-VEWISVKKQAQLAILFAHNYVCIYNVFDGSSR--------------VVYCKEKCILYGGSISGTSDENLVIFSGTVFQEILIWKINNNPGSNENVP---VLHRLTGHKGVIFSVVYCPYSRLVCSTSDDRTVRLWKVT---ERDTSEGSDVNWQMAEITLMKTMFSHTARVWR--AVIKNDVIVTIGEDSLMCTWSLTGELLNKVHAHRGAPIWSID-ITENGEK-IFTGGADGSVCAWPTMCCRNNPKIISLSS----NDKCNVPKYISYLSSGTILIFNDTGTL-LCYDKEATVPKASLHLEKYCA---------YCIMQVSPCRSFVALASREGEVTIYK----EIISANTWHLRRL-VEERIMESQIFSLQWLRHDTLVACGANGRLRIF-----NFTMVDAATRVEAQCTLPASRERWLTAAVIYEELLVCGDRAGNVHAFEMSDMSEDAKPVQTFSKVHGKIGVQSFAVVDGKLMTTGRDAMLRFY-ELSSGD--------RRRLLMLHRKKMPMDWIGGALTANGTVLVLGFKEVEFMMYDL----LHEKILIRVPCGGGHRSWDCTLLDGTASFAYVRNKQVYALDYPLESLKLPILQTGFHTKETCCLRRVLRLDAQDVFVSGSEDCSLRISCASATSRDDPFAFCNLGIFDGHLSGVKCISTVRLRNDASDKTNNRYLVFSAGGRAQLKVWEMKFKYNQRMSPNVDVSCSDVKSHMLHGQDQYRRKPWQETKQFYVVEPETRYMDICAYYPAEDPKHVLIFVACADGYYL 815          
BLAST of WD repeat-containing protein 6 vs. Ensembl Cavefish
Match: wdr6 (WD repeat domain 6 [Source:ZFIN;Acc:ZDB-GENE-081104-368])

HSP 1 Score: 52.7582 bits (125), Expect = 2.516e-6
Identity = 66/237 (27.85%), Postives = 90/237 (37.97%), Query Frame = 2
Query:  302 YFYQEDKIKFSISLAHGSTHFYSFRTGVNQKLEELGEVGTADKSLLYCCHLFRNPVVDIVNNLFLAGGNVQNLITIWEIPTPFT---------TVKLPQASMLSRLAGHKGAIFGIHVNWIDGLLISMGDDRSVILWLAEGGLDLSANTLTDI-NWLRSTILIGHEARVWGGLSLPGDDTVMAWGEDCTLRFWSKDGTSRACIRPHTG---RSIWTGDAIIKNGKYLVVTGGNDGAV 973
            +   E      +S+AH +      ++G     + L     A+  LLY   L      + V    L GG V N + +W      T            L  A +  RL GH G IF +      G L S  DDRSV LW   G L  S     ++   LR  +L GH+ARV       G+D        C L  W  +G     ++ H     RS+   +A +      V TGG DG V
Sbjct:  130 WLMDEPCPLLGVSIAHNAAILLEPQSG-----KVLSLCSCAEACLLYSALLIGQSWEESV----LVGGTVFNQLVLWRPGRTGTGRQCQAGTQACALTDAQVERRLLGHSGVIFSLFYLQSSGWLASASDDRSVRLWHV-GELSGSGGCGVEVPTCLR--VLYGHQARV------AGEDGA------CLLWEWEGEGRVGRTLKSHRSGGIRSLAVSNASVGKRSRWVATGGADGGV 342          
BLAST of WD repeat-containing protein 6 vs. Ensembl Cavefish
Match: wdr6 (WD repeat domain 6 [Source:ZFIN;Acc:ZDB-GENE-081104-368])

HSP 1 Score: 52.7582 bits (125), Expect = 2.689e-6
Identity = 66/237 (27.85%), Postives = 90/237 (37.97%), Query Frame = 2
Query:  302 YFYQEDKIKFSISLAHGSTHFYSFRTGVNQKLEELGEVGTADKSLLYCCHLFRNPVVDIVNNLFLAGGNVQNLITIWEIPTPFT---------TVKLPQASMLSRLAGHKGAIFGIHVNWIDGLLISMGDDRSVILWLAEGGLDLSANTLTDI-NWLRSTILIGHEARVWGGLSLPGDDTVMAWGEDCTLRFWSKDGTSRACIRPHTG---RSIWTGDAIIKNGKYLVVTGGNDGAV 973
            +   E      +S+AH +      ++G     + L     A+  LLY   L      + V    L GG V N + +W      T            L  A +  RL GH G IF +      G L S  DDRSV LW   G L  S     ++   LR  +L GH+ARV       G+D        C L  W  +G     ++ H     RS+   +A +      V TGG DG V
Sbjct:  130 WLMDEPCPLLGVSIAHNAAILLEPQSG-----KVLSLCSCAEACLLYSALLIGQSWEESV----LVGGTVFNQLVLWRPGRTGTGRQCQAGTQACALTDAQVERRLLGHSGVIFSLFYLQSSGWLASASDDRSVRLWHV-GELSGSGGCGVEVPTCLR--VLYGHQARV------AGEDGA------CLLWEWEGEGRVGRTLKSHRSGGIRSLAVSNASVGKRSRWVATGGADGGV 342          
BLAST of WD repeat-containing protein 6 vs. Ensembl Yeast
Match: RTT10 (WD40 domain-containing protein involved in endosomal recycling; forms a complex with Rrt2p that functions in the retromer-mediated pathway for recycling internalized cell-surface proteins; interacts with Trm7p for 2'-O-methylation of N34 of substrate tRNAs; has a role in regulation of Ty1 transposition; human ortholog is WDR6 [Source:SGD;Acc:S000006104])

HSP 1 Score: 73.9442 bits (180), Expect = 1.191e-13
Identity = 83/352 (23.58%), Postives = 149/352 (42.33%), Query Frame = 2
Query:   32 PVTCVKFMANSSQILSASGNEINLLDYKHKTVVDVQSIKNLKVIHGIELKDD-IVIIYGGFVFCIFVLID--NKIRFTNIFQRHDDFILACMIYFYQEDKIKFSISLAHGSTHFYSFRTGVNQKLEELGEVGTADKSLLYCCHLFRNPVVDIV--NNLFLAGGNVQNLITIWEIPTPFTTVKLPQASMLSRLAGHKGAIFGIHVNWIDGLLISMGDDRSVILWLAEGGLDLSANTLTDINWLRSTILIGHEARVWGGLSLPGDDTVMAWGEDCTLRFW----SKDGTSRACI----RPHTGRSIWTGDAIIKNGKYLVVTGGNDGAVVVSEYARSPEKHQAVDSFRVDGDCK 1048
            P  CVKF   +  +L+  G  I++ DY   T+++   + +   +HG+ L  +  ++ YG     I  L D   K    +  + + D+I      F   D ++  +   +           V  +    GE     +S+LY      + ++ +   + +++  G V   + IW++   F+  K+        L GH+G+IF ++++     + S  DDRS+ LW  E G  LS      + W        H AR+W  +    D  +++  EDCT R W    S++  +   I      H  +SIW  D  +K+ + + VT GNDG + + +  +         SF +D   K
Sbjct:    9 PALCVKFY--NDYVLAGYGPFIHVYDYHSATLINKCRLFHYNKVHGLSLSSEGKILAYGARSVTIVELEDVLKKESLVDFERINSDWITGATFSF---DNLQIYLLTCYNKVLICDLNCEVLFRKSLGGE-----RSILY------SGIIKVFGPDKVYVNAGTVMGGVIIWDL---FSETKIHN------LLGHEGSIFYVNLSNNGRYVASCSDDRSIRLWDLETGKQLS------VGW-------SHTARIWNLMFFDNDSKLISVSEDCTCRVWNIIESRENVAELSISNVYEVHLIKSIWGVD--VKDDEMIAVTSGNDGRLKLIDLLQLKRHGDEETSFSLDDIAK 320          

