acetolactate synthase-like protein

Overview
Nameacetolactate synthase-like protein
Smed IDSMED30011014
Length (bp)830
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of acetolactate synthase-like protein (SMED30011014) t-SNE clustered cells

Violin plots show distribution of expression levels for acetolactate synthase-like protein (SMED30011014) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011014

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30011014h1SMcG0019159 Contig4902uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30011014h1SMcG0019159 Contig4902newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30011014h1SMcG0020405 Contig4902uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30011014h1SMcG0020405 Contig4902newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
X2 cellSMED30011014h1SMcG0019159 SmedASXL_076483SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
gutSMED30011014h1SMcG0019159 dd_Smed_v4_1784_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30011014h1SMcG0019159 dd_Smed_v4_1784_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of acetolactate synthase-like protein vs. Ensembl Human
Match: ILVBL (ilvB acetolactate synthase like [Source:HGNC Symbol;Acc:HGNC:6041])

HSP 1 Score: 229.565 bits (584), Expect = 1.941e-74
Identity = 122/216 (56.48%), Postives = 157/216 (72.69%), Query Frame = 3
Query:   60 HISKFIKTIFAQVKTGSAEHGGLIVAEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFPIDTLYPYNLVRREMGISPHPRNIKQRVVN*ND*INWIFYN 707
            H       +  +V   S  HGG  VA VL+ H V+ IFTL GGHISP+L+A EK GI+V+D RHE  AVFAADA+AR++G++GV AVTAGPGLTNTVTA+KNAQMA+SP+LLLGGAA+++L+ RGALQ +DQ+ LF+PLCK+  +V R+ DI P LR A+  AQS TPGPVFVE P+D LYPY +V++EM  +  P+ +  RVV      +W   N
Sbjct:   34 HRLGLFYQLLHKVDKASVRHGGENVAAVLRAHGVRFIFTLVGGHISPLLVACEKLGIRVVDTRHEVTAVFAADAMARLSGTVGVAAVTAGPGLTNTVTAVKNAQMAQSPILLLGGAASTLLQNRGALQAVDQLSLFRPLCKFCVSVRRVRDIVPTLRAAMAAAQSGTPGPVFVELPVDVLYPYFMVQKEMVPAKPPKGLVGRVV------SWYLEN 243          
BLAST of acetolactate synthase-like protein vs. Ensembl Human
Match: ILVBL (ilvB acetolactate synthase like [Source:HGNC Symbol;Acc:HGNC:6041])

HSP 1 Score: 228.409 bits (581), Expect = 7.062e-70
Identity = 122/216 (56.48%), Postives = 157/216 (72.69%), Query Frame = 3
Query:   60 HISKFIKTIFAQVKTGSAEHGGLIVAEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFPIDTLYPYNLVRREMGISPHPRNIKQRVVN*ND*INWIFYN 707
            H       +  +V   S  HGG  VA VL+ H V+ IFTL GGHISP+L+A EK GI+V+D RHE  AVFAADA+AR++G++GV AVTAGPGLTNTVTA+KNAQMA+SP+LLLGGAA+++L+ RGALQ +DQ+ LF+PLCK+  +V R+ DI P LR A+  AQS TPGPVFVE P+D LYPY +V++EM  +  P+ +  RVV      +W   N
Sbjct:   34 HRLGLFYQLLHKVDKASVRHGGENVAAVLRAHGVRFIFTLVGGHISPLLVACEKLGIRVVDTRHEVTAVFAADAMARLSGTVGVAAVTAGPGLTNTVTAVKNAQMAQSPILLLGGAASTLLQNRGALQAVDQLSLFRPLCKFCVSVRRVRDIVPTLRAAMAAAQSGTPGPVFVELPVDVLYPYFMVQKEMVPAKPPKGLVGRVV------SWYLEN 243          
BLAST of acetolactate synthase-like protein vs. Ensembl Human
Match: ILVBL (ilvB acetolactate synthase like [Source:HGNC Symbol;Acc:HGNC:6041])

HSP 1 Score: 167.933 bits (424), Expect = 1.218e-51
Identity = 78/127 (61.42%), Postives = 103/127 (81.10%), Query Frame = 3
Query:  294 TGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFPIDTLYPYNLVRREMGISPHPRNIKQRVVN 674
            +G++GV AVTAGPGLTNTVTA+KNAQMA+SP+LLLGGAA+++L+ RGALQ +DQ+ LF+PLCK+  +V R+ DI P LR A+  AQS TPGPVFVE P+D LYPY +V++EM  +  P+ +  RVV+
Sbjct:    5 SGTVGVAAVTAGPGLTNTVTAVKNAQMAQSPILLLGGAASTLLQNRGALQAVDQLSLFRPLCKFCVSVRRVRDIVPTLRAAMAAAQSGTPGPVFVELPVDVLYPYFMVQKEMVPAKPPKGLVGRVVS 131          
BLAST of acetolactate synthase-like protein vs. Ensembl Human
Match: ILVBL (ilvB acetolactate synthase like [Source:HGNC Symbol;Acc:HGNC:6041])

HSP 1 Score: 167.162 bits (422), Expect = 1.752e-47
Identity = 78/127 (61.42%), Postives = 103/127 (81.10%), Query Frame = 3
Query:  294 TGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFPIDTLYPYNLVRREMGISPHPRNIKQRVVN 674
            +G++GV AVTAGPGLTNTVTA+KNAQMA+SP+LLLGGAA+++L+ RGALQ +DQ+ LF+PLCK+  +V R+ DI P LR A+  AQS TPGPVFVE P+D LYPY +V++EM  +  P+ +  RVV+
Sbjct:    5 SGTVGVAAVTAGPGLTNTVTAVKNAQMAQSPILLLGGAASTLLQNRGALQAVDQLSLFRPLCKFCVSVRRVRDIVPTLRAAMAAAQSGTPGPVFVELPVDVLYPYFMVQKEMVPAKPPKGLVGRVVS 131          
BLAST of acetolactate synthase-like protein vs. Ensembl Human
Match: ILVBL (ilvB acetolactate synthase like [Source:HGNC Symbol;Acc:HGNC:6041])

HSP 1 Score: 149.058 bits (375), Expect = 3.499e-44
Identity = 81/122 (66.39%), Postives = 102/122 (83.61%), Query Frame = 3
Query:   93 QVKTGSAEHGGLIVAEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQM 458
            +V   S  HGG  VA VL+ H V+ IFTL GGHISP+L+A EK GI+V+D RHE  AVFAADA+AR++G++GV AVTAGPGLTNTVTA+KNAQMA+SP+LLLGGAA+++L+ RGALQ +DQ+
Sbjct:   45 KVDKASVRHGGENVAAVLRAHGVRFIFTLVGGHISPLLVACEKLGIRVVDTRHEVTAVFAADAMARLSGTVGVAAVTAGPGLTNTVTAVKNAQMAQSPILLLGGAASTLLQNRGALQAVDQL 166          
BLAST of acetolactate synthase-like protein vs. Ensembl Celegans
Match: T26C12.1 (Acetolactate synthase-like protein [Source:UniProtKB/Swiss-Prot;Acc:O61856])

HSP 1 Score: 252.292 bits (643), Expect = 2.119e-79
Identity = 130/194 (67.01%), Postives = 156/194 (80.41%), Query Frame = 3
Query:   93 QVKTGSAEHGGLIVAEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFPIDTLYPYNLVRREMGISPHPRNIKQRVVN 674
            QV   S  HGG +VA VLK H+V+ IF LCGGHISPIL+AAEK GI+++D RHE  AVFAADAVAR+  SIGV AVTAGPGLTNT+TA+KNAQMAESP+LL+GGAA ++LKGRGALQDIDQM LF+PLCKY   V R+ DI P +REAI+ A+S  PGPVFVEFP+D LYPY LV +E+G +P+ +   QR +N
Sbjct:   49 QVDEKSKRHGGELVASVLKAHDVEEIFVLCGGHISPILVAAEKLGIKIVDTRHEVTAVFAADAVARLRQSIGVAAVTAGPGLTNTITAVKNAQMAESPLLLIGGAAPTLLKGRGALQDIDQMVLFRPLCKYVARVERLRDIVPTVREAIKAAKSGCPGPVFVEFPVDVLYPYELVVKEIGFNPNAKGFIQRALN 242          
BLAST of acetolactate synthase-like protein vs. Ensembl Celegans
Match: B0334.3 (pep chromosome:WBcel235:II:11489605:11493039:-1 gene:WBGene00007143.1 transcript:B0334.3a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:B0334.3)

HSP 1 Score: 74.7146 bits (182), Expect = 5.649e-15
Identity = 52/161 (32.30%), Postives = 85/161 (52.80%), Query Frame = 3
Query:  105 GSAEHGGLIVAEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFP 587
            GS   G  I A  LK   V+++F + G  +  + +AA+ +GI+ I  R+E  A +AA A+  +TG    + V +GPG+ + +  + NA +   PV+ +GG A   L+ RGA Q+  Q    +  CK+    T +  I   + +A+R A    PG V+V+ P
Sbjct:   69 GSNMDGASITAAALKSQGVEYMFGVVGFPVIEVGMAAQAHGIKYIGCRNEQAAAYAAQAMGYLTGKPVALLVVSGPGILHAIGGLANATVNCWPVVCIGGTADVDLENRGAFQEWSQQESVRNSCKHVSRPTSLHTIPAHIEKAVRCAMYGRPGAVYVDLP 229          
BLAST of acetolactate synthase-like protein vs. Ensembl Celegans
Match: B0334.3 (pep chromosome:WBcel235:II:11489605:11492963:-1 gene:WBGene00007143.1 transcript:B0334.3a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:B0334.3)

HSP 1 Score: 74.7146 bits (182), Expect = 5.649e-15
Identity = 52/161 (32.30%), Postives = 85/161 (52.80%), Query Frame = 3
Query:  105 GSAEHGGLIVAEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFP 587
            GS   G  I A  LK   V+++F + G  +  + +AA+ +GI+ I  R+E  A +AA A+  +TG    + V +GPG+ + +  + NA +   PV+ +GG A   L+ RGA Q+  Q    +  CK+    T +  I   + +A+R A    PG V+V+ P
Sbjct:   69 GSNMDGASITAAALKSQGVEYMFGVVGFPVIEVGMAAQAHGIKYIGCRNEQAAAYAAQAMGYLTGKPVALLVVSGPGILHAIGGLANATVNCWPVVCIGGTADVDLENRGAFQEWSQQESVRNSCKHVSRPTSLHTIPAHIEKAVRCAMYGRPGAVYVDLP 229          
BLAST of acetolactate synthase-like protein vs. Ensembl Celegans
Match: B0334.3 (pep chromosome:WBcel235:II:11489605:11492174:-1 gene:WBGene00007143.1 transcript:B0334.3b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:B0334.3)

HSP 1 Score: 73.1738 bits (178), Expect = 2.105e-14
Identity = 50/156 (32.05%), Postives = 83/156 (53.21%), Query Frame = 3
Query:  120 GGLIVAEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFP 587
            G  I A  LK   V+++F + G  +  + +AA+ +GI+ I  R+E  A +AA A+  +TG    + V +GPG+ + +  + NA +   PV+ +GG A   L+ RGA Q+  Q    +  CK+    T +  I   + +A+R A    PG V+V+ P
Sbjct:    3 GASITAAALKSQGVEYMFGVVGFPVIEVGMAAQAHGIKYIGCRNEQAAAYAAQAMGYLTGKPVALLVVSGPGILHAIGGLANATVNCWPVVCIGGTADVDLENRGAFQEWSQQESVRNSCKHVSRPTSLHTIPAHIEKAVRCAMYGRPGAVYVDLP 158          
BLAST of acetolactate synthase-like protein vs. Ensembl Fly
Match: Hacl (gene:FBgn0034488 transcript:FBtr0086322)

HSP 1 Score: 78.9518 bits (193), Expect = 2.874e-16
Identity = 51/157 (32.48%), Postives = 87/157 (55.41%), Query Frame = 3
Query:  129 IVAEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFPIDTL 599
            I+AE LK+  V+++F + G  +  + +A +  G++ I +R+E  A +AA A+  +TG  GV  V +GPGL +    + NAQ+   P++++GGA     +G G  Q+  Q+ L +P CKY         I   + +A+R A    PG  +++FP + L
Sbjct:    9 IIAESLKQQGVEYVFGIIGIPVIELSMAFQAAGLKYIGMRNEQAACYAAQAIGYLTGKPGVCLVVSGPGLLHVTGGMANAQVNCWPLIVIGGATNQDHEGIGGFQECPQVELSRPYCKYAARPATAALIPLHVEKAVRYATYGRPGVAYLDFPGNIL 165          
BLAST of acetolactate synthase-like protein vs. Ensembl Zebrafish
Match: ilvbl (ilvB (bacterial acetolactate synthase)-like [Source:NCBI gene;Acc:393639])

HSP 1 Score: 237.654 bits (605), Expect = 4.792e-78
Identity = 126/212 (59.43%), Postives = 161/212 (75.94%), Query Frame = 3
Query:   72 FIKTIFAQVKTGSAEHGGLIVAEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFPIDTLYPYNLVRREMGISPHPRNIKQRVVN*ND*INWIFYN 707
             +  +F + +  S  HGG  VAEVL+ H VK +FTL GGHISPIL+A EK GI+++D RHEA AVFAADAVAR++G++GV AVTAGPGLTNTVTA+KNAQMAESP+LL+GGAAA++L+GRGALQDIDQM LFKPLCK+  +V  + +I P +R+A+  AQS TPGPVF+EFPIDTLYPY++V +E      P+ +  ++      I W   N
Sbjct:   27 LLYQLFHKTERQSPRHGGESVAEVLRSHGVKFVFTLVGGHISPILVACEKLGIRIVDTRHEATAVFAADAVARLSGTVGVAAVTAGPGLTNTVTAVKNAQMAESPLLLIGGAAATLLQGRGALQDIDQMSLFKPLCKFCASVRTVREIVPTVRKALAIAQSGTPGPVFIEFPIDTLYPYHVVEKEFAPKNTPKGLMGKI------IAWYLKN 232          
BLAST of acetolactate synthase-like protein vs. Ensembl Zebrafish
Match: ilvbl (ilvB (bacterial acetolactate synthase)-like [Source:NCBI gene;Acc:393639])

HSP 1 Score: 236.113 bits (601), Expect = 4.012e-73
Identity = 126/212 (59.43%), Postives = 161/212 (75.94%), Query Frame = 3
Query:   72 FIKTIFAQVKTGSAEHGGLIVAEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFPIDTLYPYNLVRREMGISPHPRNIKQRVVN*ND*INWIFYN 707
             +  +F + +  S  HGG  VAEVL+ H VK +FTL GGHISPIL+A EK GI+++D RHEA AVFAADAVAR++G++GV AVTAGPGLTNTVTA+KNAQMAESP+LL+GGAAA++L+GRGALQDIDQM LFKPLCK+  +V  + +I P +R+A+  AQS TPGPVF+EFPIDTLYPY++V +E      P+ +  ++      I W   N
Sbjct:   27 LLYQLFHKTERQSPRHGGESVAEVLRSHGVKFVFTLVGGHISPILVACEKLGIRIVDTRHEATAVFAADAVARLSGTVGVAAVTAGPGLTNTVTAVKNAQMAESPLLLIGGAAATLLQGRGALQDIDQMSLFKPLCKFCASVRTVREIVPTVRKALAIAQSGTPGPVFIEFPIDTLYPYHVVEKEFAPKNTPKGLMGKI------IAWYLKN 232          
BLAST of acetolactate synthase-like protein vs. Ensembl Zebrafish
Match: ilvbl (ilvB (bacterial acetolactate synthase)-like [Source:NCBI gene;Acc:393639])

HSP 1 Score: 236.113 bits (601), Expect = 4.012e-73
Identity = 126/212 (59.43%), Postives = 161/212 (75.94%), Query Frame = 3
Query:   72 FIKTIFAQVKTGSAEHGGLIVAEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFPIDTLYPYNLVRREMGISPHPRNIKQRVVN*ND*INWIFYN 707
             +  +F + +  S  HGG  VAEVL+ H VK +FTL GGHISPIL+A EK GI+++D RHEA AVFAADAVAR++G++GV AVTAGPGLTNTVTA+KNAQMAESP+LL+GGAAA++L+GRGALQDIDQM LFKPLCK+  +V  + +I P +R+A+  AQS TPGPVF+EFPIDTLYPY++V +E      P+ +  ++      I W   N
Sbjct:   27 LLYQLFHKTERQSPRHGGESVAEVLRSHGVKFVFTLVGGHISPILVACEKLGIRIVDTRHEATAVFAADAVARLSGTVGVAAVTAGPGLTNTVTAVKNAQMAESPLLLIGGAAATLLQGRGALQDIDQMSLFKPLCKFCASVRTVREIVPTVRKALAIAQSGTPGPVFIEFPIDTLYPYHVVEKEFAPKNTPKGLMGKI------IAWYLKN 232          
BLAST of acetolactate synthase-like protein vs. Ensembl Zebrafish
Match: hacl1 (2-hydroxyacyl-CoA lyase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2058])

HSP 1 Score: 68.5514 bits (166), Expect = 1.096e-12
Identity = 45/158 (28.48%), Postives = 86/158 (54.43%), Query Frame = 3
Query:  120 GGLIVAEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFPID 593
            G  ++A  LK  NV+++F + G  I  + +AA+  GI+ + +R+E  A +AA A+  +TG   V  V +GPGL + +  + NA +   PV++LGG++    +  GA Q+  Q+   +   K++   + +  I  ++ +A+R +    PG  +++   D
Sbjct:    6 GAQLIAAALKDQNVEYMFGIVGVPIIEVAMAAQAAGIKYVGMRNEQAACYAASAIGYLTGRPAVCLVVSGPGLIHALGGMANANVNCWPVIVLGGSSDRNQETTGAFQEFPQVEACRLYSKFSARPSSLEMIPAVVEKAVRSSIYGRPGACYIDIAGD 163          
BLAST of acetolactate synthase-like protein vs. Ensembl Xenopus
Match: ilvbl (ilvB (bacterial acetolactate synthase)-like [Source:NCBI gene;Acc:100145261])

HSP 1 Score: 238.039 bits (606), Expect = 1.609e-73
Identity = 133/233 (57.08%), Postives = 172/233 (73.82%), Query Frame = 3
Query:   33 VFSHWSLINH----ISKFIKTIFA----QVKTGSAEHGGLIVAEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFPIDTLYPYNLVRREMGISPHPRNIKQRVVN*ND*INWIFYN 707
            V  HW ++ +    +  FI  ++     QV+T S  HGG +VA+VL+ H V+ +FTL GGHISPI++A EK GI+++D RHEA AVFAADAVAR++G++GV AVTAGPGLTNTVTAIKNAQMAESP+LL+GGA+A++L+GRGALQDIDQM LFKP+CK   +V  I +I P+LR+A+ EAQS TPGPVFVEFPID LYPY++V +E+     P+ I  +       I W   N
Sbjct:   23 VLLHWHMLAYKYSSVLPFILCVYVVHCLQVETQSPCHGGEVVAKVLQAHGVRFVFTLPGGHISPIVVACEKLGIRIVDTRHEATAVFAADAVARLSGTVGVAAVTAGPGLTNTVTAIKNAQMAESPLLLIGGASATLLQGRGALQDIDQMSLFKPICKSCSSVRTIREIVPVLRKAMAEAQSGTPGPVFVEFPIDILYPYHIVHKELSPKGAPKGIVGKA------ITWYLQN 249          
BLAST of acetolactate synthase-like protein vs. Ensembl Xenopus
Match: ilvbl (ilvB (bacterial acetolactate synthase)-like [Source:NCBI gene;Acc:100145261])