HSP 2 Score: 52.373 bits (124), Expect = 4.317e-7
Identity = 73/283 (25.80%), Postives = 118/283 (41.70%), Query Frame = 2
Query: 1808 SSGDELIITGFKSILFRRLAVHSSGQHPIVLIERPCGGGHREWDYSVWSDSARLAFIQAQAVNVVSWYGHCAQPIVVKPHLHGKE---INFCSFIGRGTDI------VLLTGSEDCSLAVITMTADC-ILQSVQRIHGHISSV-RCVSELPTGDLMVSAGGRGQIIFWQRCLRD-YSLRSIAS--ALLPKLVNIDTDSRIM--DICPIPHDIQQIVIIADSCGSLTFLCLPPGFNRPQFLYLYRLSQSCITNVAFI---NSLLVACS-TDGK--VYWFPKGLP 2590
            +S  E I  GFKS LF      +  +    L    CGG HR W+ +  +D   L +I+A   ++   Y     P  ++  +HG+E   I+ C      T+       +  T SED ++ +         +Q+      H+S + RC  +     LM+S+  R ++  W+  L D Y+ R   +    LP   N ++D RIM  D+  I      +++   S  ++         N+   +   R    C+ NV FI     LLV  S TDG   VY   + +P
Sbjct:  577 NSKGEYITYGFKSSLFYLYNETNCYE----LASEVCGGSHRLWNLAKITDGHVLMYIKASRFHLRKIYNSIV-PETLENGVHGREIRDISICPVSNTNTNDNFKDGHIFCTASEDTTIKLGYFNNRTGKVQNFWTQRKHVSGLQRC--QFINHKLMISSSAREELFLWE--LNDKYNKRPYMTIRQALPVSTN-NSDLRIMDFDVKFISQSGDFLLVTVYSDSTIKIWHYRENQNKFDLIMQGRYKTCCLFNVVFIALKEELLVVISPTDGHLVVYNITEYVP 849          
BLAST of WD repeat-containing protein 6 vs. Ensembl Medaka
Match: wdr6 (WD repeat domain 6 [Source:NCBI gene;Acc:101169360])

HSP 1 Score: 58.5362 bits (140), Expect = 5.205e-8
Identity = 77/312 (24.68%), Postives = 119/312 (38.14%), Query Frame = 2
Query: 1910 PCGGGHREWDY-----SVWSDSARLAFIQAQAVNVVSWYGHC-------AQPIVVKPHLHGKEINFCSFIGRGTDI----------------------------VLLTGSEDCSLAVITM-TADCILQSVQRIHGHISSVRCVSEL----------PTGDLMVSAGGRGQI------IFWQRCLRDYSLRSIASALLP------------KLVNIDTDSRIMDICPIPHDIQQIVI-IADSCGSLTFLCLPPGFNRPQFLYLYRLSQSCITNVAFIN---------SLLVACSTDGKV-YWFPKGLPTTDKS 2605
            PCGGGHR W        +W     L FI+  AV      G           P  ++  +HGK I     +GR   +                            +++TG ED SLAV+ +      ++ +  I  HIS VR V+ +          P   L+VSAGGR QI      I W R     S + I                  K V +D ++R + I  +     ++++ +A S G++    +    N  + L+     Q C+ +VA  +          LL + +TDGK+  W   G+ +TD S
Sbjct:  748 PCGGGHRSWALWLSHTGMWPGYGALVFIKQGAVLTSQPPGKLLGAKAGRTGPRDLREGVHGKGIWCVCRVGRIVGVGHVTQTKCATNNTGNEGGDHERKESFWEIIVTGGEDTSLAVLALHPPSGAVRVLSVITDHISGVRAVTAVRRPHCESESQPLSTLLVSAGGRAQIQSYRLSIGWNRQTLTPSCQVIQVGGHRLDEQWERRRNRWKTVKMDPETRYVSIAVVEESCDRVLLALACSDGAVRLFSVTESKNHIELLWETCHHQRCVLSVATCSLEAVKNDRYKLLFSAATDGKIAVWHLTGVLSTDIS 1059          

HSP 2 Score: 56.225 bits (134), Expect = 2.286e-7
Identity = 53/166 (31.93%), Postives = 74/166 (44.58%), Query Frame = 2
Query:  494 LAGGNVQNLITIWEIPTPFTTVKL-PQASMLSRLAGHKGAIFGIHVNWIDGLLISMGDDRSVILWLAEGGLDLSANTLTDINWLRSTILIGHEARVWGGLSLPGDDTVMAWGED--CTLRFWSKDGTSRACIRPHTG---RSIWTGDAIIKNGKYLVVTGGNDGAV 973
            L GG V N + IW+            +A +  RL GH G IF +     +G L S  DDRSV LW     L        D+N     +L GH+ARV+     PG   V + GED  C +  W + G     ++ H     R++     ++ N ++ V TGG DG V
Sbjct:  184 LVGGTVFNQLIIWKTEKKDEHWDSGDKAPVERRLLGHTGVIFSVAYLQEEGFLASASDDRSVRLWGVG-ALGGPGGKCGDVNPTCLRVLYGHQARVFLVRLSPG--RVFSAGEDGACLVWDWKEGGKVMRTLKGHRAGGVRALAVSQEMMDNRRW-VATGGADGGV 345          
BLAST of WD repeat-containing protein 6 vs. Ensembl Medaka
Match: wdr6 (WD repeat domain 6 [Source:NCBI gene;Acc:101169360])

HSP 1 Score: 58.5362 bits (140), Expect = 5.279e-8
Identity = 77/312 (24.68%), Postives = 119/312 (38.14%), Query Frame = 2
Query: 1910 PCGGGHREWDY-----SVWSDSARLAFIQAQAVNVVSWYGHC-------AQPIVVKPHLHGKEINFCSFIGRGTDI----------------------------VLLTGSEDCSLAVITM-TADCILQSVQRIHGHISSVRCVSEL----------PTGDLMVSAGGRGQI------IFWQRCLRDYSLRSIASALLP------------KLVNIDTDSRIMDICPIPHDIQQIVI-IADSCGSLTFLCLPPGFNRPQFLYLYRLSQSCITNVAFIN---------SLLVACSTDGKV-YWFPKGLPTTDKS 2605
            PCGGGHR W        +W     L FI+  AV      G           P  ++  +HGK I     +GR   +                            +++TG ED SLAV+ +      ++ +  I  HIS VR V+ +          P   L+VSAGGR QI      I W R     S + I                  K V +D ++R + I  +     ++++ +A S G++    +    N  + L+     Q C+ +VA  +          LL + +TDGK+  W   G+ +TD S
Sbjct:  748 PCGGGHRSWALWLSHTGMWPGYGALVFIKQGAVLTSQPPGKLLGAKAGRTGPRDLREGVHGKGIWCVCRVGRIVGVGHVTQTKCATNNTGNEGGDHERKESFWEIIVTGGEDTSLAVLALHPPSGAVRVLSVITDHISGVRAVTAVRRPHCESESQPLSTLLVSAGGRAQIQSYRLSIGWNRQTLTPSCQVIQVGGHRLDEQWERRRNRWKTVKMDPETRYVSIAVVEESCDRVLLALACSDGAVRLFSVTESKNHIELLWETCHHQRCVLSVATCSLEAVKNDRYKLLFSAATDGKIAVWHLTGVLSTDIS 1059          