HSP 1 Score: 237.269 bits (604), Expect = 2.265e-73
Identity = 129/211 (61.14%), Postives = 164/211 (77.73%), Query Frame = 3
Query:   75 IKTIFAQVKTGSAEHGGLIVAEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFPIDTLYPYNLVRREMGISPHPRNIKQRVVN*ND*INWIFYN 707
            I  +F +V+T S  HGG +VA+VL+ H V+ +FTL GGHISPI++A EK GI+++D RHEA AVFAADAVAR++G++GV AVTAGPGLTNTVTAIKNAQMAESP+LL+GGA+A++L+GRGALQDIDQM LFKP+CK   +V  I +I P+LR+A+ EAQS TPGPVFVEFPID LYPY++V +E+     P+ I  +       I W   N
Sbjct:   33 IYQLFHKVETQSPCHGGEVVAKVLQAHGVRFVFTLPGGHISPIVVACEKLGIRIVDTRHEATAVFAADAVARLSGTVGVAAVTAGPGLTNTVTAIKNAQMAESPLLLIGGASATLLQGRGALQDIDQMSLFKPICKSCSSVRTIREIVPVLRKAMAEAQSGTPGPVFVEFPIDILYPYHIVHKELSPKGAPKGIVGKA------ITWYLQN 237          
BLAST of acetolactate synthase-like protein vs. Ensembl Xenopus
Match: ilvbl (ilvB (bacterial acetolactate synthase)-like [Source:NCBI gene;Acc:100145261])

HSP 1 Score: 237.654 bits (605), Expect = 2.330e-73
Identity = 129/211 (61.14%), Postives = 164/211 (77.73%), Query Frame = 3
Query:   75 IKTIFAQVKTGSAEHGGLIVAEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFPIDTLYPYNLVRREMGISPHPRNIKQRVVN*ND*INWIFYN 707
            I  +F +V+T S  HGG +VA+VL+ H V+ +FTL GGHISPI++A EK GI+++D RHEA AVFAADAVAR++G++GV AVTAGPGLTNTVTAIKNAQMAESP+LL+GGA+A++L+GRGALQDIDQM LFKP+CK   +V  I +I P+LR+A+ EAQS TPGPVFVEFPID LYPY++V +E+     P+ I  +       I W   N
Sbjct:   58 IYQLFHKVETQSPCHGGEVVAKVLQAHGVRFVFTLPGGHISPIVVACEKLGIRIVDTRHEATAVFAADAVARLSGTVGVAAVTAGPGLTNTVTAIKNAQMAESPLLLIGGASATLLQGRGALQDIDQMSLFKPICKSCSSVRTIREIVPVLRKAMAEAQSGTPGPVFVEFPIDILYPYHIVHKELSPKGAPKGIVGKA------ITWYLQN 262          
BLAST of acetolactate synthase-like protein vs. Ensembl Xenopus
Match: ilvbl (ilvB (bacterial acetolactate synthase)-like [Source:NCBI gene;Acc:100145261])

HSP 1 Score: 237.269 bits (604), Expect = 3.647e-73
Identity = 129/211 (61.14%), Postives = 164/211 (77.73%), Query Frame = 3
Query:   75 IKTIFAQVKTGSAEHGGLIVAEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFPIDTLYPYNLVRREMGISPHPRNIKQRVVN*ND*INWIFYN 707
            I  +F +V+T S  HGG +VA+VL+ H V+ +FTL GGHISPI++A EK GI+++D RHEA AVFAADAVAR++G++GV AVTAGPGLTNTVTAIKNAQMAESP+LL+GGA+A++L+GRGALQDIDQM LFKP+CK   +V  I +I P+LR+A+ EAQS TPGPVFVEFPID LYPY++V +E+     P+ I  +       I W   N
Sbjct:   49 IYQLFHKVETQSPCHGGEVVAKVLQAHGVRFVFTLPGGHISPIVVACEKLGIRIVDTRHEATAVFAADAVARLSGTVGVAAVTAGPGLTNTVTAIKNAQMAESPLLLIGGASATLLQGRGALQDIDQMSLFKPICKSCSSVRTIREIVPVLRKAMAEAQSGTPGPVFVEFPIDILYPYHIVHKELSPKGAPKGIVGKA------ITWYLQN 253          
BLAST of acetolactate synthase-like protein vs. Ensembl Xenopus
Match: ilvbl (ilvB (bacterial acetolactate synthase)-like [Source:NCBI gene;Acc:100145261])

HSP 1 Score: 235.728 bits (600), Expect = 7.224e-73
Identity = 131/222 (59.01%), Postives = 167/222 (75.23%), Query Frame = 3
Query:   54 INHISKFIKTIFA----QVKTGSAEHGGLIVAEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFPIDTLYPYNLVRREMGISPHPRNIKQRVVN*ND*INWIFYN 707
            I  +  FI  ++     QV+T S  HGG +VA+VL+ H V+ +FTL GGHISPI++A EK GI+++D RHEA AVFAADAVAR++G++GV AVTAGPGLTNTVTAIKNAQMAESP+LL+GGA+A++L+GRGALQDIDQM LFKP+CK   +V  I +I P+LR+A+ EAQS TPGPVFVEFPID LYPY++V +E+     P+ I  +       I W   N
Sbjct:   16 ITSVLPFILCVYVVHCLQVETQSPCHGGEVVAKVLQAHGVRFVFTLPGGHISPIVVACEKLGIRIVDTRHEATAVFAADAVARLSGTVGVAAVTAGPGLTNTVTAIKNAQMAESPLLLIGGASATLLQGRGALQDIDQMSLFKPICKSCSSVRTIREIVPVLRKAMAEAQSGTPGPVFVEFPIDILYPYHIVHKELSPKGAPKGIVGKA------ITWYLQN 231          
BLAST of acetolactate synthase-like protein vs. Ensembl Mouse
Match: Ilvbl (ilvB (bacterial acetolactate synthase)-like [Source:MGI Symbol;Acc:MGI:1351911])

HSP 1 Score: 231.876 bits (590), Expect = 9.684e-74
Identity = 127/219 (57.99%), Postives = 157/219 (71.69%), Query Frame = 3
Query:   54 INHISKFIKTIFAQVKTGSAEHGGLIVAEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFPIDTLYPYNLVRREMGISPHPRNIKQRVVN*ND*INWIFYNC 710
            + H       +  +V   S  HGG  VA VL+ H V+ +FTL GGHISP+L+A EK GI+V+D RHE  AVFAADAVAR+TG++GV AVTAGPGLTNTVTA+KNAQ+A+SPVLLLGGAA+++L+ RGALQ IDQM LF+PLCK+  +V R+ DI P LR AI  AQS TPGPVFVE P+D LYPY +V +EM  +  P ++  RVV       W   NC
Sbjct:   32 VAHRLGLFYQLMHKVDKTSIRHGGESVAAVLRAHGVRFVFTLVGGHISPLLVACEKLGIRVVDTRHEVTAVFAADAVARLTGTVGVAAVTAGPGLTNTVTAVKNAQVAQSPVLLLGGAASTLLQKRGALQAIDQMSLFRPLCKFCASVRRVRDIVPTLRTAIAAAQSGTPGPVFVELPLDVLYPYFMVEKEMIPTKLPNSLMGRVV------VWYLQNC 244          
BLAST of acetolactate synthase-like protein vs. Ensembl Mouse
Match: Ilvbl (ilvB (bacterial acetolactate synthase)-like [Source:MGI Symbol;Acc:MGI:1351911])

HSP 1 Score: 231.106 bits (588), Expect = 2.552e-73
Identity = 127/219 (57.99%), Postives = 157/219 (71.69%), Query Frame = 3
Query:   54 INHISKFIKTIFAQVKTGSAEHGGLIVAEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFPIDTLYPYNLVRREMGISPHPRNIKQRVVN*ND*INWIFYNC 710
            + H       +  +V   S  HGG  VA VL+ H V+ +FTL GGHISP+L+A EK GI+V+D RHE  AVFAADAVAR+TG++GV AVTAGPGLTNTVTA+KNAQ+A+SPVLLLGGAA+++L+ RGALQ IDQM LF+PLCK+  +V R+ DI P LR AI  AQS TPGPVFVE P+D LYPY +V +EM  +  P ++  RVV       W   NC
Sbjct:   32 VAHRLGLFYQLMHKVDKTSIRHGGESVAAVLRAHGVRFVFTLVGGHISPLLVACEKLGIRVVDTRHEVTAVFAADAVARLTGTVGVAAVTAGPGLTNTVTAVKNAQVAQSPVLLLGGAASTLLQKRGALQAIDQMSLFRPLCKFCASVRRVRDIVPTLRTAIAAAQSGTPGPVFVELPLDVLYPYFMVEKEMIPTKLPNSLMGRVV------VWYLQNC 244          
BLAST of acetolactate synthase-like protein vs. Ensembl Mouse
Match: Ilvbl (ilvB (bacterial acetolactate synthase)-like [Source:MGI Symbol;Acc:MGI:1351911])

HSP 1 Score: 231.106 bits (588), Expect = 4.750e-72
Identity = 127/219 (57.99%), Postives = 157/219 (71.69%), Query Frame = 3
Query:   54 INHISKFIKTIFAQVKTGSAEHGGLIVAEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFPIDTLYPYNLVRREMGISPHPRNIKQRVVN*ND*INWIFYNC 710
            + H       +  +V   S  HGG  VA VL+ H V+ +FTL GGHISP+L+A EK GI+V+D RHE  AVFAADAVAR+TG++GV AVTAGPGLTNTVTA+KNAQ+A+SPVLLLGGAA+++L+ RGALQ IDQM LF+PLCK+  +V R+ DI P LR AI  AQS TPGPVFVE P+D LYPY +V +EM  +  P ++  RVV       W   NC
Sbjct:   32 VAHRLGLFYQLMHKVDKTSIRHGGESVAAVLRAHGVRFVFTLVGGHISPLLVACEKLGIRVVDTRHEVTAVFAADAVARLTGTVGVAAVTAGPGLTNTVTAVKNAQVAQSPVLLLGGAASTLLQKRGALQAIDQMSLFRPLCKFCASVRRVRDIVPTLRTAIAAAQSGTPGPVFVELPLDVLYPYFMVEKEMIPTKLPNSLMGRVV------VWYLQNC 244          
BLAST of acetolactate synthase-like protein vs. Ensembl Mouse
Match: Ilvbl (ilvB (bacterial acetolactate synthase)-like [Source:MGI Symbol;Acc:MGI:1351911])

HSP 1 Score: 231.491 bits (589), Expect = 1.567e-71
Identity = 127/219 (57.99%), Postives = 157/219 (71.69%), Query Frame = 3
Query:   54 INHISKFIKTIFAQVKTGSAEHGGLIVAEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFPIDTLYPYNLVRREMGISPHPRNIKQRVVN*ND*INWIFYNC 710
            + H       +  +V   S  HGG  VA VL+ H V+ +FTL GGHISP+L+A EK GI+V+D RHE  AVFAADAVAR+TG++GV AVTAGPGLTNTVTA+KNAQ+A+SPVLLLGGAA+++L+ RGALQ IDQM LF+PLCK+  +V R+ DI P LR AI  AQS TPGPVFVE P+D LYPY +V +EM  +  P ++  RVV       W   NC
Sbjct:   32 VAHRLGLFYQLMHKVDKTSIRHGGESVAAVLRAHGVRFVFTLVGGHISPLLVACEKLGIRVVDTRHEVTAVFAADAVARLTGTVGVAAVTAGPGLTNTVTAVKNAQVAQSPVLLLGGAASTLLQKRGALQAIDQMSLFRPLCKFCASVRRVRDIVPTLRTAIAAAQSGTPGPVFVELPLDVLYPYFMVEKEMIPTKLPNSLMGRVV------VWYLQNC 244          
BLAST of acetolactate synthase-like protein vs. Ensembl Mouse
Match: Ilvbl (ilvB (bacterial acetolactate synthase)-like [Source:MGI Symbol;Acc:MGI:1351911])

HSP 1 Score: 231.106 bits (588), Expect = 3.936e-71
Identity = 127/219 (57.99%), Postives = 157/219 (71.69%), Query Frame = 3
Query:   54 INHISKFIKTIFAQVKTGSAEHGGLIVAEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFPIDTLYPYNLVRREMGISPHPRNIKQRVVN*ND*INWIFYNC 710
            + H       +  +V   S  HGG  VA VL+ H V+ +FTL GGHISP+L+A EK GI+V+D RHE  AVFAADAVAR+TG++GV AVTAGPGLTNTVTA+KNAQ+A+SPVLLLGGAA+++L+ RGALQ IDQM LF+PLCK+  +V R+ DI P LR AI  AQS TPGPVFVE P+D LYPY +V +EM  +  P ++  RVV       W   NC
Sbjct:   32 VAHRLGLFYQLMHKVDKTSIRHGGESVAAVLRAHGVRFVFTLVGGHISPLLVACEKLGIRVVDTRHEVTAVFAADAVARLTGTVGVAAVTAGPGLTNTVTAVKNAQVAQSPVLLLGGAASTLLQKRGALQAIDQMSLFRPLCKFCASVRRVRDIVPTLRTAIAAAQSGTPGPVFVELPLDVLYPYFMVEKEMIPTKLPNSLMGRVV------VWYLQNC 244          
BLAST of acetolactate synthase-like protein vs. UniProt/SwissProt
Match: sp|O61856|HACL2_CAEEL (2-hydroxyacyl-CoA lyase 2 OS=Caenorhabditis elegans OX=6239 GN=T26C12.1 PE=3 SV=2)

HSP 1 Score: 252.292 bits (643), Expect = 2.696e-78
Identity = 130/194 (67.01%), Postives = 156/194 (80.41%), Query Frame = 3
Query:   93 QVKTGSAEHGGLIVAEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFPIDTLYPYNLVRREMGISPHPRNIKQRVVN 674
            QV   S  HGG +VA VLK H+V+ IF LCGGHISPIL+AAEK GI+++D RHE  AVFAADAVAR+  SIGV AVTAGPGLTNT+TA+KNAQMAESP+LL+GGAA ++LKGRGALQDIDQM LF+PLCKY   V R+ DI P +REAI+ A+S  PGPVFVEFP+D LYPY LV +E+G +P+ +   QR +N
Sbjct:   49 QVDEKSKRHGGELVASVLKAHDVEEIFVLCGGHISPILVAAEKLGIKIVDTRHEVTAVFAADAVARLRQSIGVAAVTAGPGLTNTITAVKNAQMAESPLLLIGGAAPTLLKGRGALQDIDQMVLFRPLCKYVARVERLRDIVPTVREAIKAAKSGCPGPVFVEFPVDVLYPYELVVKEIGFNPNAKGFIQRALN 242          
BLAST of acetolactate synthase-like protein vs. UniProt/SwissProt
Match: sp|Q6NV04|HACL2_DANRE (2-hydroxyacyl-CoA lyase 2 OS=Danio rerio OX=7955 GN=ilvbl PE=2 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 3.029e-72
Identity = 126/212 (59.43%), Postives = 161/212 (75.94%), Query Frame = 3
Query:   72 FIKTIFAQVKTGSAEHGGLIVAEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFPIDTLYPYNLVRREMGISPHPRNIKQRVVN*ND*INWIFYN 707
             +  +F + +  S  HGG  VAEVL+ H VK +FTL GGHISPIL+A EK GI+++D RHEA AVFAADAVAR++G++GV AVTAGPGLTNTVTA+KNAQMAESP+LL+GGAAA++L+GRGALQDIDQM LFKPLCK+  +V  + +I P +R+A+  AQS TPGPVF+EFPIDTLYPY++V +E      P+ +  ++      I W   N
Sbjct:   27 LLYQLFHKTERQSPRHGGESVAEVLRSHGVKFVFTLVGGHISPILVACEKLGIRIVDTRHEATAVFAADAVARLSGTVGVAAVTAGPGLTNTVTAVKNAQMAESPLLLIGGAAATLLQGRGALQDIDQMSLFKPLCKFCASVRTVREIVPTVRKALAIAQSGTPGPVFIEFPIDTLYPYHVVEKEFAPKNTPKGLMGKI------IAWYLKN 232          
BLAST of acetolactate synthase-like protein vs. UniProt/SwissProt
Match: sp|Q8BU33|HACL2_MOUSE (2-hydroxyacyl-CoA lyase 2 OS=Mus musculus OX=10090 GN=Ilvbl PE=1 SV=1)

HSP 1 Score: 231.106 bits (588), Expect = 2.753e-70
Identity = 127/219 (57.99%), Postives = 157/219 (71.69%), Query Frame = 3
Query:   54 INHISKFIKTIFAQVKTGSAEHGGLIVAEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFPIDTLYPYNLVRREMGISPHPRNIKQRVVN*ND*INWIFYNC 710
            + H       +  +V   S  HGG  VA VL+ H V+ +FTL GGHISP+L+A EK GI+V+D RHE  AVFAADAVAR+TG++GV AVTAGPGLTNTVTA+KNAQ+A+SPVLLLGGAA+++L+ RGALQ IDQM LF+PLCK+  +V R+ DI P LR AI  AQS TPGPVFVE P+D LYPY +V +EM  +  P ++  RVV       W   NC
Sbjct:   32 VAHRLGLFYQLMHKVDKTSIRHGGESVAAVLRAHGVRFVFTLVGGHISPLLVACEKLGIRVVDTRHEVTAVFAADAVARLTGTVGVAAVTAGPGLTNTVTAVKNAQVAQSPVLLLGGAASTLLQKRGALQAIDQMSLFRPLCKFCASVRRVRDIVPTLRTAIAAAQSGTPGPVFVELPLDVLYPYFMVEKEMIPTKLPNSLMGRVV------VWYLQNC 244          
BLAST of acetolactate synthase-like protein vs. UniProt/SwissProt
Match: sp|A6QQT9|HACL2_BOVIN (2-hydroxyacyl-CoA lyase 2 OS=Bos taurus OX=9913 GN=ILVBL PE=2 SV=2)