HSP 2 Score: 56.225 bits (134), Expect = 2.242e-7
Identity = 52/166 (31.33%), Postives = 73/166 (43.98%), Query Frame = 2
Query:  494 LAGGNVQNLITIWEIPTPFTTVKL-PQASMLSRLAGHKGAIFGIHVNWIDGLLISMGDDRSVILWLAEGGLDLSANTLTDINWLRSTILIGHEARVWGGLSLPGDDTVMAWGED--CTLRFWSKDGTSRACIRPHTG---RSIWTGDAIIKNGKYLVVTGGNDGAV 973
            L GG V N + IW+            +A +  RL GH G IF +     +G L S  DDRSV LW              D+N     +L GH+ARV+     PG   V + GED  C +  W + G     ++ H     R++     ++ N ++ V TGG DG V
Sbjct:  184 LVGGTVFNQLIIWKTEKKDEHWDSGDKAPVERRLLGHTGVIFSVAYLQEEGFLASASDDRSVRLWGVGALGGPGGK-CGDVNPTCLRVLYGHQARVFLVRLSPG--RVFSAGEDGACLVWDWKEGGKVMRTLKGHRAGGVRALAVSQEMMDNRRW-VATGGADGGV 345          
BLAST of WD repeat-containing protein 6 vs. Ensembl Medaka
Match: wdr6 (WD repeat domain 6 [Source:NCBI gene;Acc:101169360])

HSP 1 Score: 58.151 bits (139), Expect = 5.594e-8
Identity = 77/312 (24.68%), Postives = 119/312 (38.14%), Query Frame = 2
Query: 1910 PCGGGHREWDY-----SVWSDSARLAFIQAQAVNVVSWYGHC-------AQPIVVKPHLHGKEINFCSFIGRGTDI----------------------------VLLTGSEDCSLAVITM-TADCILQSVQRIHGHISSVRCVSEL----------PTGDLMVSAGGRGQI------IFWQRCLRDYSLRSIASALLP------------KLVNIDTDSRIMDICPIPHDIQQIVI-IADSCGSLTFLCLPPGFNRPQFLYLYRLSQSCITNVAFIN---------SLLVACSTDGKV-YWFPKGLPTTDKS 2605
            PCGGGHR W        +W     L FI+  AV      G           P  ++  +HGK I     +GR   +                            +++TG ED SLAV+ +      ++ +  I  HIS VR V+ +          P   L+VSAGGR QI      I W R     S + I                  K V +D ++R + I  +     ++++ +A S G++    +    N  + L+     Q C+ +VA  +          LL + +TDGK+  W   G+ +TD S
Sbjct:  748 PCGGGHRSWALWLSHTGMWPGYGALVFIKQGAVLTSQPPGKLLGAKAGRTGPRDLREGVHGKGIWCVCRVGRIVGVGHVTQTKCATNNTGNEGGDHERKESFWEIIVTGGEDTSLAVLALHPPSGAVRVLSVITDHISGVRAVTAVRRPHCESESQPLSTLLVSAGGRAQIQSYRLSIGWNRQTLTPSCQVIQVGGHRLDEQWERRRNRWKTVKMDPETRYVSIAVVEESCDRVLLALACSDGAVRLFSVTESKNHIELLWETCHHQRCVLSVATCSLEAVKNDRYKLLFSAATDGKIAVWHLTGVLSTDIS 1059          

HSP 2 Score: 56.225 bits (134), Expect = 2.240e-7
Identity = 52/166 (31.33%), Postives = 73/166 (43.98%), Query Frame = 2
Query:  494 LAGGNVQNLITIWEIPTPFTTVKL-PQASMLSRLAGHKGAIFGIHVNWIDGLLISMGDDRSVILWLAEGGLDLSANTLTDINWLRSTILIGHEARVWGGLSLPGDDTVMAWGED--CTLRFWSKDGTSRACIRPHTG---RSIWTGDAIIKNGKYLVVTGGNDGAV 973
            L GG V N + IW+            +A +  RL GH G IF +     +G L S  DDRSV LW              D+N     +L GH+ARV+     PG   V + GED  C +  W + G     ++ H     R++     ++ N ++ V TGG DG V
Sbjct:  184 LVGGTVFNQLIIWKTEKKDEHWDSGDKAPVERRLLGHTGVIFSVAYLQEEGFLASASDDRSVRLWGVGALGGPGGKC-GDVNPTCLRVLYGHQARVFLVRLSPG--RVFSAGEDGACLVWDWKEGGKVMRTLKGHRAGGVRALAVSQEMMDNRRW-VATGGADGGV 345          
BLAST of WD repeat-containing protein 6 vs. Ensembl Medaka
Match: wdr6 (WD repeat domain 6 [Source:NCBI gene;Acc:101169360])

HSP 1 Score: 58.151 bits (139), Expect = 6.643e-8
Identity = 77/312 (24.68%), Postives = 119/312 (38.14%), Query Frame = 2
Query: 1910 PCGGGHREWDY-----SVWSDSARLAFIQAQAVNVVSWYGHC-------AQPIVVKPHLHGKEINFCSFIGRGTDI----------------------------VLLTGSEDCSLAVITM-TADCILQSVQRIHGHISSVRCVSEL----------PTGDLMVSAGGRGQI------IFWQRCLRDYSLRSIASALLP------------KLVNIDTDSRIMDICPIPHDIQQIVI-IADSCGSLTFLCLPPGFNRPQFLYLYRLSQSCITNVAFIN---------SLLVACSTDGKV-YWFPKGLPTTDKS 2605
            PCGGGHR W        +W     L FI+  AV      G           P  ++  +HGK I     +GR   +                            +++TG ED SLAV+ +      ++ +  I  HIS VR V+ +          P   L+VSAGGR QI      I W R     S + I                  K V +D ++R + I  +     ++++ +A S G++    +    N  + L+     Q C+ +VA  +          LL + +TDGK+  W   G+ +TD S
Sbjct:  748 PCGGGHRSWALWLSHTGMWPGYGALVFIKQGAVLTSQPPGKLLGAKAGRTGPRDLREGVHGKGIWCVCRVGRIVGVGHVTQTKCATNNTGNEGGDHERKESFWEIIVTGGEDTSLAVLALHPPSGAVRVLSVITDHISGVRAVTAVRRPHCESESQPLSTLLVSAGGRAQIQSYRLSIGWNRQTLTPSCQVIQVGGHRLDEQWERRRNRWKTVKMDPETRYVSIAVVEESCDRVLLALACSDGAVRLFSVTESKNHIELLWETCHHQRCVLSVATCSLEAVKNDRYKLLFSAATDGKIAVWHLTGVLSTDIS 1059          

HSP 2 Score: 56.225 bits (134), Expect = 2.116e-7
Identity = 52/166 (31.33%), Postives = 73/166 (43.98%), Query Frame = 2
Query:  494 LAGGNVQNLITIWEIPTPFTTVKL-PQASMLSRLAGHKGAIFGIHVNWIDGLLISMGDDRSVILWLAEGGLDLSANTLTDINWLRSTILIGHEARVWGGLSLPGDDTVMAWGED--CTLRFWSKDGTSRACIRPHTG---RSIWTGDAIIKNGKYLVVTGGNDGAV 973
            L GG V N + IW+            +A +  RL GH G IF +     +G L S  DDRSV LW              D+N     +L GH+ARV+     PG   V + GED  C +  W + G     ++ H     R++     ++ N ++ V TGG DG V
Sbjct:  184 LVGGTVFNQLIIWKTEKKDEHWDSGDKAPVERRLLGHTGVIFSVAYLQEEGFLASASDDRSVRLWGVGALGGPGGKC-GDVNPTCLRVLYGHQARVFLVRLSPG--RVFSAGEDGACLVWDWKEGGKVMRTLKGHRAGGVRALAVSQEMMDNRRW-VATGGADGGV 345          
BLAST of WD repeat-containing protein 6 vs. Ensembl Medaka
Match: rrp9 (ribosomal RNA processing 9, U3 small nucleolar RNA binding protein [Source:NCBI gene;Acc:101165385])