HSP 1 Score: 230.72 bits (587), Expect = 4.569e-70
Identity = 123/205 (60.00%), Postives = 155/205 (75.61%), Query Frame = 3
Query:   60 HISKFIKTIFAQVKTGSAEHGGLIVAEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFPIDTLYPYNLVRREMGISPHPRNIKQRVVN 674
            H       +  +V T S  HGG  VA VLK H V+ +FTL GGHISP+L+A EK GI+V+D RHE  AVFAADAVAR+TG++GV AVTAGPGLTNTVTA+KNAQ+A+SPVLLLGGAA+++L+ RGALQ IDQ+ LF+PLCK+  +V R+ DI P LR A+  AQS TPGPVFVE P+D LYPY +V++EM  +  P+ +  R V+
Sbjct:   34 HRLGLFYQLMHKVDTASTRHGGENVAAVLKAHGVRFLFTLVGGHISPLLVACEKLGIRVVDTRHEVTAVFAADAVARLTGTVGVAAVTAGPGLTNTVTAVKNAQIAQSPVLLLGGAASTLLQNRGALQAIDQIALFRPLCKFCASVRRVRDIIPTLRAAMAAAQSGTPGPVFVELPLDVLYPYFMVQKEMVPAKPPKGLMSRAVH 238          
BLAST of acetolactate synthase-like protein vs. UniProt/SwissProt
Match: sp|A1L0T0|HACL2_HUMAN (2-hydroxyacyl-CoA lyase 2 OS=Homo sapiens OX=9606 GN=ILVBL PE=1 SV=2)

HSP 1 Score: 228.409 bits (581), Expect = 3.391e-69
Identity = 122/216 (56.48%), Postives = 157/216 (72.69%), Query Frame = 3
Query:   60 HISKFIKTIFAQVKTGSAEHGGLIVAEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFPIDTLYPYNLVRREMGISPHPRNIKQRVVN*ND*INWIFYN 707
            H       +  +V   S  HGG  VA VL+ H V+ IFTL GGHISP+L+A EK GI+V+D RHE  AVFAADA+AR++G++GV AVTAGPGLTNTVTA+KNAQMA+SP+LLLGGAA+++L+ RGALQ +DQ+ LF+PLCK+  +V R+ DI P LR A+  AQS TPGPVFVE P+D LYPY +V++EM  +  P+ +  RVV      +W   N
Sbjct:   34 HRLGLFYQLLHKVDKASVRHGGENVAAVLRAHGVRFIFTLVGGHISPLLVACEKLGIRVVDTRHEVTAVFAADAMARLSGTVGVAAVTAGPGLTNTVTAVKNAQMAQSPILLLGGAASTLLQNRGALQAVDQLSLFRPLCKFCVSVRRVRDIVPTLRAAMAAAQSGTPGPVFVELPVDVLYPYFMVQKEMVPAKPPKGLVGRVV------SWYLEN 243          
BLAST of acetolactate synthase-like protein vs. TrEMBL
Match: A0A1S3IPT1 (acetolactate synthase-like protein OS=Lingula unguis OX=7574 GN=LOC106166055 PE=3 SV=1)

HSP 1 Score: 268.855 bits (686), Expect = 2.904e-82
Identity = 139/208 (66.83%), Postives = 173/208 (83.17%), Query Frame = 3
Query:   51 LINHISKFIKTIFAQVKTGSAEHGGLIVAEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFPIDTLYPYNLVRREMGISPHPRNIKQRVVN 674
            L+N +  F + +  +V   S  HGG  VA+VLK H VK++FTL GGHISPIL+A+EK GI+V+D RHE  AVFAADAVAR++G+IGV  VTAGPGLTNTVTA+KNAQMAESP+LL+GGAAA++LKGRGALQDIDQM LFKPLCK+  T+T++ DI P+L+EAI+ AQS TPGPVFVEFPIDTLYPY+LV+RE G+S  P+ + Q++VN
Sbjct:   27 LLNRVGFFYR-MLHKVDEHSVRHGGEKVADVLKSHGVKYLFTLTGGHISPILVASEKLGIRVVDTRHEVTAVFAADAVARLSGNIGVAVVTAGPGLTNTVTAVKNAQMAESPLLLMGGAAATLLKGRGALQDIDQMSLFKPLCKFCATITKVRDIVPVLKEAIQVAQSGTPGPVFVEFPIDTLYPYSLVKREAGLSDSPKGLIQKIVN 233          
BLAST of acetolactate synthase-like protein vs. TrEMBL
Match: K1QG61 (Acetolactate synthase-like protein OS=Crassostrea gigas OX=29159 GN=CGI_10016018 PE=3 SV=1)

HSP 1 Score: 268.085 bits (684), Expect = 7.211e-82
Identity = 142/212 (66.98%), Postives = 169/212 (79.72%), Query Frame = 3
Query:   75 IKTIFAQVKTGSAEHGGLIVAEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFPIDTLYPYNLVRREMGISPH-PRNIKQRVVN*ND*INWIFYN 707
            I  +F +V + +  +GG IVA+VLK H +K++FTL GGHISPIL+A EK GI+V+D RHE   VFAADAVAR++G+IGV AVTAGPGLTNTVTA+KNAQMAESPVLL+GGAAA++LKGRGALQDIDQM LFKPLCKY  +VT+I DI P L++A+ EAQS TPGPVFVEFPIDTLYPY LVRRE+G+    P N  QR+      INW   N
Sbjct:   39 IYQLFHKVDSKTKRNGGDIVADVLKAHGIKYVFTLVGGHISPILVACEKLGIRVVDTRHEVTTVFAADAVARMSGTIGVAAVTAGPGLTNTVTAVKNAQMAESPVLLIGGAAATLLKGRGALQDIDQMSLFKPLCKYCASVTKIRDIVPTLKKALHEAQSGTPGPVFVEFPIDTLYPYELVRREIGMKEKGPVNFVQRI------INWYLMN 244          
BLAST of acetolactate synthase-like protein vs. TrEMBL
Match: H2Y6A6 (Uncharacterized protein OS=Ciona savignyi OX=51511 PE=3 SV=1)

HSP 1 Score: 266.929 bits (681), Expect = 1.437e-81
Identity = 150/230 (65.22%), Postives = 174/230 (75.65%), Query Frame = 3
Query:   72 FIKTIFAQ-----------VKTGSAEHGGLIVAEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFPIDTLYPYNLVRREMGISP-HPRNIKQRVVN*ND*INWIF--YNC*IF 719
            FI ++F Q           V   S +HGG +VAE LK H V +IFTL GGHISPIL+AAEK GI+V+D RHE  AVFAADAVAR++G IGV AVTAGPG+TNT+TA+KNAQMAESP+LL+GGAAASILKGRGALQDIDQM L KPLCKYT T+ RI DI P L++AI +AQS TPGPVFVEFPIDTLYPY+LV+RE+G S    RNIKQ +V      NW    Y C +F
Sbjct:   27 FIASLFVQKFGLMYQYLHKVDKDSQQHGGEVVAETLKSHGVDYIFTLVGGHISPILVAAEKLGIRVVDTRHEVTAVFAADAVARLSGKIGVAAVTAGPGITNTITAVKNAQMAESPLLLMGGAAASILKGRGALQDIDQMVLLKPLCKYTATIKRIRDIVPTLQQAIVQAQSGTPGPVFVEFPIDTLYPYHLVQREIGSSTGKARNIKQHIV------NWYMNNYLCNLF 250          
BLAST of acetolactate synthase-like protein vs. TrEMBL
Match: A0A3Q0K1B8 (acetolactate synthase-like protein OS=Ciona intestinalis OX=7719 GN=LOC101242740 PE=3 SV=1)

HSP 1 Score: 266.159 bits (679), Expect = 3.817e-81
Identity = 148/224 (66.07%), Postives = 173/224 (77.23%), Query Frame = 3
Query:   63 ISKF--IKTIFAQVKTGSAEHGGLIVAEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFPIDTLYPYNLVRRE-MGISPHPRNIKQRVVN*ND*INWIF--YNC*IF 719
            + KF  I     +V   S +HGG IVAE LK H V+ IFTL GGHISPIL+A+EK GI+V+D RHE  AVFAADAVAR++G IGV AVTAGPG+TNT+TA+KNAQMAESP+LL+GGAAASILKGRGALQDIDQM L KPLCKYT T+ RI DI P L++AI +AQS TPGPVFVEFPIDTLYPY+LV++E M  S   RN+KQR+V      NW    Y C +F
Sbjct:   33 VQKFGLIYQFLHKVDKDSQQHGGEIVAETLKAHGVEFIFTLIGGHISPILVASEKLGIRVVDTRHEVTAVFAADAVARLSGKIGVAAVTAGPGITNTITAVKNAQMAESPLLLMGGAAASILKGRGALQDIDQMVLLKPLCKYTATIKRIRDIIPTLQQAISQAQSGTPGPVFVEFPIDTLYPYHLVQKEIMSSSGKARNLKQRIV------NWYMGNYLCNLF 250          
BLAST of acetolactate synthase-like protein vs. TrEMBL
Match: E9GG06 (Uncharacterized protein OS=Daphnia pulex OX=6669 GN=DAPPUDRAFT_303446 PE=3 SV=1)

HSP 1 Score: 265.003 bits (676), Expect = 8.794e-81
Identity = 141/194 (72.68%), Postives = 162/194 (83.51%), Query Frame = 3
Query:   93 QVKTGSAEHGGLIVAEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFPIDTLYPYNLVRREMGISPHPRNIKQRVVN 674
            QV T S  +GG IVA+VL+ HN+KH+FTL GGHISPIL AAEK GI+V+D RHE +AVFAADAVAR+TG++GVVAVTAGPGLTNTVTAIKNAQMAESP+LLLGGAAA+ILKGRGALQDIDQM LF PLCKY  +VT I DI PILR A++ AQSDTPGPVFVE PID LY Y LV+RE+G     + I  ++VN
Sbjct:   46 QVDTTSKRNGGEIVAKVLEAHNIKHMFTLAGGHISPILAAAEKIGIKVVDTRHEVSAVFAADAVARMTGTVGVVAVTAGPGLTNTVTAIKNAQMAESPILLLGGAAATILKGRGALQDIDQMSLFSPLCKYCVSVTSIRDIAPILRTALQIAQSDTPGPVFVEMPIDVLYSYELVKREVGAKSDGKGIMNKIVN 239          
BLAST of acetolactate synthase-like protein vs. Ensembl Cavefish
Match: ilvbl (ilvB (bacterial acetolactate synthase)-like [Source:NCBI gene;Acc:393639])

HSP 1 Score: 235.728 bits (600), Expect = 3.522e-73
Identity = 125/200 (62.50%), Postives = 156/200 (78.00%), Query Frame = 3
Query:   69 KFIKTIFAQVKTGSAEHGGLIVAEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFPIDTLYPYNLVRREMGISPHPRNIKQRV 668
            + + T+    +  S  HGG  VAEVL+ H +K +FTL GGHISPIL+A EK GI V+D RHEA AVFAADAVAR++G++GV AVTAGPGLTNTVTA+KNAQMAESP+LL+GGAAA++L+GRGALQDIDQM LFKPLCK+  +V  + +I P +R A+  AQS TPGPVF+EFPIDTLYPY++V +E      P+ I  R+
Sbjct:    3 QLVYTLHPSAEVKSPRHGGESVAEVLRAHGIKFVFTLVGGHISPILVACEKLGICVVDTRHEATAVFAADAVARLSGTVGVAAVTAGPGLTNTVTAVKNAQMAESPLLLIGGAAATLLQGRGALQDIDQMSLFKPLCKFCASVRSVREIVPTVRRALAVAQSGTPGPVFIEFPIDTLYPYHVVEKEFSPKSTPKGIVGRI 202          
BLAST of acetolactate synthase-like protein vs. Ensembl Cavefish
Match: ilvbl (ilvB (bacterial acetolactate synthase)-like [Source:NCBI gene;Acc:393639])

HSP 1 Score: 235.728 bits (600), Expect = 5.360e-73
Identity = 125/199 (62.81%), Postives = 156/199 (78.39%), Query Frame = 3
Query:   72 FIKTIFAQVKTGSAEHGGLIVAEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFPIDTLYPYNLVRREMGISPHPRNIKQRV 668
             +  +F + +  S  HGG  VAEVL+ H +K +FTL GGHISPIL+A EK GI V+D RHEA AVFAADAVAR++G++GV AVTAGPGLTNTVTA+KNAQMAESP+LL+GGAAA++L+GRGALQDIDQM LFKPLCK+  +V  + +I P +R A+  AQS TPGPVF+EFPIDTLYPY++V +E      P+ I  R+
Sbjct:   27 LLYRLFHKAEVKSPRHGGESVAEVLRAHGIKFVFTLVGGHISPILVACEKLGICVVDTRHEATAVFAADAVARLSGTVGVAAVTAGPGLTNTVTAVKNAQMAESPLLLIGGAAATLLQGRGALQDIDQMSLFKPLCKFCASVRSVREIVPTVRRALAVAQSGTPGPVFIEFPIDTLYPYHVVEKEFSPKSTPKGIVGRI 225          
BLAST of acetolactate synthase-like protein vs. Ensembl Cavefish
Match: ilvbl (ilvB (bacterial acetolactate synthase)-like [Source:NCBI gene;Acc:393639])

HSP 1 Score: 172.94 bits (437), Expect = 1.891e-49
Identity = 107/200 (53.50%), Postives = 137/200 (68.50%), Query Frame = 3
Query:   72 FIKTIFAQVKTGSAEHGGLIVAEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKP-LCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFPIDTLYPYNLVRREMGISPHPRNIKQRV 668
             +  +F +V+  S  HGG  VAEVL+ H +K +FTL GGHISPIL+A EK GI V+D RHEA AVFAADAVAR++G++GV AVTAGPGLTNTVTA+KNAQMAESP+LL+GGAAA++L+GR  +Q  +   L+   +C Y     +I  I   L            GPVF+EFPIDTLYPY++V +E      P+ I  R+
Sbjct:   38 LLYRLFHKVRVSSPRHGGESVAEVLRAHGIKFVFTLVGGHISPILVACEKLGICVVDTRHEATAVFAADAVARLSGTVGVAAVTAGPGLTNTVTAVKNAQMAESPLLLIGGAAATLLQGR--VQKKNNCKLYVVFMCVYCTASFKIRLIVKCL----------FLGPVFIEFPIDTLYPYHVVEKEFSPKSTPKGIVGRI 225          
BLAST of acetolactate synthase-like protein vs. Ensembl Sea Lamprey
Match: ilvbl (ilvB (bacterial acetolactate synthase)-like [Source:NCBI gene;Acc:393639])

HSP 1 Score: 238.424 bits (607), Expect = 1.199e-74
Identity = 125/208 (60.10%), Postives = 163/208 (78.37%), Query Frame = 3
Query:   84 IFAQVKTGSAEHGGLIVAEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFPIDTLYPYNLVRREMGISPHPRNIKQRVVN*ND*INWIFYN 707
            +  +V++ S+ HGG +VAEVL+ H V+ +FTL GGH+SP+L A+EK G++V+DVRHEA AVFAADAVAR++G++GV  VTAGPGLTNTVTA+KNAQMAESPVLL+GGAAA++LKGRGALQDIDQ+ LFKPLCK   TV+ + +I P +R A+  AQS TPGPVFVE PID LYPY++V++E+     P+ +  ++      INW   N
Sbjct:   44 LLHKVESDSSRHGGELVAEVLRAHGVRFVFTLVGGHVSPVLTASEKLGMRVVDVRHEATAVFAADAVARLSGTVGVAVVTAGPGLTNTVTAVKNAQMAESPVLLMGGAAATLLKGRGALQDIDQLSLFKPLCKLCITVSTVREIVPAIRRALATAQSGTPGPVFVELPIDVLYPYHVVQKELAPKTAPKGLMGKI------INWYLLN 245          
BLAST of acetolactate synthase-like protein vs. Ensembl Sea Lamprey
Match: hacl1 (2-hydroxyacyl-CoA lyase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2058])

HSP 1 Score: 73.9442 bits (180), Expect = 3.137e-15
Identity = 50/166 (30.12%), Postives = 91/166 (54.82%), Query Frame = 3
Query:   90 AQVKTGSAEHGGLIVAEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFP 587
            AQ +TG    G  ++AE L +  ++ +F + G  I  + +AA++ GI+ I +R+E  A +AA AV  +T   G+  V +GPGL + +  + NA +   PVL+LGG++    +  GA Q+  Q+   +   K++   + +  I  I+ +A+R +    PG  +++ P
Sbjct:    9 AQDETGEQLTGAQLIAEALLEQGIEFMFGVVGVPIIEVALAAQQVGIKYIGMRNEQAACYAASAVGYLTNRPGICLVVSGPGLIHALGGMANANVNCWPVLVLGGSSDQDQEAMGAFQEFPQVESCRLYSKFSARPSSLQSIPGIVEKAVRTSIYGRPGACYIDIP 174          
BLAST of acetolactate synthase-like protein vs. Ensembl Yeast
Match: ILV2 (Acetolactate synthase; catalyses the first common step in isoleucine and valine biosynthesis and is the target of several classes of inhibitors, localizes to the mitochondria; expression of the gene is under general amino acid control [Source:SGD;Acc:S000004714])

HSP 1 Score: 71.633 bits (174), Expect = 1.431e-14
Identity = 51/159 (32.08%), Postives = 78/159 (49.06%), Query Frame = 3
Query:  120 GGLIVAEVLKKHNVKHIFTLCGGHISPILIA-AEKNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFPID 593
            GG I  E++ + NV  +F   GG I P+  A    +    +  +HE  A   A+  AR +G  GVV VT+GPG TN VT + +A     P+++  G   +   G  A Q+ D + + +   K+   V  + ++   + EA   A S  PGPV V+ P D
Sbjct:   94 GGQIFNEMMSRQNVDTVFGYPGGAILPVYDAIHNSDKFNFVLPKHEQGAGHMAEGYARASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTSAIGTDAFQEADVVGISRSCTKWNVMVKSVEELPLRINEAFEIATSGRPGPVLVDLPKD 252          
BLAST of acetolactate synthase-like protein vs. Ensembl Yeast
Match: PXP1 (Peroxisomal matrix protein; well-conserved in fungi; contains tripartite homology domain of thiamine pyrophosphate (TPP) enzymes; targeted to peroxisomes by Pex5p; contains low sequence identity with Pdc1p; mRNA identified as translated by ribosome profiling data [Source:SGD;Acc:S000000746])

HSP 1 Score: 63.5438 bits (153), Expect = 6.226e-12
Identity = 43/153 (28.10%), Postives = 80/153 (52.29%), Query Frame = 3
Query:  135 AEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFPID 593
            A++L+K+ +  +F + G  I  +      NGI+ I  R+E  A +AA A   ++   GV+ +  GPGL + +  I N+     P+L++ G+++     +G  Q++DQ+ L  P  K+T  +T   +I  I ++A+      T G  +++ P D
Sbjct:   10 AQLLQKYGIDTVFGIVGIPIVQLADTMVANGIKFIPCRNEQAASYAASAYGYISDKPGVLLIVGGPGLIHALAGIYNSMSNRWPLLVIAGSSSQSDIHKGGFQELDQVSLLSPFLKFTGKLTP-DNIDMITQKALNYCIQGTAGVSYIDVPAD 161          
BLAST of acetolactate synthase-like protein vs. Ensembl Nematostella
Match: EDO32896 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STP8])