HSP 1 Score: 51.9878 bits (123), Expect = 3.148e-6
Identity = 54/189 (28.57%), Postives = 79/189 (41.80%), Query Frame = 2
Query:  407 GEVGTADKSLLYCCHLFRNPVVDIVNNLFLAGGNVQNLITIWEIPTPFTTVKLPQASMLSRLAGHKGAIFGIHVNWIDGLLISMGDDRSVILWLAEGGLDLSANTLTDINWLRSTILIGHEARVWGGLSLPGDDTVMAWGEDCTLRFWSKDGTSRACIRPHTGRSIWTGDAIIKNGKYLVVTGGNDGAV 973
            G  GT ++ + +  H+    +    +  +LA G+   LI IWE  T            L +  GHKG + G+        L S   DRSV +W     +D +A   T         L GH+  + G  SL  +  V A G D T+R W     S+     H G SI   D I    +  ++TG +DG+V
Sbjct:  191 GRKGTEERHVGHTAHILCMALSS--DGKYLASGDTNKLIMIWEGET---------CKHLYKFTGHKGPVSGLSFRKGTHDLYSASHDRSVKVW----NVDENAYVET---------LFGHQDAITGLDSLSRERCVTAGGRDGTVRVWKIAEESQLVFHGHEG-SI---DCIQLINEEHMITGADDGSV 351          
BLAST of WD repeat-containing protein 6 vs. Planmine SMEST
Match: SMESG000001835.1 (SMESG000001835.1)

HSP 1 Score: 1849.33 bits (4789), Expect = 0.000e+0
Identity = 957/1019 (93.92%), Postives = 961/1019 (94.31%), Query Frame = 2
Query:   20 MKFLPVTCVKFMANSSQILSASGNEINLLDYKHKTVVDVQSIKNLKVIHGIELKDDIVIIYGGFVFCIFVLIDNKIRFTNIFQRHDDFILACMIYFYQEDKIKFSISLAHGSTHFYSFRTGVNQKLEELGEVGTADKSLLYCCHLFRNPVVDIVNNLFLAGGNVQNLITIWEIPTPFTTVKLPQASMLSRLAGHKGAIFGIHVNWIDGLLISMGDDRSVILWLAEGGLDLSANTLTDINWLRSTILIGHEARVWGGLSLPGDDTVMAWGEDCTLRFWSKDGTSRACIRPHTGRSIWTGDAIIKNGKYLVVTGGNDGAVVVSEYARSPEKHQAVDSFRVDGDCKDFARRLIILEKGLILVVTDFGIFYLIREQEREKSGRQSMMERVNCDIADDLLNHYCFMFAHNAHRVVLLGNASGQLFVTKLKFTESGSPNLITLETFKLGHKIMAIGAFIDTDTLVSLNNGQMVRVVRHSADKFNIFDLLTVTGDGWAACWTQWWRQEGCQQVLHLVCGDRDGWLHAFQLAGKSDSQPQLIATSKRKLSEKSGITCLLWHEQHQRIYVGTKSGDVFSXXXXXXXXXXXXXRNPDMIGWTCRIESSGDELIITGFKSILFRRLAVHSSGQHPIVLIERPCGGGHREWDYSVWSDSARLAFIQAQAVNVVSWYGHCAQPIVVKPHLHGKEINFCSFIGRGTDIVLLTGSEDCSLAVITMTADCILQSVQRIHGHISSVRCVSELPTGDLMVSAGGRGQIIFWQRCLRDYSLRSIASALLPKLVNIDTDSRIMDICPIPHDIQQIVIIADSCGSLTFLCLPPGFNRPQFLYLYRLSQSCITNVAFINSLLVACSTDGKVYWFPKGLPTTDKSEHKAQQIGKSGLQGMDVLSFXXXXXXXXXXXXXXXXXXXXXXXXXXXADWDLTSSCVHSDGHSGSTVSTKWLPGDDANKWLTSLGSDGWLILWRTSINENVVILSMIRCISPSVGVTDPHTMAVTRHPFYQSRFLFCVAGMGAHIFEFDLGSEELFL 3076
            MKFLPVTCVKFMANSSQILSAS NEINLLDYKHKTVVDVQSIKNLKV+                                                  EDKIKFSISLAHGSTHFYSFRTGVNQKLEELGEVGTADKSLLYCCHLFRNP VDIVNNLFLAGGNVQNLITIWEIPTPFTT KLPQASMLSRLAGHKGAIFGIHVNWIDGLLISMGDDRSVILWLAEGGLD+SANTLTDINW+RSTILIGHEARVWGGLSLPGDDTVMAWGEDCTLRFWSKDGTSRACIRPHTGRSIWTGDAIIKNGKYLVVTGGNDGAVVVSEYARSPEKHQAVDSFRVDGDCKDFARRLIILEKGLILVVTDFGIFYLIREQEREKSG QSMMERVNCDIADDLLNHYCFMFAHNAHRVVLLGNASGQLFVTKLKFTESGSPNLITL+TFKLGHKIMAIGAFIDTDTLVSLNNGQMVRVVRHSADKFNI DLLTVTGDGWAACWTQWWRQEGCQQVLHLVCGDRDGWLHAFQLAGKSDSQPQLIATSKRKLSEKSGITCLLWHEQHQRIYVGTKSGDVFSLDGDGLDKDVVVLRNPDMIGWTCRIESSGDELIITGFKSILFRRLAVHSSGQHPIVLIERPCGGGHREWDYSVWSDSARLAFIQAQAVNVVSWYGHCAQPIVVKPHLHGKEINFCSFIGRGTDIVLLTGSEDCSLAVITMT DCILQSVQRIHGHISSVRCVSELPTGDLMVSAGGRGQIIFWQRCLRDYSLRSIASALLPKLVNIDTDSRIMDICPIPHDIQQIVIIADSCGSLTFLCLPPG NRPQFLYLYRLSQSCITNVAFINSLLVACSTDGKVYWFPKGLPTTDKSEHKAQQIGKSGLQGMDVLSFDLSGSVILVSVGGDDGSVSVVKIDKVG DWDLTSSCVHSDGHSGSTVSTKWLPGDDANKWLTSLGSDGWLILWRTSINENVVILSMIRCISPSVGVTDPHTMAVTRHPFYQSRFLFCVAGMGAHIFEFDLGSEELFL
Sbjct:    1 MKFLPVTCVKFMANSSQILSASDNEINLLDYKHKTVVDVQSIKNLKVMD-----------------------------------------------LSEDKIKFSISLAHGSTHFYSFRTGVNQKLEELGEVGTADKSLLYCCHLFRNPAVDIVNNLFLAGGNVQNLITIWEIPTPFTTAKLPQASMLSRLAGHKGAIFGIHVNWIDGLLISMGDDRSVILWLAEGGLDMSANTLTDINWVRSTILIGHEARVWGGLSLPGDDTVMAWGEDCTLRFWSKDGTSRACIRPHTGRSIWTGDAIIKNGKYLVVTGGNDGAVVVSEYARSPEKHQAVDSFRVDGDCKDFARRLIILEKGLILVVTDFGIFYLIREQEREKSGGQSMMERVNCDIADDLLNHYCFMFAHNAHRVVLLGNASGQLFVTKLKFTESGSPNLITLKTFKLGHKIMAIGAFIDTDTLVSLNNGQMVRVVRHSADKFNICDLLTVTGDGWAACWTQWWRQEGCQQVLHLVCGDRDGWLHAFQLAGKSDSQPQLIATSKRKLSEKSGITCLLWHEQHQRIYVGTKSGDVFSLDGDGLDKDVVVLRNPDMIGWTCRIESSGDELIITGFKSILFRRLAVHSSGQHPIVLIERPCGGGHREWDYSVWSDSARLAFIQAQAVNVVSWYGHCAQPIVVKPHLHGKEINFCSFIGRGTDIVLLTGSEDCSLAVITMTTDCILQSVQRIHGHISSVRCVSELPTGDLMVSAGGRGQIIFWQRCLRDYSLRSIASALLPKLVNIDTDSRIMDICPIPHDIQQIVIIADSCGSLTFLCLPPGSNRPQFLYLYRLSQSCITNVAFINSLLVACSTDGKVYWFPKGLPTTDKSEHKAQQIGKSGLQGMDVLSFDLSGSVILVSVGGDDGSVSVVKIDKVGGDWDLTSSCVHSDGHSGSTVSTKWLPGDDANKWLTSLGSDGWLILWRTSINENVVILSMIRCISPSVGVTDPHTMAVTRHPFYQSRFLFCVAGMGAHIFEFDLGSEELFL 972          
BLAST of WD repeat-containing protein 6 vs. Planmine SMEST
Match: SMESG000001845.1 (SMESG000001845.1)

HSP 1 Score: 1692.94 bits (4383), Expect = 0.000e+0
Identity = 872/904 (96.46%), Postives = 882/904 (97.57%), Query Frame = 2
Query:  365 YSFRTGVNQKLEELGEVGTADKSLLYCCHLFRNPVVDIVNNLFLAGGNVQNLITIWEIPTPFTTVKLPQASMLSRLAGHKGAIFGIHVNWIDGLLISMGDDRSVILWLAEGGLDLSANTLTDINWLRSTILIGHEARVWGGLSLPGDDTVMAWGEDCTLRFWSKDGTSRACIRPHTGRSIWTGDAIIKNGKYLVVTGGNDGAVVVSEYARSPEKHQAVDSFRVDGDCKDFARRLIILEKGLILVVTDFGIFYLIREQEREKSGRQSMMERVNCDIADDLLNHYCFMFAHNAHRVVLLGNASGQLFVTKLKFTESGSPNLITLETFKLGHKIMAIGAFIDTDTLVSLNNGQMVRVVRHSADKFNIFDLLTVTGDGWAACWTQWWRQEGCQQVLHLVCGDRDGWLHAFQLAGKSDSQPQLIATSKRKLSEKSGITCLLWHEQHQRIYVGTKSGDVFSXXXXXXXXXXXXXRNPDMIGWTCRIESSGDELIITGFKSILFRRLAVHSSGQHPIVLIERPCGGGHREWDYSVWSDSARLAFIQAQAVNVVSWYGHCAQPIVVKPHLHGKEINFCSFIGRGTDIVLLTGSEDCSLAVITMTADCILQSVQRIHGHISSVRCVSELPTGDLMVSAGGRGQIIFWQRCLRDYSLRSIASALLPKLVNIDTDSRIMDICPIPHDIQQIVIIADSCGSLTFLCLPPGFNRPQFLYLYRLSQSCITNVAFINSLLVACSTDGKVYWFPKGLPTTDKSEHKAQQIGKSGLQGMDVLSFXXXXXXXXXXXXXXXXXXXXXXXXXXXADWDLTSSCVHSDGHSGSTVSTKWLPGDDANKWLTSLGSDGWLILWRTSINENVVILSMIRCISPSVGVTDPHTMAVTRHPFYQSRFLFCVAGMGAHIFEFDLGSEELFL 3076
            Y  +T V+  ++ +  +   D S+L   HLFRNP VDIVNNLFLAGGNVQNLITIWEIPTPFTT KLPQASMLSRLAGHKGAIFGIHVNWIDGLLISMGDDRSVILWLAEGGLD+SANTLTDINW+RSTILIGHEARVWGGLSLPGDDTVMAWGEDCTLRFWSKDGTSRACIRPHTGRSIWTGDAIIKNGKYLVVTGGNDGAVVVSEYARSPEKHQAVDSFRVDGDCKDFARRLIILEKGLILVVTDFGIFYLIREQEREKSG QSMMERVNCDIADDLLNHYCFMFAHNAHRVVLLGNASGQLFVTKLKFTESGSPNLITL+TFKLGHKIMAIGAFIDTDTLVSLNNGQMVRVVRHSADKFNI DLLTVTGDGWAACWTQWWRQEGCQQVLHLVCGDRDGWLHAFQLAGKSDSQPQLIATSKRKLSEKSGITCLLWHEQHQRIYVGTKSGDVFSLDGDGLDKDVVVLRNPDMIGWTCRIESSGDELIITGFKSILFRRLAVHSSGQHPIVLIERPCGGGHREWDYSVWSDSARLAFIQAQAVNVVSWYGHCAQPIVVKPHLHGKEINFCSFIGRGTDIVLLTGSEDCSLAVITMT DCILQSVQRIHGHISSVRCVSELPTGDLMVSAGGRGQIIFWQRCLRDYSLRSIASALLPKLVNIDTDSRIMDICPIPHDIQQIVIIADSCGSLTFLCLPPG NRPQFLYLYRLSQSCITNVAFINSLLVACSTDGKVYWFPKGLPTTDKSEHKAQQIGKSGLQGMDVLSFDLSGSVILVSVGGDDGSVSVVKIDKVG DWDLTSSCVHSDGHSGSTVSTKWLPGDDANKWLTSLGSDGWLILWRTSINENVVILSMIRCISPSVGVTDPHTMAVTRHPFYQSRFLFCVAGMGAHIFEFDLGSEELFL
Sbjct:   31 YKHKTVVD--VQSIKNLKVMDLSILL--HLFRNPAVDIVNNLFLAGGNVQNLITIWEIPTPFTTAKLPQASMLSRLAGHKGAIFGIHVNWIDGLLISMGDDRSVILWLAEGGLDMSANTLTDINWVRSTILIGHEARVWGGLSLPGDDTVMAWGEDCTLRFWSKDGTSRACIRPHTGRSIWTGDAIIKNGKYLVVTGGNDGAVVVSEYARSPEKHQAVDSFRVDGDCKDFARRLIILEKGLILVVTDFGIFYLIREQEREKSGGQSMMERVNCDIADDLLNHYCFMFAHNAHRVVLLGNASGQLFVTKLKFTESGSPNLITLKTFKLGHKIMAIGAFIDTDTLVSLNNGQMVRVVRHSADKFNICDLLTVTGDGWAACWTQWWRQEGCQQVLHLVCGDRDGWLHAFQLAGKSDSQPQLIATSKRKLSEKSGITCLLWHEQHQRIYVGTKSGDVFSLDGDGLDKDVVVLRNPDMIGWTCRIESSGDELIITGFKSILFRRLAVHSSGQHPIVLIERPCGGGHREWDYSVWSDSARLAFIQAQAVNVVSWYGHCAQPIVVKPHLHGKEINFCSFIGRGTDIVLLTGSEDCSLAVITMTTDCILQSVQRIHGHISSVRCVSELPTGDLMVSAGGRGQIIFWQRCLRDYSLRSIASALLPKLVNIDTDSRIMDICPIPHDIQQIVIIADSCGSLTFLCLPPGSNRPQFLYLYRLSQSCITNVAFINSLLVACSTDGKVYWFPKGLPTTDKSEHKAQQIGKSGLQGMDVLSFDLSGSVILVSVGGDDGSVSVVKIDKVGGDWDLTSSCVHSDGHSGSTVSTKWLPGDDANKWLTSLGSDGWLILWRTSINENVVILSMIRCISPSVGVTDPHTMAVTRHPFYQSRFLFCVAGMGAHIFEFDLGSEELFL 930          

HSP 2 Score: 95.9005 bits (237), Expect = 1.015e-19
Identity = 47/48 (97.92%), Postives = 48/48 (100.00%), Query Frame = 2
Query:   20 MKFLPVTCVKFMANSSQILSASGNEINLLDYKHKTVVDVQSIKNLKVI 163
            MKFLPVTCVKFMANSSQILSASGNEINLLDYKHKTVVDVQSIKNLKV+
Sbjct:    1 MKFLPVTCVKFMANSSQILSASGNEINLLDYKHKTVVDVQSIKNLKVM 48          
BLAST of WD repeat-containing protein 6 vs. Planmine SMEST
Match: SMESG000001845.1 (SMESG000001845.1)

HSP 1 Score: 1687.16 bits (4368), Expect = 0.000e+0
Identity = 866/876 (98.86%), Postives = 869/876 (99.20%), Query Frame = 2
Query:  449 HLFRNPVVDIVNNLFLAGGNVQNLITIWEIPTPFTTVKLPQASMLSRLAGHKGAIFGIHVNWIDGLLISMGDDRSVILWLAEGGLDLSANTLTDINWLRSTILIGHEARVWGGLSLPGDDTVMAWGEDCTLRFWSKDGTSRACIRPHTGRSIWTGDAIIKNGKYLVVTGGNDGAVVVSEYARSPEKHQAVDSFRVDGDCKDFARRLIILEKGLILVVTDFGIFYLIREQEREKSGRQSMMERVNCDIADDLLNHYCFMFAHNAHRVVLLGNASGQLFVTKLKFTESGSPNLITLETFKLGHKIMAIGAFIDTDTLVSLNNGQMVRVVRHSADKFNIFDLLTVTGDGWAACWTQWWRQEGCQQVLHLVCGDRDGWLHAFQLAGKSDSQPQLIATSKRKLSEKSGITCLLWHEQHQRIYVGTKSGDVFSXXXXXXXXXXXXXRNPDMIGWTCRIESSGDELIITGFKSILFRRLAVHSSGQHPIVLIERPCGGGHREWDYSVWSDSARLAFIQAQAVNVVSWYGHCAQPIVVKPHLHGKEINFCSFIGRGTDIVLLTGSEDCSLAVITMTADCILQSVQRIHGHISSVRCVSELPTGDLMVSAGGRGQIIFWQRCLRDYSLRSIASALLPKLVNIDTDSRIMDICPIPHDIQQIVIIADSCGSLTFLCLPPGFNRPQFLYLYRLSQSCITNVAFINSLLVACSTDGKVYWFPKGLPTTDKSEHKAQQIGKSGLQGMDVLSFXXXXXXXXXXXXXXXXXXXXXXXXXXXADWDLTSSCVHSDGHSGSTVSTKWLPGDDANKWLTSLGSDGWLILWRTSINENVVILSMIRCISPSVGVTDPHTMAVTRHPFYQSRFLFCVAGMGAHIFEFDLGSEELFL 3076
            HLFRNP VDIVNNLFLAGGNVQNLITIWEIPTPFTT KLPQASMLSRLAGHKGAIFGIHVNWIDGLLISMGDDRSVILWLAEGGLD+SANTLTDINW+RSTILIGHEARVWGGLSLPGDDTVMAWGEDCTLRFWSKDGTSRACIRPHTGRSIWTGDAIIKNGKYLVVTGGNDGAVVVSEYARSPEKHQAVDSFRVDGDCKDFARRLIILEKGLILVVTDFGIFYLIREQEREKSG QSMMERVNCDIADDLLNHYCFMFAHNAHRVVLLGNASGQLFVTKLKFTESGSPNLITL+TFKLGHKIMAIGAFIDTDTLVSLNNGQMVRVVRHSADKFNI DLLTVTGDGWAACWTQWWRQEGCQQVLHLVCGDRDGWLHAFQLAGKSDSQPQLIATSKRKLSEKSGITCLLWHEQHQRIYVGTKSGDVFSLDGDGLDKDVVVLRNPDMIGWTCRIESSGDELIITGFKSILFRRLAVHSSGQHPIVLIERPCGGGHREWDYSVWSDSARLAFIQAQAVNVVSWYGHCAQPIVVKPHLHGKEINFCSFIGRGTDIVLLTGSEDCSLAVITMT DCILQSVQRIHGHISSVRCVSELPTGDLMVSAGGRGQIIFWQRCLRDYSLRSIASALLPKLVNIDTDSRIMDICPIPHDIQQIVIIADSCGSLTFLCLPPG NRPQFLYLYRLSQSCITNVAFINSLLVACSTDGKVYWFPKGLPTTDKSEHKAQQIGKSGLQGMDVLSFDLSGSVILVSVGGDDGSVSVVKIDKVG DWDLTSSCVHSDGHSGSTVSTKWLPGDDANKWLTSLGSDGWLILWRTSINENVVILSMIRCISPSVGVTDPHTMAVTRHPFYQSRFLFCVAGMGAHIFEFDLGSEELFL
Sbjct:    9 HLFRNPAVDIVNNLFLAGGNVQNLITIWEIPTPFTTAKLPQASMLSRLAGHKGAIFGIHVNWIDGLLISMGDDRSVILWLAEGGLDMSANTLTDINWVRSTILIGHEARVWGGLSLPGDDTVMAWGEDCTLRFWSKDGTSRACIRPHTGRSIWTGDAIIKNGKYLVVTGGNDGAVVVSEYARSPEKHQAVDSFRVDGDCKDFARRLIILEKGLILVVTDFGIFYLIREQEREKSGGQSMMERVNCDIADDLLNHYCFMFAHNAHRVVLLGNASGQLFVTKLKFTESGSPNLITLKTFKLGHKIMAIGAFIDTDTLVSLNNGQMVRVVRHSADKFNICDLLTVTGDGWAACWTQWWRQEGCQQVLHLVCGDRDGWLHAFQLAGKSDSQPQLIATSKRKLSEKSGITCLLWHEQHQRIYVGTKSGDVFSLDGDGLDKDVVVLRNPDMIGWTCRIESSGDELIITGFKSILFRRLAVHSSGQHPIVLIERPCGGGHREWDYSVWSDSARLAFIQAQAVNVVSWYGHCAQPIVVKPHLHGKEINFCSFIGRGTDIVLLTGSEDCSLAVITMTTDCILQSVQRIHGHISSVRCVSELPTGDLMVSAGGRGQIIFWQRCLRDYSLRSIASALLPKLVNIDTDSRIMDICPIPHDIQQIVIIADSCGSLTFLCLPPGSNRPQFLYLYRLSQSCITNVAFINSLLVACSTDGKVYWFPKGLPTTDKSEHKAQQIGKSGLQGMDVLSFDLSGSVILVSVGGDDGSVSVVKIDKVGGDWDLTSSCVHSDGHSGSTVSTKWLPGDDANKWLTSLGSDGWLILWRTSINENVVILSMIRCISPSVGVTDPHTMAVTRHPFYQSRFLFCVAGMGAHIFEFDLGSEELFL 884          
The following BLAST results are available for this feature:
BLAST of WD repeat-containing protein 6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
WDR64.444e-1023.88WD repeat domain 6 [Source:HGNC Symbol;Acc:HGNC:12... [more]
WDR64.444e-1023.88WD repeat domain 6 [Source:HGNC Symbol;Acc:HGNC:12... [more]
WDR65.494e-1023.88WD repeat domain 6 [Source:HGNC Symbol;Acc:HGNC:12... [more]
WDR69.003e-1026.49WD repeat domain 6 [Source:HGNC Symbol;Acc:HGNC:12... [more]
back to top
BLAST of WD repeat-containing protein 6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD repeat-containing protein 6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG331723.968e-1026.15gene:FBgn0053172 transcript:FBtr0308092[more]
back to top
BLAST of WD repeat-containing protein 6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
wdr62.141e-926.38WD repeat domain 6 [Source:ZFIN;Acc:ZDB-GENE-08110... [more]
wdr62.220e-926.38WD repeat domain 6 [Source:ZFIN;Acc:ZDB-GENE-08110... [more]
back to top
BLAST of WD repeat-containing protein 6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
basp15.990e-1825.19brain abundant membrane attached signal protein 1 ... [more]
back to top
BLAST of WD repeat-containing protein 6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Wdr69.169e-1327.91WD repeat domain 6 [Source:MGI Symbol;Acc:MGI:1930... [more]
back to top
BLAST of WD repeat-containing protein 6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5XFW6|WDR6_RAT7.108e-1723.43WD repeat-containing protein 6 OS=Rattus norvegicu... [more]
sp|Q99ME2|WDR6_MOUSE6.414e-1227.91WD repeat-containing protein 6 OS=Mus musculus OX=... [more]
sp|Q08924|WDR6_YEAST7.730e-1223.58Regulator of Ty1 transposition protein 10 OS=Sacch... [more]
sp|Q9USZ0|WDR6_SCHPO8.740e-1124.01Uncharacterized WD repeat-containing protein C1306... [more]
sp|Q5RB07|WDR6_PONAB4.501e-923.36WD repeat-containing protein 6 OS=Pongo abelii OX=... [more]
back to top
BLAST of WD repeat-containing protein 6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2J7PV438.445e-4323.18WD_REPEATS_REGION domain-containing protein OS=Cry... [more]
A0A2J7PV315.019e-4123.24WD_REPEATS_REGION domain-containing protein OS=Cry... [more]
T1JG632.466e-3725.98WD_REPEATS_REGION domain-containing protein OS=Str... [more]
A0A067R4E25.611e-3524.55WD_REPEATS_REGION domain-containing protein (Fragm... [more]
A0A3L8D9J61.263e-3124.14WD_REPEATS_REGION domain-containing protein OS=Ooc... [more]
back to top
BLAST of WD repeat-containing protein 6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
wdr62.516e-627.85WD repeat domain 6 [Source:ZFIN;Acc:ZDB-GENE-08110... [more]
wdr62.689e-627.85WD repeat domain 6 [Source:ZFIN;Acc:ZDB-GENE-08110... [more]
back to top
BLAST of WD repeat-containing protein 6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD repeat-containing protein 6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
RTT101.191e-1323.58WD40 domain-containing protein involved in endosom... [more]
back to top
BLAST of WD repeat-containing protein 6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD repeat-containing protein 6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr65.205e-824.68WD repeat domain 6 [Source:NCBI gene;Acc:101169360... [more]
wdr65.279e-824.68WD repeat domain 6 [Source:NCBI gene;Acc:101169360... [more]
wdr65.594e-824.68WD repeat domain 6 [Source:NCBI gene;Acc:101169360... [more]
wdr66.643e-824.68WD repeat domain 6 [Source:NCBI gene;Acc:101169360... [more]
rrp93.148e-628.57ribosomal RNA processing 9, U3 small nucleolar RNA... [more]
back to top
BLAST of WD repeat-containing protein 6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000001835.10.000e+093.92SMESG000001835.1[more]
SMESG000001845.11.015e-1996.46SMESG000001845.1[more]
SMESG000001845.10.000e+098.86SMESG000001845.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011023 ID=SMED30011023|Name=WD repeat-containing protein 6|organism=Schmidtea mediterranea sexual|type=transcript|length=3528bp
TAAATCTTCGATAATCTAAATGAAATTTCTACCAGTAACTTGCGTCAAAT
TTATGGCTAATTCAAGCCAAATTTTATCAGCTTCTGGCAACGAAATAAAT
CTGCTTGATTATAAACATAAAACAGTTGTAGATGTACAATCAATAAAAAA
TTTAAAAGTTATTCATGGAATTGAGTTGAAAGACGACATTGTGATTATTT
ACGGGGGATTTGTGTTCTGCATTTTCGTGTTGATTGACAACAAGATAAGA
TTTACAAATATCTTTCAACGCCATGACGATTTTATTCTAGCTTGTATGAT
TTATTTTTACCAAGAAGATAAGATTAAGTTCAGCATTTCATTGGCACATG
GATCGACACATTTCTACTCGTTTCGGACAGGTGTAAACCAGAAATTGGAA
GAACTTGGCGAAGTAGGCACAGCGGATAAATCACTGCTATATTGCTGCCA
TTTGTTCCGTAATCCCGTAGTAGACATCGTCAATAATCTATTTTTAGCCG
GTGGCAATGTCCAGAATCTGATCACTATCTGGGAAATACCGACACCTTTT
ACCACCGTTAAATTACCACAGGCGTCCATGTTGTCGAGATTGGCTGGTCA
TAAGGGCGCTATATTCGGAATTCACGTGAATTGGATTGATGGACTGCTTA
TCTCCATGGGTGACGACCGCTCGGTCATTCTCTGGCTGGCCGAAGGTGGG
CTTGACTTGTCTGCTAATACACTAACTGACATCAATTGGCTGAGATCGAC
TATTCTCATTGGCCATGAAGCAAGAGTTTGGGGTGGGCTGAGTCTGCCTG
GGGATGACACAGTGATGGCCTGGGGGGAAGACTGCACACTCCGATTCTGG
TCAAAGGACGGCACAAGTCGAGCTTGTATTCGGCCGCATACTGGCCGTAG
CATTTGGACTGGGGATGCCATTATCAAGAATGGGAAATATCTGGTTGTCA
CTGGTGGCAATGACGGTGCGGTCGTCGTGTCAGAATACGCAAGGAGTCCT
GAGAAACATCAAGCAGTAGATAGCTTTCGAGTTGATGGAGATTGCAAGGA
TTTTGCGAGACGGTTGATTATTTTGGAGAAGGGACTGATCCTCGTTGTGA
CTGACTTCGGGATTTTTTACCTGATCCGAGAACAGGAACGGGAGAAAAGT
GGTAGGCAATCCATGATGGAAAGGGTCAATTGCGACATCGCAGATGATCT
ACTCAATCATTATTGCTTTATGTTCGCTCATAACGCACATCGAGTAGTGC
TACTAGGCAACGCATCAGGCCAGCTGTTCGTCACGAAACTGAAATTCACT
GAAAGCGGCTCGCCAAATCTTATCACATTGGAAACATTCAAACTAGGTCA
TAAAATCATGGCTATCGGGGCCTTTATCGATACGGACACGTTGGTATCTC
TGAACAATGGACAGATGGTTCGAGTTGTTAGGCATTCAGCAGATAAGTTT
AACATTTTTGATCTTCTTACTGTGACTGGCGATGGATGGGCAGCTTGCTG
GACTCAATGGTGGAGACAAGAAGGTTGTCAGCAGGTGCTCCATCTGGTCT
GTGGTGATCGAGACGGATGGTTGCATGCTTTCCAATTGGCGGGAAAGTCG
GACTCGCAGCCTCAACTAATCGCTACCAGCAAGAGAAAGCTGAGCGAGAA
ATCTGGCATCACTTGTTTATTGTGGCACGAGCAGCATCAGCGAATTTATG
TCGGTACGAAATCTGGAGATGTTTTCTCATTGGATGGCGACGGCCTTGAC
AAGGATGTGGTTGTGCTGAGGAATCCCGATATGATCGGCTGGACGTGTCG
TATCGAGTCATCTGGGGACGAGCTGATCATCACCGGGTTCAAATCGATTC
TGTTCCGCCGGCTCGCTGTTCATAGCAGTGGCCAGCATCCAATCGTGCTT
ATTGAGCGGCCTTGTGGCGGCGGGCACAGAGAGTGGGACTACTCGGTTTG
GTCGGACAGCGCCAGATTGGCATTCATTCAGGCCCAGGCAGTCAATGTGG
TCAGCTGGTACGGCCATTGTGCTCAGCCGATAGTTGTCAAGCCGCATCTC
CACGGGAAAGAAATCAATTTCTGCTCATTCATTGGCAGGGGGACCGACAT
TGTCTTGTTGACTGGGTCCGAGGATTGCAGCCTGGCAGTGATTACCATGA
CAGCTGACTGCATTTTGCAGTCGGTTCAGCGAATTCATGGGCACATCTCG
AGTGTGCGCTGTGTGAGTGAGCTCCCAACCGGTGACCTGATGGTGTCGGC
TGGAGGCCGAGGCCAAATCATATTTTGGCAGCGGTGCCTTCGAGATTACT
CATTGCGGTCCATTGCAAGCGCCCTCCTGCCGAAACTGGTTAATATCGAC
ACGGATTCCCGCATCATGGACATTTGTCCTATCCCTCATGACATCCAGCA
AATCGTGATTATCGCTGACTCGTGTGGCTCCCTTACGTTCCTCTGCCTTC
CTCCTGGCTTCAACCGGCCTCAGTTTTTGTACTTATACAGGCTCAGTCAA
TCCTGCATTACCAATGTCGCTTTCATCAATTCCTTGCTAGTCGCCTGCTC
AACGGATGGCAAGGTCTACTGGTTCCCCAAAGGTTTACCGACTACCGACA
AATCCGAGCATAAAGCCCAACAGATTGGCAAAAGTGGACTGCAAGGAATG
GACGTCTTGTCATTCGATCTTTCAGGTTCTGTCATATTAGTGAGTGTTGG
AGGAGATGATGGATCCGTATCAGTCGTCAAAATCGATAAGGTTGGTGCTG
ATTGGGATCTGACCAGCAGTTGTGTGCATTCAGATGGCCATTCTGGCAGT
ACAGTCTCTACTAAGTGGCTTCCGGGTGATGATGCCAATAAGTGGCTGAC
GTCTCTTGGTTCTGATGGATGGCTTATCCTGTGGAGGACAAGCATCAATG
AGAATGTCGTTATATTGTCAATGATCCGCTGCATCAGTCCGTCAGTTGGT
GTTACGGACCCTCATACAATGGCTGTCACTCGCCATCCCTTCTATCAATC
AAGATTTCTGTTTTGTGTCGCCGGCATGGGAGCTCACATATTCGAATTTG
ATCTCGGTTCAGAAGAATTATTTTTATAAATATATTTCACACTTTTATGG
CCTGTTAATTTGATAATAAATCATGGGTACCAATATGGCACCGATGCTGG
ACTTCAGTCTCATCATTTTTTATTGTGGATCGGCCTTCTAGTTCGTTAAT
TATGCTCGGTCTATAATTGAATCTCTGATTTGCTCAATCGTAATGTCAGT
TTCGCCATCTCTTTCAAATGCTATGATATCATTAGTGAAATTTCATTCGT
ATTTCTATTTCAAGCGTTATTCTTAATAAGATAATATCTGGCTTTCTAAT
TTAAAAAAGTAACTCGAAGAATTTAATAAAACTTGCATCATCAAGAATTA
TTTCCGCAAGTTTTAGTTAATTATTTATGTTAGCCTAGAAGTCTCCTGGC
GAAAACGTTTTTTAAATATTATTTTTTCCTATGCATATTCTATTAGTATT
CATTTTATTCGTCAGGTGGAAAACTGAT
back to top

protein sequence of SMED30011023-orf-1

>SMED30011023-orf-1 ID=SMED30011023-orf-1|Name=SMED30011023-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1020bp
MKFLPVTCVKFMANSSQILSASGNEINLLDYKHKTVVDVQSIKNLKVIHG
IELKDDIVIIYGGFVFCIFVLIDNKIRFTNIFQRHDDFILACMIYFYQED
KIKFSISLAHGSTHFYSFRTGVNQKLEELGEVGTADKSLLYCCHLFRNPV
VDIVNNLFLAGGNVQNLITIWEIPTPFTTVKLPQASMLSRLAGHKGAIFG
IHVNWIDGLLISMGDDRSVILWLAEGGLDLSANTLTDINWLRSTILIGHE
ARVWGGLSLPGDDTVMAWGEDCTLRFWSKDGTSRACIRPHTGRSIWTGDA
IIKNGKYLVVTGGNDGAVVVSEYARSPEKHQAVDSFRVDGDCKDFARRLI
ILEKGLILVVTDFGIFYLIREQEREKSGRQSMMERVNCDIADDLLNHYCF
MFAHNAHRVVLLGNASGQLFVTKLKFTESGSPNLITLETFKLGHKIMAIG
AFIDTDTLVSLNNGQMVRVVRHSADKFNIFDLLTVTGDGWAACWTQWWRQ
EGCQQVLHLVCGDRDGWLHAFQLAGKSDSQPQLIATSKRKLSEKSGITCL
LWHEQHQRIYVGTKSGDVFSLDGDGLDKDVVVLRNPDMIGWTCRIESSGD
ELIITGFKSILFRRLAVHSSGQHPIVLIERPCGGGHREWDYSVWSDSARL
AFIQAQAVNVVSWYGHCAQPIVVKPHLHGKEINFCSFIGRGTDIVLLTGS
EDCSLAVITMTADCILQSVQRIHGHISSVRCVSELPTGDLMVSAGGRGQI
IFWQRCLRDYSLRSIASALLPKLVNIDTDSRIMDICPIPHDIQQIVIIAD
SCGSLTFLCLPPGFNRPQFLYLYRLSQSCITNVAFINSLLVACSTDGKVY
WFPKGLPTTDKSEHKAQQIGKSGLQGMDVLSFDLSGSVILVSVGGDDGSV
SVVKIDKVGADWDLTSSCVHSDGHSGSTVSTKWLPGDDANKWLTSLGSDG
WLILWRTSINENVVILSMIRCISPSVGVTDPHTMAVTRHPFYQSRFLFCV
AGMGAHIFEFDLGSEELFL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003824catalytic activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 630..667
e-value: 8.5
score: 11.1
coord: 529..568
e-value: 0.035
score: 23.3
coord: 483..523
e-value: 100.0
score: 4.2
coord: 1..37
e-value: 150.0
score: 3.2
coord: 344..386
e-value: 31.0
score: 7.6
coord: 729..770
e-value: 38.0
score: 7.0
coord: 53..92
e-value: 2.1
score: 14.9
coord: 94..136
e-value: 180.0
score: 2.8
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 5..36
score: 9.071
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 536..568
score: 9.105
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 608..771
e-value: 6.6E-7
score: 30.5
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 1..159
e-value: 4.3E-13
score: 50.6
NoneNo IPR availablePANTHERPTHR14344WD REPEAT PROTEINcoord: 2..825
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 5..101
score: 8.624
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 483..781
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 4..423