HSP 1 Score: 259.225 bits (661), Expect = 7.781e-83
Identity = 131/189 (69.31%), Postives = 161/189 (85.19%), Query Frame = 3
Query:  108 SAEHGGLIVAEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFPIDTLYPYNLVRREMGISPHPRNIKQRVVN 674
            S  HGG +VA+VLK H VK++FTL GGHISPIL+A +  GI+V+D RHEA+ +FAADAVAR++G +GV AVTAGPGLTNTVTA+KNAQMAESP+LL+GGAAA++LKGRGALQDIDQM LFKPLCKY  T+TR+ DI P+L EA++ AQS TPGPVFVEFPIDTLYPY+LV+RE G+    + + Q++VN
Sbjct:    5 STHHGGELVADVLKAHGVKYVFTLVGGHISPILVACQNLGIRVVDTRHEASNMFAADAVARLSGVVGVAAVTAGPGLTNTVTAVKNAQMAESPLLLIGGAAATLLKGRGALQDIDQMSLFKPLCKYCATITRVADIIPVLCEALKVAQSGTPGPVFVEFPIDTLYPYSLVKRESGLKEEAKGLSQKIVN 193          
BLAST of acetolactate synthase-like protein vs. Ensembl Nematostella
Match: EDO37544 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFE8])

HSP 1 Score: 82.4185 bits (202), Expect = 7.110e-18
Identity = 51/156 (32.69%), Postives = 89/156 (57.05%), Query Frame = 3
Query:  120 GGLIVAEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFP 587
            G  ++A  L+    +++F + G  +  I IAA+  GI+ + +R+E +A +AA A+  +T   GV  V +GPGL + +  + NA     PVL++GG++    +G+GA Q+I Q+   KP CKY+   + I  IG  + +A+R +    PG  +++ P
Sbjct:   11 GATLLARALRAQGCEYMFGVVGIPVIEIAIAAQAEGIKYVGMRNEQSACYAASAIGYLTRRPGVCLVVSGPGLLHALGGLANATENCWPVLVIGGSSDLDQEGQGAFQEIPQVEAAKPYCKYSARPSSIHSIGFFVEKAVRTSIYGRPGACYLDIP 166          
BLAST of acetolactate synthase-like protein vs. Ensembl Nematostella
Match: EDO27963 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7T7])

HSP 1 Score: 80.4925 bits (197), Expect = 1.700e-17
Identity = 57/156 (36.54%), Postives = 85/156 (54.49%), Query Frame = 3
Query:  120 GGLIVAEVLKKHNVKHIFTLCGGHISPILIAAE--KNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVE 581
            G L V + L   +V  +F   GG I PI  A     + ++ I VRHE  A+ AA   ARV+G  GVV  T+GPG TN VT + +AQ+  +P++ + G   + L G  A Q+ D + +  P+ K+   VT   +I  +L +A   A+S  PGPV ++
Sbjct:   21 GSLAVIDALLSEDVSTVFGYPGGAIMPIYDALYDFNDSLKHILVRHEQGAIHAAQGYARVSGKTGVVFATSGPGATNLVTGLADAQIDSTPLVCITGQVFAHLLGTDAFQETDIINITTPITKWNYQVTDANEIPEVLAKAFYIAKSGRPGPVLID 176          
BLAST of acetolactate synthase-like protein vs. Ensembl Medaka
Match: ilvbl (ilvB acetolactate synthase like [Source:NCBI gene;Acc:101163679])

HSP 1 Score: 240.736 bits (613), Expect = 2.859e-75
Identity = 130/208 (62.50%), Postives = 159/208 (76.44%), Query Frame = 3
Query:   84 IFAQVKTGSAEHGGLIVAEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFPIDTLYPYNLVRREMGISPHPRNIKQRVVN*ND*INWIFYN 707
            +F Q +T S  HGG  VAEVL+ H VK +FTL GGHISPIL+A EK GI+++D RHEA AVFAADAVAR++G++GV  VTAGPGLTNTVTA+KNAQMAESPVLLLGG AA++L+GRGALQDIDQM LFKPLCK+  ++  + +I P LR+A+  AQS TPGPVFVEFPIDTLYPY+LV +E      P+ +   +      I+W   N
Sbjct:   36 LFHQTETESPRHGGESVAEVLRAHGVKFLFTLVGGHISPILVACEKVGIRIVDTRHEATAVFAADAVARLSGTVGVATVTAGPGLTNTVTAVKNAQMAESPVLLLGGGAATLLQGRGALQDIDQMSLFKPLCKFCASIRTVREIVPTLRKALAIAQSGTPGPVFVEFPIDTLYPYHLVSKEFAPKTPPKGLMGSI------ISWYLRN 237          
BLAST of acetolactate synthase-like protein vs. Ensembl Medaka
Match: ilvbl (ilvB acetolactate synthase like [Source:NCBI gene;Acc:101163679])

HSP 1 Score: 240.35 bits (612), Expect = 9.185e-75
Identity = 130/208 (62.50%), Postives = 159/208 (76.44%), Query Frame = 3
Query:   84 IFAQVKTGSAEHGGLIVAEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFPIDTLYPYNLVRREMGISPHPRNIKQRVVN*ND*INWIFYN 707
            +F Q +T S  HGG  VAEVL+ H VK +FTL GGHISPIL+A EK GI+++D RHEA AVFAADAVAR++G++GV  VTAGPGLTNTVTA+KNAQMAESPVLLLGG AA++L+GRGALQDIDQM LFKPLCK+  ++  + +I P LR+A+  AQS TPGPVFVEFPIDTLYPY+LV +E      P+ +   +      I+W   N
Sbjct:   36 LFHQTETESPRHGGESVAEVLRAHGVKFLFTLVGGHISPILVACEKVGIRIVDTRHEATAVFAADAVARLSGTVGVATVTAGPGLTNTVTAVKNAQMAESPVLLLGGGAATLLQGRGALQDIDQMSLFKPLCKFCASIRTVREIVPTLRKALAIAQSGTPGPVFVEFPIDTLYPYHLVSKEFAPKTPPKGLMGSI------ISWYLRN 237          
BLAST of acetolactate synthase-like protein vs. Ensembl Medaka
Match: hacl1 (2-hydroxyacyl-CoA lyase 1 [Source:NCBI gene;Acc:101156193])

HSP 1 Score: 68.5514 bits (166), Expect = 8.932e-13
Identity = 45/160 (28.12%), Postives = 87/160 (54.37%), Query Frame = 3
Query:  120 GGLIVAEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFPIDTL 599
            G  ++AE LK   V+++F + G  I  + +AA+  GI+ + +R+E  A +AA A+  +TG  G   V +GPGL + +  + NA +   PV+++GG++    +  GA Q+  Q+   +   K++   + +  I  ++ +A+R +    PG  +V+   D +
Sbjct:    6 GAELIAEALKTQKVEYMFGIVGVPIIEVAMAAQAAGIKYVGMRNEQAACYAASAIGYLTGRPGACLVVSGPGLIHALGGMANANVNCWPVVVIGGSSDRNQETTGAFQEFPQVEACRLYSKFSARPSSLEAIPSVIEKAVRTSIYGRPGACYVDIAGDMV 165          
BLAST of acetolactate synthase-like protein vs. Ensembl Medaka
Match: hacl1 (2-hydroxyacyl-CoA lyase 1 [Source:NCBI gene;Acc:101156193])

HSP 1 Score: 68.5514 bits (166), Expect = 8.970e-13
Identity = 45/160 (28.12%), Postives = 87/160 (54.37%), Query Frame = 3
Query:  120 GGLIVAEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFPIDTL 599
            G  ++AE LK   V+++F + G  I  + +AA+  GI+ + +R+E  A +AA A+  +TG  G   V +GPGL + +  + NA +   PV+++GG++    +  GA Q+  Q+   +   K++   + +  I  ++ +A+R +    PG  +V+   D +
Sbjct:    6 GAELIAEALKTQKVEYMFGIVGVPIIEVAMAAQAAGIKYVGMRNEQAACYAASAIGYLTGRPGACLVVSGPGLIHALGGMANANVNCWPVVVIGGSSDRNQETTGAFQEFPQVEACRLYSKFSARPSSLEAIPSVIEKAVRTSIYGRPGACYVDIAGDMV 165          
BLAST of acetolactate synthase-like protein vs. Ensembl Medaka
Match: hacl1 (2-hydroxyacyl-CoA lyase 1 [Source:NCBI gene;Acc:101156193])

HSP 1 Score: 61.2326 bits (147), Expect = 2.621e-10
Identity = 41/158 (25.95%), Postives = 83/158 (52.53%), Query Frame = 3
Query:  126 LIVAEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFPIDTL 599
              ++  L    V+++F + G  I  + +AA+  GI+ + +R+E  A +AA A+  +TG  G   V +GPGL + +  + NA +   PV+++GG++    +  GA Q+  Q+   +   K++   + +  I  ++ +A+R +    PG  +V+   D +
Sbjct:   19 FYISSCLSLQKVEYMFGIVGVPIIEVAMAAQAAGIKYVGMRNEQAACYAASAIGYLTGRPGACLVVSGPGLIHALGGMANANVNCWPVVVIGGSSDRNQETTGAFQEFPQVEACRLYSKFSARPSSLEAIPSVIEKAVRTSIYGRPGACYVDIAGDMV 176          
BLAST of acetolactate synthase-like protein vs. Planmine SMEST
Match: SMESG000026596.1 (SMESG000026596.1)

HSP 1 Score: 401.749 bits (1031), Expect = 1.667e-137
Identity = 213/224 (95.09%), Postives = 218/224 (97.32%), Query Frame = 3
Query:    9 FLSFIFY*VFSHWSL--INHISKFIKTIFAQVKTGSAEHGGLIVAEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEXXXXXXXXXXXXXTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFPIDTLYPYNLVRREMGISPHPRNIKQRVVN 674
            F+ F+FY + S ++L  INHISKFIKTIFAQVKTGSAEHGGLIVAEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEANAVFAADAVARVTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFPIDTLYPYNLVRREMGISPHPRNIKQRVVN
Sbjct:    4 FILFVFYILLSFFTLFLINHISKFIKTIFAQVKTGSAEHGGLIVAEVLKKHNVKHIFTLCGGHISPILIAAEKNGIQVIDVRHEANAVFAADAVARVTGSIGVVAVTAGPGLTNTVTAIKNAQMAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGPILREAIREAQSDTPGPVFVEFPIDTLYPYNLVRREMGISPHPRNIKQRVVN 227          
The following BLAST results are available for this feature:
BLAST of acetolactate synthase-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ILVBL1.941e-7456.48ilvB acetolactate synthase like [Source:HGNC Symbo... [more]
ILVBL7.062e-7056.48ilvB acetolactate synthase like [Source:HGNC Symbo... [more]
ILVBL1.218e-5161.42ilvB acetolactate synthase like [Source:HGNC Symbo... [more]
ILVBL1.752e-4761.42ilvB acetolactate synthase like [Source:HGNC Symbo... [more]
ILVBL3.499e-4466.39ilvB acetolactate synthase like [Source:HGNC Symbo... [more]
back to top
BLAST of acetolactate synthase-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
T26C12.12.119e-7967.01Acetolactate synthase-like protein [Source:UniPro... [more]
B0334.35.649e-1532.30pep chromosome:WBcel235:II:11489605:11493039:-1 ge... [more]
B0334.35.649e-1532.30pep chromosome:WBcel235:II:11489605:11492963:-1 ge... [more]
B0334.32.105e-1432.05pep chromosome:WBcel235:II:11489605:11492174:-1 ge... [more]
back to top
BLAST of acetolactate synthase-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Hacl2.874e-1632.48gene:FBgn0034488 transcript:FBtr0086322[more]
back to top
BLAST of acetolactate synthase-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ilvbl4.792e-7859.43ilvB (bacterial acetolactate synthase)-like [Sourc... [more]
ilvbl4.012e-7359.43ilvB (bacterial acetolactate synthase)-like [Sourc... [more]
ilvbl4.012e-7359.43ilvB (bacterial acetolactate synthase)-like [Sourc... [more]
hacl11.096e-1228.482-hydroxyacyl-CoA lyase 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of acetolactate synthase-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ilvbl1.609e-7357.08ilvB (bacterial acetolactate synthase)-like [Sourc... [more]
ilvbl2.265e-7361.14ilvB (bacterial acetolactate synthase)-like [Sourc... [more]
ilvbl2.330e-7361.14ilvB (bacterial acetolactate synthase)-like [Sourc... [more]
ilvbl3.647e-7361.14ilvB (bacterial acetolactate synthase)-like [Sourc... [more]
ilvbl7.224e-7359.01ilvB (bacterial acetolactate synthase)-like [Sourc... [more]
back to top
BLAST of acetolactate synthase-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ilvbl9.684e-7457.99ilvB (bacterial acetolactate synthase)-like [Sourc... [more]
Ilvbl2.552e-7357.99ilvB (bacterial acetolactate synthase)-like [Sourc... [more]
Ilvbl4.750e-7257.99ilvB (bacterial acetolactate synthase)-like [Sourc... [more]
Ilvbl1.567e-7157.99ilvB (bacterial acetolactate synthase)-like [Sourc... [more]
Ilvbl3.936e-7157.99ilvB (bacterial acetolactate synthase)-like [Sourc... [more]
back to top
BLAST of acetolactate synthase-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O61856|HACL2_CAEEL2.696e-7867.012-hydroxyacyl-CoA lyase 2 OS=Caenorhabditis elegan... [more]
sp|Q6NV04|HACL2_DANRE3.029e-7259.432-hydroxyacyl-CoA lyase 2 OS=Danio rerio OX=7955 G... [more]
sp|Q8BU33|HACL2_MOUSE2.753e-7057.992-hydroxyacyl-CoA lyase 2 OS=Mus musculus OX=10090... [more]
sp|A6QQT9|HACL2_BOVIN4.569e-7060.002-hydroxyacyl-CoA lyase 2 OS=Bos taurus OX=9913 GN... [more]
sp|A1L0T0|HACL2_HUMAN3.391e-6956.482-hydroxyacyl-CoA lyase 2 OS=Homo sapiens OX=9606 ... [more]
back to top
BLAST of acetolactate synthase-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3IPT12.904e-8266.83acetolactate synthase-like protein OS=Lingula ungu... [more]
K1QG617.211e-8266.98Acetolactate synthase-like protein OS=Crassostrea ... [more]
H2Y6A61.437e-8165.22Uncharacterized protein OS=Ciona savignyi OX=51511... [more]
A0A3Q0K1B83.817e-8166.07acetolactate synthase-like protein OS=Ciona intest... [more]
E9GG068.794e-8172.68Uncharacterized protein OS=Daphnia pulex OX=6669 G... [more]
back to top
BLAST of acetolactate synthase-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ilvbl3.522e-7362.50ilvB (bacterial acetolactate synthase)-like [Sourc... [more]
ilvbl5.360e-7362.81ilvB (bacterial acetolactate synthase)-like [Sourc... [more]
ilvbl1.891e-4953.50ilvB (bacterial acetolactate synthase)-like [Sourc... [more]
back to top
BLAST of acetolactate synthase-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ilvbl1.199e-7460.10ilvB (bacterial acetolactate synthase)-like [Sourc... [more]
hacl13.137e-1530.122-hydroxyacyl-CoA lyase 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of acetolactate synthase-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
ILV21.431e-1432.08Acetolactate synthase; catalyses the first common ... [more]
PXP16.226e-1228.10Peroxisomal matrix protein; well-conserved in fung... [more]
back to top
BLAST of acetolactate synthase-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO328967.781e-8369.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375447.110e-1832.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO279631.700e-1736.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of acetolactate synthase-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ilvbl2.859e-7562.50ilvB acetolactate synthase like [Source:NCBI gene;... [more]
ilvbl9.185e-7562.50ilvB acetolactate synthase like [Source:NCBI gene;... [more]
hacl18.932e-1328.132-hydroxyacyl-CoA lyase 1 [Source:NCBI gene;Acc:10... [more]
hacl18.970e-1328.132-hydroxyacyl-CoA lyase 1 [Source:NCBI gene;Acc:10... [more]
hacl12.621e-1025.952-hydroxyacyl-CoA lyase 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of acetolactate synthase-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000026596.11.667e-13795.09SMESG000026596.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011014 ID=SMED30011014|Name=acetolactate synthase-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=830bp
CTTTTATTTTTTTGTCTTTTATATTTTATTAAGTTTTTTCACACTGGTCT
TTGATAAATCATATTTCAAAATTTATTAAAACAATTTTTGCTCAAGTGAA
AACTGGTTCAGCCGAGCACGGTGGATTAATTGTAGCTGAAGTACTAAAAA
AACACAATGTCAAACATATATTCACTTTATGTGGTGGACATATTTCACCG
ATTTTGATCGCGGCTGAAAAGAATGGGATACAAGTCATAGACGTTCGTCA
TGAAGCTAATGCAGTATTTGCTGCTGATGCAGTTGCTAGAGTAACAGGTT
CAATTGGTGTTGTTGCGGTGACAGCCGGTCCTGGATTGACAAACACTGTG
ACCGCAATTAAGAACGCGCAAATGGCAGAATCTCCGGTTTTGTTATTGGG
TGGAGCAGCAGCAAGTATTCTTAAAGGCCGAGGAGCGTTACAAGATATCG
ATCAAATGTGTCTTTTCAAGCCCCTGTGCAAATACACGAAAACTGTGACC
AGAATTTGTGACATTGGACCGATTTTGCGAGAAGCAATCCGAGAAGCCCA
ATCAGACACTCCAGGACCAGTTTTTGTGGAATTCCCCATCGATACACTGT
ATCCATACAATTTGGTACGACGCGAGATGGGAATATCCCCTCACCCGCGC
AATATCAAACAACGCGTTGTCAACTGAAATGATTAGATTAATTGGATCTT
CTACAATTGTTAAATTTTTCTGTCGGTTCGCTTCTACCGTATTTACAAAT
ATCTTCTGACCAATACAACGGATGTCTAGTTAAAAGATATCAAACGGTCC
AAATCAACATCGAAATTTGTTGTCATAAAG
back to top

protein sequence of SMED30011014-orf-1

>SMED30011014-orf-1 ID=SMED30011014-orf-1|Name=SMED30011014-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=102bp
MAESPVLLLGGAAASILKGRGALQDIDQMCLFKPLCKYTKTVTRICDIGP
ILREAIREAQSDTPGPVFVEFPIDTLYPYNLVRREMGISPHPRNIKQRVV
N*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0003001lateral region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR012001Thiamin_PyroP_enz_TPP-bd_dom
IPR029061THDP-binding
Vocabulary: molecular function
TermDefinition
GO:0030976thiamine pyrophosphate binding
GO:0000287magnesium ion binding
GO:0003824catalytic activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane