Lectin 2b

Overview
NameLectin 2b
Smed IDSMED30011012
Length (bp)2023
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Lectin 2b (SMED30011012) t-SNE clustered cells

Violin plots show distribution of expression levels for Lectin 2b (SMED30011012) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Lectin 2b (SMED30011012) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Lectin 2b (SMED30011012) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Lectin 2b vs. Ensembl Human
Match: MRC1 (mannose receptor C-type 1 [Source:HGNC Symbol;Acc:HGNC:7228])

HSP 1 Score: 87.0409 bits (214), Expect = 8.619e-21
Identity = 111/546 (20.33%), Postives = 206/546 (37.73%), Query Frame = 3
Query:   96 FVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYR-LPSGLWNDITCLARIWAICQKDSEV--------------------STDQLEIEGNIFVVSKG-KMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNS--DLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGR-VENCAHGYLNYDSLWNDLPC-HFNLWVICYRSEIRAPGADPNTLIA--------------------SYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPN-GGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKI----------------KDNENFEIDMDNMM---VSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGE------NCIFIL 1517
             +  TL T+ EA Q+C +    L  +    + A +  F        +W   +D   +G F  +    + + ++ ++ P  GR   C+ +   +  GLW+ + C  +   +C+  +E                     ++ +  +   ++   K  K T+ +++++C A    +  I +  +   +      + S   L+W+          +  SDG  + Y+N+  GEP   + VE C     +    WND+ C H N W IC   + + P  +P                         S ++ T   A+ +CK     +V   + +E   +  +  R  +   +  G    L+ K+   + + + +  +  GEPN    +ENC+  Y S  G WND  C Y N F IC + +  I                K+  NF  +    +   +  ER  + EA + C   G  L  + ++ + A L    K       W   ND   E  ++ ++   + Y NW    P G R        +C+ I+
Sbjct:  517 MIGHTLSTFAEANQTCNNENAYLTTIEDRYEQAFLTSFVGLRPEKYFWTGLSDIQTKGTFQWTIEEEVRFTHWNSDMP--GRKPGCVAMRTGIAGGLWDVLKCDEKAKFVCKHWAEGVTHPPKPTTTPEPKCPEDWGASSRTSLCFKLYAKGKHEKKTWFESRDFCRALGGDLASINNKEEQQTIWRLITASGSYHKLFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPTMSWNDINCEHLNNW-ICQIQKGQTPKPEPTPAPQDNPPVTEDGWVIYKDYQYYFSKEKETMDNARAFCKRNFGDLVSIQSESEKKFLWKYVNRNDAQSAYFIGLLISLDKKFAWMDGSKVDYVSWATGEPNFANEDENCVTMY-SNSGFWNDINCGYPNAF-ICQRHNSSINATTVMPTMPSVPSGCKEGWNFYSNKCFKIFGFMEEERKNWQEARKACIGFGGNLVSIQNEKEQAFLTYHMKDSTFS-AWTGLNDVNSEHTFLWTDGRGVHYTNWGKGYPGGRRSSLSYEDADCVVII 1056          

HSP 2 Score: 34.2686 bits (77), Expect = 8.619e-21
Identity = 35/158 (22.15%), Postives = 61/158 (38.61%), Query Frame = 1
Query: 1522 EEGTWRDIACTNKYLAICTL-------NPNAGAKT--------ADYHFTKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDS----YWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSFATGLWVDSKCDDFNSVVC 1938
            E G W D  C +K   IC         NP A  +T        + Y   + K  +  A  YCK     +  + +  SN        +L++++     W+  N N  + ++  T+   + Y N+AA+ P       C+     G W  + C++    +C
Sbjct: 1062 EAGKWMDDTCDSKRGYICQTRSDPSLTNPPATIQTDGFVKYGKSSYSLMRQKFQWHEAETYCKLHNSLIASILDPYSNAF-----AWLQMETSNERVWIALNSNLTDNQYTWTDKWRVRYTNWAADEPK--LKSACVYLDLDGYWKTAHCNESFYFLC 1212          

HSP 3 Score: 82.8037 bits (203), Expect = 1.231e-15
Identity = 118/527 (22.39%), Postives = 202/527 (38.33%), Query Frame = 3
Query:  126 EALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPN--GGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVSTDQL-EIEGNI-----------FVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEG--KWVDSDGKDLIYKN--FPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYR--------------SEIRAP---GADPNTLI-------ASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSD-----LYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVN-ENC--LNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFEIDMDNMMV---------------SAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPN-GNRGENCI 1508
            +AL +C+  G  L  +++ E+   +         D  WI  ND   +  F  S G  +T+  +   EP+    R E+C+ V +   G W D  C   +  IC+  S     ++ E+E              +++     TFA+A + C+  +  +  I    + A + SF        +W   +DI T+G  +W   +     + N   P  +PG   +     G      LW+ L C      +C                 E + P   GA   T +         +++ T+ E++D+C+A G  +   NN  E   +    R IT+      L+WL          +  S+ + + ++ +  GEPN   N E C  L G  ++   WND  C + N + IC     +    E      DN  V               S E+ T + A  FC+     L  + S+ +   L  +  +  A   +  G   + + K+   + + + Y +WA  EPN  N  ENC+
Sbjct:  386 DALTTCRKEGGDLTSIHTIEELDFIISQLGYEPNDELWIGLNDIKIQMYFEWSDGTPVTFTKWLRGEPSHENNRQEDCV-VMKGKDGYWADRGCEWPLGYICKMKSRSQGPEIVEVEKGCRKGWKKHHFYCYMIGHTLSTFAEANQTCNNENAYLTTIEDRYEQAFLTSFVGLRPEKYFWTGLSDIQTKGTFQWTIEEEVRFTHWNSDMPGRKPGCVAMRTGIAG-----GLWDVLKCDEKAKFVCKHWAEGVTHPPKPTTTPEPKCPEDWGASSRTSLCFKLYAKGKHEKKTWFESRDFCRALGGDLASINNKEEQQTIW---RLITASGSYHKLFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPTMS--WNDINCEHLNNW-ICQIQKGQTPKPEPTPAPQDNPPVTEDGWVIYKDYQYYFSKEKETMDNARAFCKRNFGDLVSIQSESEKKFLWKYVNRNDAQSAYFIGLLISLDKKFAWMDGSKVDYVSWATGEPNFANEDENCV 900          

HSP 4 Score: 79.7221 bits (195), Expect = 1.279e-14
Identity = 97/410 (23.66%), Postives = 176/410 (42.93%), Query Frame = 3
Query:   96 FVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSE------NCINVYRLPS---GLWNDITCLARIWAICQ--KDSEVSTDQLEIEGNIFV--------VSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYRS-EIRA------PGADPNT--------------LIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPC-PYKNLFAICAKDSL 1202
            F+ +    + EA ++C   G  LV + + ++ A +  +  K    S W   ND  +E  F+ + G  + Y N+G   P G RS       +C+ +    S   G W D TC ++   ICQ   D  ++     I+ + FV        + + K  + +A+ YC   +  +  I     NA       ET+++  W+  N  +T+ ++  +D   + Y N+   EP   ++++ A  YL+ D  W    C+ + + +C RS EI A      PG  P +              + +SY R  + +A   C   G  +V   +AAE++ +      + S   +  G    +EG W+    + +    ++ G+P+G  N+ C+  + S  G W++  C  YK    IC +  +
Sbjct:  962 FMEEERKNWQEARKACIGFGGNLVSIQNEKEQAFLT-YHMKDSTFSAWTGLNDVNSEHTFLWTDGRGVHYTNWGKGYPGGRRSSLSYEDADCVVIIGGASNEAGKWMDDTCDSKRGYICQTRSDPSLTNPPATIQTDGFVKYGKSSYSLMRQKFQWHEAETYCKLHNSLIASILDPYSNAFAW-LQMETSNERVWIALNSNLTDNQYTWTDKWRVRYTNWAADEP---KLKS-ACVYLDLDGYWKTAHCNESFYFLCKRSDEIPATEPPQLPGRCPESDHTAWIPFHGHCYYIESSYTR-NWGQASLECLRMGSSLVSIESAAESSFLSYRVEPLKSKTNFWIGLFRNVEGTWLWINNSPVSFVNWNTGDPSGERND-CVALHAS-SGFWSNIHCSSYKGY--ICKRPKI 1360          

HSP 5 Score: 73.9442 bits (180), Expect = 7.154e-13
Identity = 101/522 (19.35%), Postives = 198/522 (37.93%), Query Frame = 3
Query:  102 TKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQK------------DSEVST----DQLEIEGNIFVVSKG-KMTFADAQEYCSARSLKMIRIGHALD--NAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPG--GGRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGADPNTL----------------IASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSL-DGLWNDFPCPYKNLFAI--------------------CAKD-SLKIKDNENFEIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAF--AKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPN 1484
            +K+ +T+++A +SC+ +   L+ +    +   + G  +  L    WI  N  +    +  S  +   Y N+    P+    ++C+++    +  W ++ C+ ++  IC+K            +S+V T          G+ + + +  K    DA   C      +  I H ++  + I+     E N +L W+  NDI  +  +  SDG  + +  +  GEP     R E+C       D  W D  C + L  IC + + R+ G +   +                +  +   TF EA   C  +   +    +  E A +  F        +W   +D + +G +  + E +++   ++   P  G    C+     +  GLW+   C  K  F                      C +D     + +  F++         E+ T+ E+  FCR  G  LA +N++ +   +     A       +W+     +    +  S+ + + Y+NWA  EPN
Sbjct:  234 SKSALTWHQARKSCQQQNAELLSITEIHEQTYLTGLTSS-LTSGLWIGLNSLSFNSGWQWSDRSPFRYLNWLPGSPSAEPGKSCVSLNPGKNAKWENLECVQKLGYICKKGNTTLNSFVIPSESDVPTHCPSQWWPYAGHCYKIHRDEKKIQRDALTTCRKEGGDLTSI-HTIEELDFIISQLGYEPNDEL-WIGLNDIKIQMYFEWSDGTPVTFTKWLRGEPSHENNRQEDCV-VMKGKDGYWADRGCEWPLGYIC-KMKSRSQGPEIVEVEKGCRKGWKKHHFYCYMIGHTLSTFAEANQTCNNENAYLTTIEDRYEQAFLTSFVGLRPEKYFWTGLSDIQTKGTFQWTIEEEVRFTHWNSDMP--GRKPGCVAMRTGIAGGLWDVLKCDEKAKFVCKHWAEGVTHPPKPTTTPEPKCPEDWGASSRTSLCFKLYAKG---KHEKKTWFESRDFCRALGGDLASINNKEEQQTIWRLITASGSYHKLFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPN 745          

HSP 6 Score: 72.7886 bits (177), Expect = 1.683e-12
Identity = 109/528 (20.64%), Postives = 202/528 (38.26%), Query Frame = 3
Query:   96 FVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPN-GGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVSTDQLEIEGNIFVVSKG----------------------KMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVE------NCA---HGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGADPNTLI---------ASY----DRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFEI-----DMDNM-----------MVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADY-YWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNR 1493
            + +K   T + A   CK     LV + S  +   +  + N+  A S +  G   + +  F    G+ + Y ++ T EPN     ENC+ +Y   SG WNDI C      ICQ+ +  S +   +   +  V  G                      +  + +A++ C      ++ I +  + A +    +++     W   ND+ +E  ++ +DG+ + Y N+  G PGG R        +C     G  N    W D  C      IC      +    P T+          +SY     +  + EA+ YCK     +    +   NA         +++  W+  N    + ++  +++  +++  +   EP   +   C+  YL LDG W    C     F    K S +I   E  ++     + D+            + S+    + +A   C   G+ L  + S  +++ L+   + + +   +WI G     EG W+  N + + + NW   +P+G R
Sbjct:  813 YFSKEKETMDNARAFCKRNFGDLVSIQSESEKKFLWKYVNRNDAQSAYFIGLLISLDKKFAWMDGSKVDYVSWATGEPNFANEDENCVTMYS-NSGFWNDINCGYPNAFICQRHNS-SINATTVMPTMPSVPSGCKEGWNFYSNKCFKIFGFMEEERKNWQEARKACIGFGGNLVSIQNEKEQAFLTYHMKDSTFSA-WTGLNDVNSEHTFLWTDGRGVHYTNWGKGYPGGRRSSLSYEDADCVVIIGGASNEAGKWMDDTCDSKRGYICQTRSDPSLTNPPATIQTDGFVKYGKSSYSLMRQKFQWHEAETYCKLHNSLIASILDPYSNAFAW-LQMETSNERVWIALNSNLTDNQYTWTDKWRVRYTNWAADEPK--LKSACV--YLDLDGYWKTAHC--NESFYFLCKRSDEIPATEPPQLPGRCPESDHTAWIPFHGHCYYIESSYTRNWGQASLECLRMGSSLVSIESAAESSFLSYRVEPLKSKTNFWI-GLFRNVEGTWLWINNSPVSFVNWNTGDPSGER 1329          

HSP 7 Score: 52.7582 bits (125), Expect = 2.490e-6
Identity = 74/376 (19.68%), Postives = 137/376 (36.44%), Query Frame = 3
Query:  480 VVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYR-----------SEIRAPGADPNTL---------IASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVN--ENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFEIDMDN-----------MMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENCI 1508
            + SK  +T+  A++ C  ++ +++ I    +   +        S L W+  N +     W  SD     Y N+  G P     ++C       ++ W +L C   L  IC +           SE   P   P+           I   ++   ++A   C+ +G  +   +   E   +        +D  W+  ND K++  +  S+   +    +  GEP+   N  E+C+      DG W D  C +  L  IC   S + +  E  E++               M+     T+ EA Q C      L  +  + + A L +F       Y+W   +D   +G +  +    + + +W +  P   R   C+
Sbjct:  232 INSKSALTWHQARKSCQQQNAELLSITEIHEQTYLTGLTSSLTSGL-WIGLNSLSFNSGWQWSDRSPFRYLNWLPGSPSAEPGKSCVSLNPGKNAKWENLECVQKLGYICKKGNTTLNSFVIPSESDVPTHCPSQWWPYAGHCYKIHRDEKKIQRDALTTCRKEGGDLTSIHTIEELDFIISQLGYEPNDELWIGLNDIKIQMYFEWSDGTPVTFTKWLRGEPSHENNRQEDCVV-MKGKDGYWADRGCEWP-LGYICKMKS-RSQGPEIVEVEKGCRKGWKKHHFYCYMIGHTLSTFAEANQTCNNENAYLTTIEDRYEQAFLTSFVGLRPEKYFWTGLSDIQTKGTFQWTIEEEVRFTHWNSDMP--GRKPGCV 601          
BLAST of Lectin 2b vs. Ensembl Human
Match: MRC2 (mannose receptor C type 2 [Source:HGNC Symbol;Acc:HGNC:16875])

HSP 1 Score: 82.0333 bits (201), Expect = 2.609e-15
Identity = 82/395 (20.76%), Postives = 155/395 (39.24%), Query Frame = 3
Query:   42 FILITLDSCRSDIDVNTL------FVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQKDS-----------------EVSTDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGR--VENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGA--------------DPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGK--WVDSEENDLKHKGF-HPGEPNGGV 1100
            F  I  + C +  D + L      F  ++ +++ EA  SC+ +G  L+ +    +   +NG      + + WI  ND    G +  S  + L Y N+ +++P+    ENC  +    SG W +  C   +  +C+K                   E        +G+ + +   K ++ ++++ C      ++ I    +   +    ++   +L W+  ND+  +  +  SDG  + + ++   EP   R  +E+C   +   +  WND PC+ +L  IC ++   + GA               P+      D++T+ EA+  C   G ++V   N  E A V         + +W    D    G   W+  +E    H     PG   GG 
Sbjct:  227 FCPIKSNDCETFWDKDQLTDSCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGY-SSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPSEENCGVIRTESSGGWQNRDCSIALPYVCKKKPNATAEPTPPDRWANVKVECEPSWQPFQGHCYRLQAEKRSWQESKKACLRGGGDLVSIHSMAELEFITKQIKQEVEEL-WIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVTIW-GPEGRWNDSPCNQSLPSICKKAGQLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQVTYSEARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFFWLSGDEVMYTHWNRDQPGYSRGGC 618          

HSP 2 Score: 78.9518 bits (193), Expect = 1.955e-14
Identity = 84/404 (20.79%), Postives = 162/404 (40.10%), Query Frame = 3
Query:  414 WAIC---QKDSEVSTDQLEIEGNIFVVS-KGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYR-----SEIRAPGADPNTLIA---------------SYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEG--KWVDSEENDLKHKGFHPGEPNGGVN--ENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFEIDMDN---------MMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENCIFI 1514
            W  C     D E   D+ ++  + +  + +  +++ +A   C  +   ++ I    +   ++      +S L W+  ND+ T G W  SD   L Y N+   +P     ENC          W +  C   L  +C +     +E   P    N  +                  ++ ++QE++  C   G  +V  ++ AE   +    ++   +L W+  ND KL+   +W D       H  +HP EPN   +  E+C+  +   +G WND PC  ++L +IC K     +     +                +  ++ TY+EA + C   G+QL  + ++ + A +++       +Y+W    D    G +   + + + Y +W   +P  +RG  C+ +
Sbjct:  225 WGFCPIKSNDCETFWDKDQLTDSCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYSSTL-WIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPSEENCGVIRTESSGGWQNRDCSIALPYVCKKKPNATAEPTPPDRWANVKVECEPSWQPFQGHCYRLQAEKRSWQESKKACLRGGGDLVSIHSMAELEFITKQIKQEVEEL-WIGLNDLKLQMNFEWSDGSLVSFTH--WHPFEPNNFRDSLEDCVTIW-GPEGRWNDSPC-NQSLPSICKKAGQLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQVTYSEARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFFWLSGDEVMYTHWNRDQPGYSRG-GCVAL 621          

HSP 3 Score: 69.707 bits (169), Expect = 1.507e-11
Identity = 112/538 (20.82%), Postives = 200/538 (37.17%), Query Frame = 3
Query:  117 TYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADS---------YWIDGNDETAEG--IFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQ-----------KDSEVSTDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRI-GHALDNAIVHSFAR--ETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGG-GRVENCAHGYLNYDSLWNDLPCHFNLWVICYRS----EIRAP-------GADPNTLIA------------SYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLS-----------LDGLWNDFPCPYKNLFAICAKDS--------LKIKDNENFEIDMDN--MMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWID--GNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENCIFI 1514
            ++ +A  +C+  G +L+ + S E+   V    NK+  +S         +WI  N     G   +  S G   +Y NF  +  +      C  V  L S  W  + C  ++  IC+              +   + L  +   +   +   T+A AQ  C+    ++  +   A  + + H+  +        +W+  +   ++G++  +DG  + + ++  G+P   G+ + C +   + +  W D  C   L  IC RS    E + P       G  P+  I                R+ + EAQ  C+ Q  ++V   N  E A +      +T DL W+  + ++ + +WV  E+  L +  + PGEP+G       N   S             G W+D  C  +    IC K +          +      E+   N    +  +   +++AL  C +R   LA V      A L   A+ +     WI   G + +    WV      L Y  W   EP    G  C ++
Sbjct:  696 SWVQAQGACQELGAQLLSLASYEEEHFVANMLNKIFGESEPEIHEQHWFWIGLNRRDPRGGQSWRWSDGVGFSYHNFDRSRHDDDDIRGCA-VLDLASLQWVAMQCDTQLDWICKIPRGTDVREPDDSPQGRREWLRFQEAEYKFFEHHSTWAQAQRICTWFQAELTSVHSQAELDFLSHNLQKFSRAQEQHWWIGLHTSESDGRFRWTDGSIINFISWAPGKPRPVGKDKKCVYMTASRED-WGDQRCLTALPYICKRSNVTKETQPPDLPTTALGGCPSDWIQFLNKCFQVQGQEPQSRVKWSEAQFSCEQQEAQLVTITNPLEQAFITASLPNVTFDL-WIGLHASQRDFQWV--EQEPLMYANWAPGEPSGPSPAPSGNKPTSCAVVLHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLSPSPAALPPAPGTELSYLNGTFRLLQKPLRWHDALLLCESRNASLAYVPDPYTQAFLTQAARGLRTP-LWIGLAGEEGSRRYSWVSEEP--LNYVGWQDGEPQQPGG--CTYV 1223          

HSP 4 Score: 52.7582 bits (125), Expect = 2.454e-6
Identity = 85/416 (20.43%), Postives = 164/416 (39.42%), Query Frame = 3
Query:  117 TYNEALQSCKSRGMRLVRVNS-AEDNAVVNGFA--NKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNG-GRSENCINVYRLPSGL-WNDITCLARIWAICQKDSEV----------------STDQLEIEGNIFVVS----KGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGG-------RVENCA----HGYLNYDSLWNDLPC-HFNLWVICYRS-----------EIRAPGADPNTLIASY----DRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLY-WLDGNDAKLEGKWVDSEENDLKHKGFHPGEPN--GGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKDS 1199
            T+ +A + C      L  V+S AE + + +     ++     +WI  +   ++G F  + G+++ + ++   +P   G+ + C  VY   S   W D  CL  +  IC++ +                   +D ++     F V     + ++ +++AQ  C  +  +++ I + L+ A + +       DL W+  +    + +WV+ +   L+Y N+  GEP G        +  +CA        ++   W+D  C       IC +               APG + + L  ++      L + +A   C+++   +    +    A +   AR + + L+  L G +      WV   E  L + G+  GEP   GG        Y+ +DG W    C  K   A+C   S
Sbjct:  845 TWAQAQRICTWFQAELTSVHSQAELDFLSHNLQKFSRAQEQHWWIGLHTSESDGRFRWTDGSIINFISWAPGKPRPVGKDKKC--VYMTASREDWGDQRCLTALPYICKRSNVTKETQPPDLPTTALGGCPSDWIQFLNKCFQVQGQEPQSRVKWSEAQFSCEQQEAQLVTITNPLEQAFITASLPNVTFDL-WIGLHASQRDFQWVEQE--PLMYANWAPGEPSGPSPAPSGNKPTSCAVVLHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLSPSPAALPPAPGTELSYLNGTFRLLQKPLRWHDALLLCESRNASLAYVPDPYTQAFLTQAARGLRTPLWIGLAGEEGSRRYSWVS--EEPLNYVGWQDGEPQQPGGCT------YVDVDGAWRTTSCDTKLQGAVCGVSS 1247          
BLAST of Lectin 2b vs. Ensembl Human
Match: CLEC3B (C-type lectin domain family 3 member B [Source:HGNC Symbol;Acc:HGNC:11891])

HSP 1 Score: 59.6918 bits (143), Expect = 1.661e-9
Identity = 34/109 (31.19%), Postives = 57/109 (52.29%), Query Frame = 3
Query:  117 TYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADS--YWIDGNDETAEGIFVNSKGNLLTYKNFGTN---EPNGGRSENCINVYRLPSGLWNDITCLARIWAICQ 428
            T++EA + C SRG  L    +  +N  +  +  + + +    W+  ND  AEG +V+  G  + YKN+ T    +P+GG++ENC  +    +G W D  C  ++  ICQ
Sbjct:   90 TFHEASEDCISRGGTLGTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQ 198          

HSP 2 Score: 56.225 bits (134), Expect = 2.841e-8
Identity = 41/121 (33.88%), Postives = 56/121 (46.28%), Query Frame = 1
Query: 1618 FTKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLD-----SYWLDGNDNAEEGKWVDTNNSTLLYKNFAAE---APNGGRDKNC--LQSFATGLWVDSKCDDFNSVVCYGSI 1950
            FT+ K TF  A+  C S G  +   +  + N  L +   YL+         WL  ND A EG WVD   + + YKN+  E    P+GG+ +NC  L   A G W D +C D    +C   I
Sbjct:   85 FTQTK-TFHEASEDCISRGGTLGTPQTGSENDALYE---YLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGI 201          

HSP 3 Score: 54.6842 bits (130), Expect = 7.262e-8
Identity = 34/108 (31.48%), Postives = 50/108 (46.30%), Query Frame = 3
Query:  501 TFADAQEYCSARSLKMIRIGHALDNAIVHSFARET--NSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFP---VGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVIC 809
            TF +A E C +R   +       +N  ++ + R++  N    W+  ND+  EG WVD  G  + YKN+      +P GG+ ENCA      +  W D  C   L  IC
Sbjct:   90 TFHEASEDCISRGGTLGTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYIC 197          

HSP 4 Score: 52.7582 bits (125), Expect = 3.261e-7
Identity = 28/98 (28.57%), Postives = 47/98 (47.96%), Query Frame = 3
Query: 1227 EIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADY--YWIDGNDHTEEGKWVDSNANVLPYKNWA---ATEPNGNRGENC 1505
            ++ M   +   +  T++EA + C +RG  L    +  +N  L  + ++ V +    W+  ND   EG WVD     + YKNW      +P+G + ENC
Sbjct:   76 KVHMKCFLAFTQTKTFHEASEDCISRGGTLGTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENC 173          
BLAST of Lectin 2b vs. Ensembl Human
Match: CLEC3B (C-type lectin domain family 3 member B [Source:HGNC Symbol;Acc:HGNC:11891])

HSP 1 Score: 58.151 bits (139), Expect = 2.948e-9
Identity = 34/109 (31.19%), Postives = 57/109 (52.29%), Query Frame = 3
Query:  117 TYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADS--YWIDGNDETAEGIFVNSKGNLLTYKNFGTN---EPNGGRSENCINVYRLPSGLWNDITCLARIWAICQ 428
            T++EA + C SRG  L    +  +N  +  +  + + +    W+  ND  AEG +V+  G  + YKN+ T    +P+GG++ENC  +    +G W D  C  ++  ICQ
Sbjct:   48 TFHEASEDCISRGGTLGTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQ 156          

HSP 2 Score: 55.8398 bits (133), Expect = 1.857e-8
Identity = 41/121 (33.88%), Postives = 56/121 (46.28%), Query Frame = 1
Query: 1618 FTKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLD-----SYWLDGNDNAEEGKWVDTNNSTLLYKNFAAE---APNGGRDKNC--LQSFATGLWVDSKCDDFNSVVCYGSI 1950
            FT+ K TF  A+  C S G  +   +  + N  L +   YL+         WL  ND A EG WVD   + + YKN+  E    P+GG+ +NC  L   A G W D +C D    +C   I
Sbjct:   43 FTQTK-TFHEASEDCISRGGTLGTPQTGSENDALYE---YLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGI 159          

HSP 3 Score: 55.0694 bits (131), Expect = 3.292e-8
Identity = 35/122 (28.69%), Postives = 54/122 (44.26%), Query Frame = 3
Query:  459 EIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARET--NSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFP---VGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVIC 809
            ++    F+      TF +A E C +R   +       +N  ++ + R++  N    W+  ND+  EG WVD  G  + YKN+      +P GG+ ENCA      +  W D  C   L  IC
Sbjct:   34 KVHMKCFLAFTQTKTFHEASEDCISRGGTLGTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYIC 155          

HSP 4 Score: 51.9878 bits (123), Expect = 3.295e-7
Identity = 28/101 (27.72%), Postives = 48/101 (47.52%), Query Frame = 3
Query: 1227 EIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADY--YWIDGNDHTEEGKWVDSNANVLPYKNWA---ATEPNGNRGENCIFI 1514
            ++ M   +   +  T++EA + C +RG  L    +  +N  L  + ++ V +    W+  ND   EG WVD     + YKNW      +P+G + ENC  +
Sbjct:   34 KVHMKCFLAFTQTKTFHEASEDCISRGGTLGTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVL 134          
BLAST of Lectin 2b vs. Ensembl Human
Match: CLEC3A (C-type lectin domain family 3 member A [Source:HGNC Symbol;Acc:HGNC:2052])

HSP 1 Score: 57.7658 bits (138), Expect = 6.873e-9
Identity = 31/113 (27.43%), Postives = 59/113 (52.21%), Query Frame = 3
Query:   96 FVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVL--ADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQ 428
              ++ L  ++EA + C S+G  LV   ++++   +  +  + L   + +W+  ND   EG FV+  G  +++ N+   +PNGG+ ENC+   +   G W+D  C +    IC+
Sbjct:   80 LASEGLKHFHEANEDCISKGGILVIPRNSDEINALQDYGKRSLPGVNDFWLGINDMVTEGKFVDVNGIAISFLNWDRAQPNGGKRENCVLFSQSAQGKWSDEACRSSKRYICE 192          

HSP 2 Score: 55.4546 bits (132), Expect = 3.901e-8
Identity = 35/145 (24.14%), Postives = 69/145 (47.59%), Query Frame = 3
Query:  381 LWNDITCLARIWAICQKDSEVSTDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDL--YWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVIC 809
            LW ++  L  I A+      V     ++    ++ S+G   F +A E C ++   ++   ++ +   +  + + +   +  +W+  ND+VTEGK+VD +G  + + N+   +P GG+ ENC     +    W+D  C  +   IC
Sbjct:   51 LWTEVNALKEIQAL----QTVCLRGTKVHKKCYLASEGLKHFHEANEDCISKGGILVIPRNSDEINALQDYGKRSLPGVNDFWLGINDMVTEGKFVDVNGIAISFLNWDRAQPNGGKRENCVLFSQSAQGKWSDEACRSSKRYIC 191          

HSP 3 Score: 52.373 bits (124), Expect = 4.346e-7
Identity = 35/110 (31.82%), Postives = 50/110 (45.45%), Query Frame = 1
Query: 1639 FEAAALYCKSVGLKVVRVRNLNSNRLLADSAK--YLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCL--QSFATGLWVDSKCDDFNSVVCYGSIKR 1956
            F  A   C S G  +V  RN +    L D  K     ++ +WL  ND   EGK+VD N   + + N+    PNGG+ +NC+     A G W D  C      +C  +I +
Sbjct:   88 FHEANEDCISKGGILVIPRNSDEINALQDYGKRSLPGVNDFWLGINDMVTEGKFVDVNGIAISFLNWDRAQPNGGKRENCVLFSQSAQGKWSDEACRSSKRYICEFTIPQ 197          

HSP 4 Score: 49.6766 bits (117), Expect = 3.479e-6
Identity = 33/115 (28.70%), Postives = 51/115 (44.35%), Query Frame = 3
Query:  822 IRAPGADPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDL--YWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPC 1160
            +R         +AS     F EA + C ++G  +V   N+ E   +  + +R    +  +WL  ND   EGK+VD     +    +   +PNGG  ENC+    S  G W+D  C
Sbjct:   69 LRGTKVHKKCYLASEGLKHFHEANEDCISKGGILVIPRNSDEINALQDYGKRSLPGVNDFWLGINDMVTEGKFVDVNGIAISFLNWDRAQPNGGKRENCVLFSQSAQGKWSDEAC 183          
BLAST of Lectin 2b vs. Ensembl Celegans
Match: clec-51 (C-type LECtin [Source:UniProtKB/TrEMBL;Acc:W6RTE8])

HSP 1 Score: 49.2914 bits (116), Expect = 5.681e-6
Identity = 38/167 (22.75%), Postives = 66/167 (39.52%), Query Frame = 3
Query:  483 VSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGN----DIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGADPNTLIASY--DRLTFQEAQDYCKAQGLKMVRANNAAENALVHG 965
            V +   +F  A+E C+  S  ++ I + +DN  + S A++      W+       D+     W  +DG +  Y+N+ VG+P       C        + W    C   L  IC  S    P   P+  I S+     T+ +  D+C    ++    N+A  +    G
Sbjct:   36 VFRTASSFQSAEEICATLSGHLVSIHNTIDNTFISSQAQKYFDGGVWLGAKTTAPDVTNPLNWYWTDGSNFDYQNYKVGQPSPQGDTACMQ-LQTGTAKWQTTNCTAQLPFICSYSSSVTPTC-PSVTIPSHCPSGYTWYDETDFCYKNTVRFTSFNDARSSCQADG 200          
BLAST of Lectin 2b vs. Ensembl Celegans
Match: clec-52 (C-type LECtin [Source:UniProtKB/TrEMBL;Acc:Q17452])

HSP 1 Score: 48.521 bits (114), Expect = 7.687e-6
Identity = 60/262 (22.90%), Postives = 98/262 (37.40%), Query Frame = 3
Query:  795 LWVICYRSEIRAPGADPNTLI--ASYDRLT-------FQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGN----DAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFEID------------MDNMMVSAERYT-YNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVA--DYYWIDGNDHT----EEGKWVDSNANVLPYKNWAATEPN 1484
            L V C+ + + +    P  L   +S   LT       FQ A+  C      +V  +NA +N  V G A++      WL       D      W  ++  D  ++ +  G+P    +  C+    +    W    C  K  F IC+  +  +       I              D    +  +YT +N+A   C+  G  LA ++S  +N  L  F+K      D  W  G+       +  KW  ++ +V+ Y NW   EPN
Sbjct:    6 LLVFCFSAPLISAQCGPGALYQQSSSRCLTLFRAAVDFQTAESICATLNGHLVSVHNAIDNTFVSGQAQKFIDGGAWLGAQASAPDVTNPLNWYWTDGTDFNYQNYKVGQPTQTGSTACMQ-LETGTSKWQTANCTTKLPF-ICSASASAMPTFPAVTIPSHCPSGYTWFELTDFCYKNTVQYTNFNDARSACQADGGDLASIHSLAENTFLVGFSKAGCTNKDKDWT-GDVFIGLVFQNSKWQWTDGSVVDYVNWGDGEPN 264          
BLAST of Lectin 2b vs. Ensembl Fly
Match: tfc (gene:FBgn0035199 transcript:FBtr0072661)

HSP 1 Score: 50.8322 bits (120), Expect = 6.189e-7
Identity = 34/111 (30.63%), Postives = 53/111 (47.75%), Query Frame = 3
Query:  126 EALQSCKSRGMRLVRVNSAEDNAVVNGFANK--VLADSYWIDGNDETAEG-IFVNSKGNLLTYKNFGTNEPN-----GGRSENCINVY-RLPSGL-WNDITCLARIWAICQ 428
            +A Q C+  GM L  ++S E+N  +        +  + +WI G D   EG  F  + G  +T+ N+   EPN      G  ENC+ ++ R   GL WND  C    + +C+
Sbjct:   74 KATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVCE 184          
BLAST of Lectin 2b vs. Ensembl Fly
Match: tfc (gene:FBgn0035199 transcript:FBtr0072660)

HSP 1 Score: 50.8322 bits (120), Expect = 6.189e-7
Identity = 34/111 (30.63%), Postives = 53/111 (47.75%), Query Frame = 3
Query:  126 EALQSCKSRGMRLVRVNSAEDNAVVNGFANK--VLADSYWIDGNDETAEG-IFVNSKGNLLTYKNFGTNEPN-----GGRSENCINVY-RLPSGL-WNDITCLARIWAICQ 428
            +A Q C+  GM L  ++S E+N  +        +  + +WI G D   EG  F  + G  +T+ N+   EPN      G  ENC+ ++ R   GL WND  C    + +C+
Sbjct:   74 KATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVCE 184          
BLAST of Lectin 2b vs. Ensembl Fly
Match: tfc (gene:FBgn0035199 transcript:FBtr0072659)

HSP 1 Score: 50.447 bits (119), Expect = 3.506e-6
Identity = 34/111 (30.63%), Postives = 53/111 (47.75%), Query Frame = 3
Query:  126 EALQSCKSRGMRLVRVNSAEDNAVVNGFANK--VLADSYWIDGNDETAEG-IFVNSKGNLLTYKNFGTNEPN-----GGRSENCINVY-RLPSGL-WNDITCLARIWAICQ 428
            +A Q C+  GM L  ++S E+N  +        +  + +WI G D   EG  F  + G  +T+ N+   EPN      G  ENC+ ++ R   GL WND  C    + +C+
Sbjct:  262 KATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVCE 372          
BLAST of Lectin 2b vs. Ensembl Zebrafish
Match: si:dkey-88n24.7 (si:dkey-88n24.7 [Source:ZFIN;Acc:ZDB-GENE-041014-91])

HSP 1 Score: 88.9669 bits (219), Expect = 1.312e-18
Identity = 77/351 (21.94%), Postives = 145/351 (41.31%), Query Frame = 3
Query:  462 IEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGADPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFA--RRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNG-GVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFEIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENC 1505
            ++     +++GK  + +AQ YC      +  + +  D   +    +  N    W+    +     W  S G  +++ N+  G+P    + +C    + Y+  W +  C    + IC++            L+     + ++ AQ YC+   + +V   N  EN  +  F   R  +    W+          W  S++++   + +  GEPN  G NE+C        GLWND PC ++  F +C +D         F +  D ++V  +  +++EAL++CR     L  V S      +    K    +  W+  ++      W+  N +++ Y+NWA    NG+  ENC
Sbjct:   21 VQRQYHFINEGK-NWTEAQRYCRENYTDLATVDNMND---LIQLMKSVNDGRVWIG---LQRMSNWHWSSGDPVLFLNWASGQPAS--ISDCT---VMYNGQWINEACSNTHFFICFQMS--------GGLVFVNQLMNWRAAQSYCRQNHIDLVSVRNQNENQQLEKFINDRNSSGSAVWI----GLFRDTWQWSDQSNSSFRYWSTGEPNNVGGNEDCAMISQYPQGLWNDIPCHFQFPF-VCHQDF--------FVLHKDKLIVIQQNLSWSEALRYCRQNHVDLVSVQSVEMQRRVMNVVKLASTEAVWLGLHNFCSINTWLWVNGDMVCYQNWAPG--NGSTPENC 336          

HSP 2 Score: 63.1586 bits (152), Expect = 4.340e-10
Identity = 47/218 (21.56%), Postives = 96/218 (44.04%), Query Frame = 3
Query:   93 LFVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFAN--KVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNG-GRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVSTDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENC 737
            L     L+ +  A   C+   + LV V +  +N  +  F N       + WI    +T +     S  +  +++ + T EPN  G +E+C  + + P GLWNDI C  +   +C +D  V      +  +  +V +  +++++A  YC    + ++ +        V +  +  +++  W+  ++  +   W+  +G  + Y+N+  G   G   ENC
Sbjct:  131 LVFVNQLMNWRAAQSYCRQNHIDLVSVRNQNENQQLEKFINDRNSSGSAVWIGLFRDTWQW----SDQSNSSFRYWSTGEPNNVGGNEDCAMISQYPQGLWNDIPCHFQFPFVCHQDFFV------LHKDKLIVIQQNLSWSEALRYCRQNHVDLVSVQSVEMQRRVMNVVKLASTEAVWLGLHNFCSINTWLWVNGDMVCYQNWAPG--NGSTPENC 336          
BLAST of Lectin 2b vs. Ensembl Zebrafish
Match: si:dkey-88n24.7 (si:dkey-88n24.7 [Source:ZFIN;Acc:ZDB-GENE-041014-91])

HSP 1 Score: 86.2705 bits (212), Expect = 1.128e-17
Identity = 75/351 (21.37%), Postives = 139/351 (39.60%), Query Frame = 3
Query:  462 IEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGADPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFA--RRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNG-GVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFEIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENC 1505
            ++     +++GK  + +AQ YC      +  + +  D   +    +  N    W+    +     W  S G  +++ N+  G+P    + +C    + Y+  W +  C    + IC++            L+     + ++ AQ YC+   + +V   N  EN  +  F   R  +    W+          W  S++++   + +  GEPN  G NE+C        GLWND PC +   F  C                 D ++V  +  +++EAL++CR     L  V S      +    K    +  W+  ++      W+  N +++ Y+NWA    NG+  ENC
Sbjct:   21 VQRQYHFINEGK-NWTEAQRYCRENYTDLATVDNMND---LIQLMKSVNDGRVWIG---LQRMSNWHWSSGDPVLFLNWASGQPAS--ISDCT---VMYNGQWINEACSNTHFFICFQMS--------GGLVFVNQLMNWRAAQSYCRQNHIDLVSVRNQNENQQLEKFINDRNSSGSAVWI----GLFRDTWQWSDQSNSSFRYWSTGEPNNVGGNEDCAMISQYPQGLWNDIPCHFHFCFVFCP----------------DKLIVIQQNLSWSEALRYCRQNHVDLVSVQSVEMQRRVMNVVKLASTEAVWLGLHNFCSINTWLWVNGDMVCYQNWAPG--NGSTPENC 329          

HSP 2 Score: 54.299 bits (129), Expect = 2.765e-7
Identity = 45/218 (20.64%), Postives = 90/218 (41.28%), Query Frame = 3
Query:   93 LFVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFAN--KVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNG-GRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVSTDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENC 737
            L     L+ +  A   C+   + LV V +  +N  +  F N       + WI    +T +     S  +  +++ + T EPN  G +E+C  + + P GLWNDI C      +   D               +V +  +++++A  YC    + ++ +        V +  +  +++  W+  ++  +   W+  +G  + Y+N+  G   G   ENC
Sbjct:  131 LVFVNQLMNWRAAQSYCRQNHIDLVSVRNQNENQQLEKFINDRNSSGSAVWIGLFRDTWQW----SDQSNSSFRYWSTGEPNNVGGNEDCAMISQYPQGLWNDIPCHFHFCFVFCPDK-------------LIVIQQNLSWSEALRYCRQNHVDLVSVQSVEMQRRVMNVVKLASTEAVWLGLHNFCSINTWLWVNGDMVCYQNWAPG--NGSTPENC 329          
BLAST of Lectin 2b vs. Ensembl Zebrafish
Match: mrc1a (mannose receptor, C type 1a [Source:ZFIN;Acc:ZDB-GENE-090915-4])

HSP 1 Score: 88.5817 bits (218), Expect = 1.344e-17
Identity = 116/538 (21.56%), Postives = 202/538 (37.55%), Query Frame = 3
Query:   87 NTLFVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNG--GRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVSTDQLEIEGNIFVVSKG------------------KMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDS-LWNDLPCHFNLWVICYR--------------SEIRAP----GADPNTLIASYDRL-----TFQEAQDYCKAQGLKMVRANNAAE-NALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNEN-CLNGYLSLDGLWNDFPCPYKN--LFAICAKDSLKIKDNENFEIDMDNM------------MVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEG-KWVDSNANVLPYKNWAATEPN-GNRGENCIFI 1514
            N  ++ +T   +N+AL +C   G  L  +++ E+++ +   +  +  D  WI  ND+  + +F  S    +T+  +   EP+    R E+C+ + +   G W D  C      IC+K S       + EG   VVS G                    TF +A++ C      ++ +    +NA + S         +W+  ++  +   +  S+   + + +F VG P   R   C        + LW+ L C+     IC +                +  P      DP   I  Y R      T+ EA+DYCKA G  +   ++  + N L +G           L+ N   +   W D   +D ++  F  GEPN   N+  C          WND  C   N  +  I    + K       +++ +               ++ E     +A  FC+     L  +  Q +   +     +   + Y+I    + ++   WVD +  V  Y +W   EPN  N  ENC+ I
Sbjct:  371 NCYYLQRTKKMWNDALAACHREGANLASIHNIEEHSFIISQSGYLPTDELWIGLNDQKTQNLFEWSDRTHVTFTTWLVGEPSHFINRLEDCV-LIKGKDGKWADHACEMERGYICKKKSSS-----KPEGAPEVVSLGCQAGWVRYGSYCYMSAIESKTFNEAKQICEQTGANLVDVASRYENAFLISLVGLRPEKYFWIGLSNTESPESFRWSNSDKVKFTHFNVGMPEKHR--GCVAMLTGTSAGLWDVLDCNSKQKYICKKMAEGVTTTQIPPTTQPLSCPVGWTKKDPRNCIQIYSRPKEQKKTWFEARDYCKAIGGDLASFHSQKQINNLQYGMGETAWIGFNLLNINSGFV---WTDGTPSDFENWSF--GEPNNHNNQELCTESSFYYGRKWNDRDCEAYNDWICQIAIGTTPKSPPTTVTQVEYNKTSDGWIQYNDSQYFINEESLPMEDARSFCKKNNGDLVVITGQTERKFVWKQISRGSENQYYIGMIVNLDKSFNWVDGSPVV--YTSWDQNEPNFANNDENCVTI 893          

HSP 2 Score: 86.2705 bits (212), Expect = 7.306e-17
Identity = 112/542 (20.66%), Postives = 204/542 (37.64%), Query Frame = 3
Query:  105 KTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEV------STDQ--------LEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGG--GRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGADPNTL----------------IASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYW--LDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLD-GLWNDFPCPYKNLFAICAKDSLKIKDNENF-------------EIDMDNMM-----VSAERYTYNEALQFCRTRGTQLARVNS--QVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNG-NRGENCI---FILLRR---RDMEGY 1544
            ++++T+++A  SC+ +   L+ +    + + ++G  N     + WI  N    E  +  S GN   Y N+    P+      C  +    +  W  + C  ++  IC+K +          DQ        +   GN + + + K  + DA   C      +  I +  +++ + S +    +D  W+  ND  T+  +  SD   + +  + VGEP     R+E+C       D  W D  C      IC +     P   P  +                +++ +  TF EA+  C+  G  +V   +  ENA +           +W  L   ++    +W +S++    H  F+ G P    +  C+        GLW+   C  K  + IC K +  +   +               + D  N +        ++ T+ EA  +C+  G  LA  +S  Q++N          + +  WI  N       +V ++     ++NW+  EPN  N  E C    F   R+   RD E Y
Sbjct:  236 QSILTWHQARTSCQQQEADLLSITELHEQSYISGLTN-TFGSALWIGLNSLDFESGWQWSNGNPFRYLNWAPGHPSLEPGLTCAALNAGKASKWESMACNKKLGYICRKGNSTDNTPPPGKDQPNFCPAAWVPYAGNCYYLQRTKKMWNDALAACHREGANLASIHNIEEHSFIISQSGYLPTDELWIGLNDQKTQNLFEWSDRTHVTFTTWLVGEPSHFINRLEDCVL-IKGKDGKWADHACEMERGYICKKKSSSKPEGAPEVVSLGCQAGWVRYGSYCYMSAIESKTFNEAKQICEQTGANLVDVASRYENAFLISLVGLRPEKYFWIGLSNTESPESFRWSNSDKVKFTH--FNVGMPEK--HRGCVAMLTGTSAGLWDVLDCNSKQKY-ICKKMAEGVTTTQIPPTTQPLSCPVGWTKKDPRNCIQIYSRPKEQKKTWFEARDYCKAIGGDLASFHSQKQINNLQYG------MGETAWIGFNLLNINSGFVWTDGTPSDFENWSFGEPNNHNNQELCTESSFYYGRKWNDRDCEAY 764          

HSP 3 Score: 79.337 bits (194), Expect = 9.146e-15
Identity = 122/532 (22.93%), Postives = 205/532 (38.53%), Query Frame = 3
Query:  117 TYNEALQSCKSRGMRLVRVNSAED-NAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNG-GRSENCINVYRLPSGLWNDITCLARIWAICQ-------KDSEVSTDQLEI----EGNI------FVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGK---WVDSDGKDLIYKNFPVGEPG-GGRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSE-----------IRAPGADPNTLIAS-------YDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPN------------GGVNENC---LNGYLSLDGLWNDFPCPYKNLFAICAK--DSLKIKD------NENFEIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEG--KWVDSNANVLPYKNWAATEPNGNRGENCIFI 1514
            T+ EA   CK+ G  L   +S +  N +  G     + ++ WI  N       FV + G    ++N+   EPN     E C          WND  C A    ICQ       K    +  Q+E     +G I      + +++  +   DA+ +C   +  ++ I    +   V       + + Y++    IV   K   WVD  G  ++Y ++   EP      ENC   Y +    WND+ C   L  IC RS            +R  G  P   I          +++T+ +A++ C + G  +V      E A +         D+ W+  ND   E +++ ++   + +  +  G P+            G  N +C   L     + G+W    C  +  F IC +  D+  I+          F +  D+  V  E+ +++EA + C+     LA V + +  A       K+  +  WI  N +   G  +WVD+   +L Y  WA  EP  N    C++I
Sbjct:  670 TWFEARDYCKAIGGDLASFHSQKQINNLQYG-----MGETAWIGFNLLNINSGFVWTDGTPSDFENWSFGEPNNHNNQELCTESSFYYGRKWNDRDCEAYNDWICQIAIGTTPKSPPTTVTQVEYNKTSDGWIQYNDSQYFINEESLPMEDARSFCKKNNGDLVVITGQTERKFVWKQISRGSENQYYI--GMIVNLDKSFNWVD--GSPVVYTSWDQNEPNFANNDENCVTIYKSM-GFWNDINCGVPLPSICKRSSNFINSTLPLPTVRPGGCSPEWTIFQGSCYKLFQNKMTWHDARNLCISHGGNLVSILTHEEQAFLTTLMLDSVDDI-WIGFNDVNWEMRFLWTDGKGVSYTNWAKGVPSSMPDGPSRMYEFGSENYDCVVMLRSPEKMTGMWKVQMCGDQQGF-ICKRKTDTQLIRPVTTAAPQHFFTLGNDSYKVQKEKMSWDEARRQCKASDADLASVRNSISQAYTILTVSKL-KEPLWIGLNSNLTSGQYRWVDNW--LLSYSRWATGEPKNNLA--CVYI 1184          

HSP 4 Score: 77.411 bits (189), Expect = 4.130e-14
Identity = 92/413 (22.28%), Postives = 167/413 (40.44%), Query Frame = 3
Query:   96 FVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPN-GGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVSTDQLEI---------------EGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGG---GRVENCAHGYLNYD------------SLWNDLPCHFNLWVICYR---SEIRAP--GADPNTLIA----SY----DRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYW-LDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKDS 1199
            F+ +  +   +A   CK     LV +    +   V    ++   + Y+I G     +  F    G+ + Y ++  NEPN     ENC+ +Y+   G WNDI C   + +IC++ S      L +               +G+ + + + KMT+ DA+  C +    ++ I    + A + +   ++  D+ W+  ND+  E +++ +DGK + Y N+  G P     G       G  NYD             +W    C      IC R   +++  P   A P         SY    +++++ EA+  CKA    +    N+   A       ++   L+  L+ N    + +WVD+    L +  +  GEP    N  C+  Y+  DG W    C     +++C + +
Sbjct:  805 FINEESLPMEDARSFCKKNNGDLVVITGQTERKFVWKQISRGSENQYYI-GMIVNLDKSFNWVDGSPVVYTSWDQNEPNFANNDENCVTIYK-SMGFWNDINCGVPLPSICKRSSNFINSTLPLPTVRPGGCSPEWTIFQGSCYKLFQNKMTWHDARNLCISHGGNLVSILTHEEQAFLTTLMLDSVDDI-WIGFNDVNWEMRFLWTDGKGVSYTNWAKGVPSSMPDGPSRMYEFGSENYDCVVMLRSPEKMTGMWKVQMCGDQQGFICKRKTDTQLIRPVTTAAPQHFFTLGNDSYKVQKEKMSWDEARRQCKASDADLASVRNSISQAYTILTVSKLKEPLWIGLNSNLTSGQYRWVDNWL--LSYSRWATGEPKN--NLACV--YIDTDGRWKTATC-NNTYYSLCKQST 1207          
BLAST of Lectin 2b vs. Ensembl Zebrafish
Match: si:ch73-335d12.2 (si:ch73-335d12.2 [Source:ZFIN;Acc:ZDB-GENE-060503-423])

HSP 1 Score: 82.0333 bits (201), Expect = 2.486e-16
Identity = 80/351 (22.79%), Postives = 146/351 (41.60%), Query Frame = 3
Query:  462 IEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGADPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFA--RRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPN-GGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFEIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENC 1505
            ++     ++K K T+ +AQ YC  +   +  + + +++ I  + + + N    W+ G    +  KW  S G  +++ N+  G+P GG  +NC    +  +  W   PC      ICY             L+     + +++AQ YC+   + +V   N  EN  +  F   R  +    W+          W  S++++   + +   EPN  G +ENC   YL     WND  C  +  F +C +D L               +V  +  +++EAL++CR     L  V S      +    K    +  W+  ++      W+  + +++ Y+NWA    NG+  ENC
Sbjct:   21 VQRQYHFINKNK-TWTEAQRYCREKYTDLATVDN-MNDMIQMNKSVKVNDGYAWI-GLQRTSVYKWHWSSGDSVLFLNWASGQPAGG--DNCT---VMRNGKWFVEPCSDAWTFICYNM--------SRGLVFVNQTMNWRDAQSYCRQNHIDLVSVRNQNENQQLEKFINDRNSSGSAVWI----GLFRDTWQWSDQSNSSFRYWDTIEPNNAGGHENCAVIYLYNLKQWNDILCDRQYAF-VCHEDKL---------------IVIQQNLSWSEALRYCRQNHVDLVSVQSVEMQRRVMNVVKLASTEAVWLGLHNFCSMNMWLWLSGDMVCYQNWAP--GNGSTPENC 333          

HSP 2 Score: 51.6026 bits (122), Expect = 1.798e-6
Identity = 47/219 (21.46%), Postives = 93/219 (42.47%), Query Frame = 3
Query:   93 LFVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFAN--KVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPN-GGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVSTDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRV-ENC 737
            +FV +T+  + +A   C+   + LV V +  +N  +  F N       + WI    +T +     S  +  +++ + T EPN  G  ENC  +Y      WNDI C  +   +C +D               +V +  +++++A  YC    + ++ +        V +  +  +++  W+  ++  +   W+   G  + Y+N+    PG G   ENC
Sbjct:  136 VFVNQTM-NWRDAQSYCRQNHIDLVSVRNQNENQQLEKFINDRNSSGSAVWIGLFRDTWQW----SDQSNSSFRYWDTIEPNNAGGHENCAVIYLYNLKQWNDILCDRQYAFVCHEDK-------------LIVIQQNLSWSEALRYCRQNHVDLVSVQSVEMQRRVMNVVKLASTEAVWLGLHNFCSMNMWLWLSGDMVCYQNWA---PGNGSTPENC 333          
BLAST of Lectin 2b vs. Ensembl Zebrafish
Match: si:ch73-335d12.2 (si:ch73-335d12.2 [Source:ZFIN;Acc:ZDB-GENE-060503-423])

HSP 1 Score: 82.0333 bits (201), Expect = 2.486e-16
Identity = 80/351 (22.79%), Postives = 146/351 (41.60%), Query Frame = 3
Query:  462 IEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGADPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFA--RRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPN-GGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFEIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENC 1505
            ++     ++K K T+ +AQ YC  +   +  + + +++ I  + + + N    W+ G    +  KW  S G  +++ N+  G+P GG  +NC    +  +  W   PC      ICY             L+     + +++AQ YC+   + +V   N  EN  +  F   R  +    W+          W  S++++   + +   EPN  G +ENC   YL     WND  C  +  F +C +D L               +V  +  +++EAL++CR     L  V S      +    K    +  W+  ++      W+  + +++ Y+NWA    NG+  ENC
Sbjct:   21 VQRQYHFINKNK-TWTEAQRYCREKYTDLATVDN-MNDMIQMNKSVKVNDGYAWI-GLQRTSVYKWHWSSGDSVLFLNWASGQPAGG--DNCT---VMRNGKWFVEPCSDAWTFICYNM--------SRGLVFVNQTMNWRDAQSYCRQNHIDLVSVRNQNENQQLEKFINDRNSSGSAVWI----GLFRDTWQWSDQSNSSFRYWDTIEPNNAGGHENCAVIYLYNLKQWNDILCDRQYAF-VCHEDKL---------------IVIQQNLSWSEALRYCRQNHVDLVSVQSVEMQRRVMNVVKLASTEAVWLGLHNFCSMNMWLWLSGDMVCYQNWAP--GNGSTPENC 333          

HSP 2 Score: 51.6026 bits (122), Expect = 1.798e-6
Identity = 47/219 (21.46%), Postives = 93/219 (42.47%), Query Frame = 3
Query:   93 LFVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFAN--KVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPN-GGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVSTDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRV-ENC 737
            +FV +T+  + +A   C+   + LV V +  +N  +  F N       + WI    +T +     S  +  +++ + T EPN  G  ENC  +Y      WNDI C  +   +C +D               +V +  +++++A  YC    + ++ +        V +  +  +++  W+  ++  +   W+   G  + Y+N+    PG G   ENC
Sbjct:  136 VFVNQTM-NWRDAQSYCRQNHIDLVSVRNQNENQQLEKFINDRNSSGSAVWIGLFRDTWQW----SDQSNSSFRYWDTIEPNNAGGHENCAVIYLYNLKQWNDILCDRQYAFVCHEDK-------------LIVIQQNLSWSEALRYCRQNHVDLVSVQSVEMQRRVMNVVKLASTEAVWLGLHNFCSMNMWLWLSGDMVCYQNWA---PGNGSTPENC 333          
BLAST of Lectin 2b vs. Ensembl Xenopus
Match: orc3 (origin recognition complex subunit 3 [Source:Xenbase;Acc:XB-GENE-984200])

HSP 1 Score: 93.2041 bits (230), Expect = 2.775e-23
Identity = 119/519 (22.93%), Postives = 205/519 (39.50%), Query Frame = 3
Query:   96 FVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRL--PSGLWNDITCLARIWAICQKDSE---------------VSTD---QLEIEGNIFVVSKG---KMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWV--DGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGR-VENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGAD------PNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVN-ENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFE---------IDMDNMMVSAERYT-----------YNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNR 1493
             ++ T  ++ EA Q+C   G  LV V    + A +           +W    D    G++  + G  + + ++ +  P  GR   C+ V R     GLW+ ITC  +   +C++ +E                 TD     EI       S+G   K T+ +++ +C A    ++ I    +  I+        + ++W+    +D     +WVD  G  L Y+N+  GEP   + +E C   +++Y   WND  C  +   IC   +     +D       N    S + +   +A+++CK     +V  N+  E   +  +       LY+       L  +W+D   + + +  +   EPN   N ENC+  Y ++ G WND  C Y N + IC + +  I  N  F             D +      Y            ++ A   C      LA V +++  A L    K +  D  WI  ND  EE +++ ++   + Y NWA   P G+R
Sbjct:  497 LISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMP--GRRRGCV-VMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGEEEKRTWFESRSFCKAIGGDLVSINSKEEETILSQLYY---NQIFWIGLQTSDPEEGFEWVD--GSALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKEYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFF------LFFRWMDG--SVMNYVAWASYEPNFANNDENCVVMYKNM-GFWNDINCGYPNPY-ICERKNSSI--NATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNIDV-WIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSR 994          

HSP 2 Score: 36.965 bits (84), Expect = 2.775e-23
Identity = 37/154 (24.03%), Postives = 64/154 (41.56%), Query Frame = 1
Query: 1519 LEEGTWRDIACTNKYLAICTLN---PNAGAKTADYHFTKV----------KMTFEAAALYCKSVGLKVVRVRNLNSNRLL-ADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSFATGLWVDSKCDDFNSVVC 1938
            L+ G+W +  C+     IC  +   P +        F K           KM+++ A   CKS   ++V + +  +N  L   ++KY   + +W+  N N    ++  T+N  L Y  +AAE P   +   C+     G W  S C +    +C
Sbjct: 1013 LDAGSWFEEECSLSRGYICQTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYR--EPFWIGLNSNKTGNQYKWTDNWKLRYTKWAAEEPK--KTTACVYMDIDGQWKTSSCTENYFSIC 1162          

HSP 3 Score: 85.1149 bits (209), Expect = 2.585e-16
Identity = 112/535 (20.93%), Postives = 190/535 (35.51%), Query Frame = 3
Query:   69 RSDIDVNTLFVT-KTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVST----------------DQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGG--GRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGADPNTL----------------IASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEG--KWVDSEENDLKH-KGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKD----------------NENFEIDMDNMMVS---AERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWI--DGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRG 1496
            R D+     F+  +  +T+ +A +SC  +   L+ +    +   + G +N  +  S W   N       +  S G+   Y N+    P+     NC+ +    +G W +  C  ++  IC+K S  S+                  L   GN + V K    + +A   C      +    +  + + + S      +   W+  ND  +   +  SDG  + Y  +  GEP     + E+C   +      W+D  C      IC R  +       + +                + S    +F EA   C   G  +V   +  E A +           +W    D+   G  KW + E     H     PG   G V     N      GLW+   C  K  F +C + +  +                    + EI       S    E+ T+ E+  FC+  G  L  +NS+ +  +L+      +   +WI    +D  E  +WVD +A  L Y+NWA  EPN ++G
Sbjct:  202 RKDLLTTLFFINNQAALTWFQARKSCLQQESELLSITEIHEQTFLTGLSN-TMTTSLWTGLNSLNFNAGWQWSGGSPFRYLNWVPGNPSSEPGINCVTLNTGKNGKWENKECNQKLGYICKKGSITSSTFVMPSESDSPISCPPSWLPYAGNCYTVKKENKIWKEALSSCRKEEGDLASFHNVEELSFISSQFEFEQTTKVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCV-AFDPKSGHWSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPGRRRGCVVMRTGNK----GGLWDVITCEEKAKF-VCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGEEEKRTWFESRSFCKAIGGDLVSINSKEEETILSQLYYNQI---FWIGLQTSDPEEGFEWVDGSA--LSYENWAYGEPNNHQG 724          

HSP 4 Score: 67.0106 bits (162), Expect = 9.084e-11
Identity = 114/547 (20.84%), Postives = 216/547 (39.49%), Query Frame = 3
Query:   87 NTLFVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPN-GGRSENCINVYRLPSGLWNDITCLARIWAICQK-----DSEVSTDQLEIEGNIFV--VSKGKMTF-------ADAQEYCSARSLKMIRIGH--ALDNAIVHSFARETNSDL---YWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRV------ENCA---HGYLNYDSLWNDLPCHFNLWVICY--RSEIRAPGADPNTLIASYDRLTFQ---------EAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYW--LDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAK-DSLKIKDNEN----------------FEIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKV--VADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENC-IFILLRRRDMEG 1541
            N  F++  +V  ++A + CK     LV +N   +   +  +        Y+           F    G+++ Y  + + EPN     ENC+ +Y+   G WNDI C      IC++     ++  +      +G      ++ GK  +        +A ++ SAR+  M   G+   ++N +V +F      DL    W+  ND   E +++ +D + + Y N+  G P G R        +C     G       W +  C  +   IC   ++   +P   P+     +   TF+         EA   CK++  ++V   +   N+ +  +  +   + +W  L+ N    + KW D+ +  L++  +   EP       C+  Y+ +DG W    C  +N F+IC + D++   D                   F      + VS  +  Y  +L+ C   G  LA  +  +++  +    +++      +WI G     E KW+  +   + + NW   EP+ +  E+C  F +L    + G
Sbjct:  771 NQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFF--------LFFRWMDGSVMNYVAWASYEPNFANNDENCVVMYK-NMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNIDVWIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKY-REPFWIGLNSNKTGNQYKWTDNWK--LRYTKWAAEEPKKTTA--CV--YMDIDGQWKTSSCT-ENYFSICKQSDAIAPTDPPQKPGKCPPDSDDRSWIPFRGHCYLIQVSYTKNWYQASLE-CLRFGGSLASFDDSLESNFVWHQIERLEDRVKSFWI-GMYQNVENKWLWLDNAPVDFVNWNIGEPSDHNDEHCHTFYILHLYSIGG 1298          
BLAST of Lectin 2b vs. Ensembl Xenopus
Match: orc3 (origin recognition complex subunit 3 [Source:Xenbase;Acc:XB-GENE-984200])

HSP 1 Score: 90.1225 bits (222), Expect = 1.914e-22
Identity = 119/530 (22.45%), Postives = 205/530 (38.68%), Query Frame = 3
Query:   96 FVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRL--PSGLWNDITCLARIWAICQKDSE---------------VSTD---QLEIEGNIFVVSKG---KMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWV--DGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGR-VENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGADP-----------------NTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVN-ENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFE---------IDMDNMMVSAERYT-----------YNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNR 1493
             ++ T  ++ EA Q+C   G  LV V    + A +           +W    D    G++  + G  + + ++ +  P  GR   C+ V R     GLW+ ITC  +   +C++ +E                 TD     EI       S+G   K T+ +++ +C A    ++ I    +  I+        + ++W+    +D     +WVD  G  L Y+N+  GEP   + +E C   +++Y   WND  C  +   IC   +      +P                 N    S + +   +A+++CK     +V  N+  E   +  +       LY+       L  +W+D   + + +  +   EPN   N ENC+  Y ++ G WND  C Y N + IC + +  I  N  F             D +      Y            ++ A   C      LA V +++  A L    K +  D  WI  ND  EE +++ ++   + Y NWA   P G+R
Sbjct:  497 LISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMP--GRRRGCV-VMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGEEEKRTWFESRSFCKAIGGDLVSINSKEEETILSQLYY---NQIFWIGLQTSDPEEGFEWVD--GSALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSSYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFF------LFFRWMDG--SVMNYVAWASYEPNFANNDENCVVMYKNM-GFWNDINCGYPNPY-ICERKNSSI--NATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNIDV-WIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSR 1005          

HSP 2 Score: 36.5798 bits (83), Expect = 1.914e-22
Identity = 37/154 (24.03%), Postives = 64/154 (41.56%), Query Frame = 1
Query: 1519 LEEGTWRDIACTNKYLAICTLN---PNAGAKTADYHFTKV----------KMTFEAAALYCKSVGLKVVRVRNLNSNRLL-ADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSFATGLWVDSKCDDFNSVVC 1938
            L+ G+W +  C+     IC  +   P +        F K           KM+++ A   CKS   ++V + +  +N  L   ++KY   + +W+  N N    ++  T+N  L Y  +AAE P   +   C+     G W  S C +    +C
Sbjct: 1024 LDAGSWFEEECSLSRGYICQTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYR--EPFWIGLNSNKTGNQYKWTDNWKLRYTKWAAEEPK--KTTACVYMDIDGQWKTSSCTENYFSIC 1173          

HSP 3 Score: 84.7297 bits (208), Expect = 3.441e-16
Identity = 112/535 (20.93%), Postives = 190/535 (35.51%), Query Frame = 3
Query:   69 RSDIDVNTLFVT-KTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVST----------------DQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGG--GRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGADPNTL----------------IASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEG--KWVDSEENDLKH-KGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKD----------------NENFEIDMDNMMVS---AERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWI--DGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRG 1496
            R D+     F+  +  +T+ +A +SC  +   L+ +    +   + G +N  +  S W   N       +  S G+   Y N+    P+     NC+ +    +G W +  C  ++  IC+K S  S+                  L   GN + V K    + +A   C      +    +  + + + S      +   W+  ND  +   +  SDG  + Y  +  GEP     + E+C   +      W+D  C      IC R  +       + +                + S    +F EA   C   G  +V   +  E A +           +W    D+   G  KW + E     H     PG   G V     N      GLW+   C  K  F +C + +  +                    + EI       S    E+ T+ E+  FC+  G  L  +NS+ +  +L+      +   +WI    +D  E  +WVD +A  L Y+NWA  EPN ++G
Sbjct:  202 RKDLLTTLFFINNQAALTWFQARKSCLQQESELLSITEIHEQTFLTGLSN-TMTTSLWTGLNSLNFNAGWQWSGGSPFRYLNWVPGNPSSEPGINCVTLNTGKNGKWENKECNQKLGYICKKGSITSSTFVMPSESDSPISCPPSWLPYAGNCYTVKKENKIWKEALSSCRKEEGDLASFHNVEELSFISSQFEFEQTTKVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCV-AFDPKSGHWSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPGRRRGCVVMRTGNK----GGLWDVITCEEKAKF-VCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGEEEKRTWFESRSFCKAIGGDLVSINSKEEETILSQLYYNQI---FWIGLQTSDPEEGFEWVDGSA--LSYENWAYGEPNNHQG 724          

HSP 4 Score: 66.6254 bits (161), Expect = 1.281e-10
Identity = 115/547 (21.02%), Postives = 218/547 (39.85%), Query Frame = 3
Query:   87 NTLFVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPN-GGRSENCINVYRLPSGLWNDITCLARIWAICQK-----DSEVSTDQLEIEGNIFV--VSKGKMTF-------ADAQEYCSARSLKMIRIGH--ALDNAIVHSFARETNSDL---YWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRV------ENCA---HGYLNYDSLWNDLPCHFNLWVICY--RSEIRAPGADPNTLIASYDRLTFQ---------EAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYW--LDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAK-DSLKIKDNEN----FEIDMDN------------MMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKV--VADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENC-IFILLRRRDMEG 1541
            N  F++  +V  ++A + CK     LV +N   +   +  +        Y+           F    G+++ Y  + + EPN     ENC+ +Y+   G WNDI C      IC++     ++  +      +G      ++ GK  +        +A ++ SAR+  M   G+   ++N +V +F      DL    W+  ND   E +++ +D + + Y N+  G P G R        +C     G       W +  C  +   IC   ++   +P   P+     +   TF+         EA   CK++  ++V   +   N+ +  +  +   + +W  L+ N    + KW D+ +  L++  +   EP       C+  Y+ +DG W    C  +N F+IC + D++   D          D D+            + VS  +  Y  +L+ C   G  LA  +  +++  +    +++      +WI G     E KW+  +   + + NW   EP+ +  E+C  F +L    + G
Sbjct:  782 NQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFF--------LFFRWMDGSVMNYVAWASYEPNFANNDENCVVMYK-NMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNIDVWIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKY-REPFWIGLNSNKTGNQYKWTDNWK--LRYTKWAAEEPKKTTA--CV--YMDIDGQWKTSSCT-ENYFSICKQSDAIAPTDPPQKPGKCPPDSDDRSWIPFRGHCYLIQVSYTKNWYQASLE-CLRFGGSLASFDDSLESNFVWHQIERLEDRVKSFWI-GMYQNVENKWLWLDNAPVDFVNWNIGEPSDHNDEHCHTFYILHLYSIGG 1309          
BLAST of Lectin 2b vs. Ensembl Xenopus
Match: orc3 (origin recognition complex subunit 3 [Source:Xenbase;Acc:XB-GENE-984200])

HSP 1 Score: 90.1225 bits (222), Expect = 2.130e-22
Identity = 119/530 (22.45%), Postives = 205/530 (38.68%), Query Frame = 3
Query:   96 FVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRL--PSGLWNDITCLARIWAICQKDSE---------------VSTD---QLEIEGNIFVVSKG---KMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWV--DGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGR-VENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGADP-----------------NTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVN-ENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFE---------IDMDNMMVSAERYT-----------YNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNR 1493
             ++ T  ++ EA Q+C   G  LV V    + A +           +W    D    G++  + G  + + ++ +  P  GR   C+ V R     GLW+ ITC  +   +C++ +E                 TD     EI       S+G   K T+ +++ +C A    ++ I    +  I+        + ++W+    +D     +WVD  G  L Y+N+  GEP   + +E C   +++Y   WND  C  +   IC   +      +P                 N    S + +   +A+++CK     +V  N+  E   +  +       LY+       L  +W+D   + + +  +   EPN   N ENC+  Y ++ G WND  C Y N + IC + +  I  N  F             D +      Y            ++ A   C      LA V +++  A L    K +  D  WI  ND  EE +++ ++   + Y NWA   P G+R
Sbjct:  497 LISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMP--GRRRGCV-VMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGEEEKRTWFESRSFCKAIGGDLVSINSKEEETILSQLYY---NQIFWIGLQTSDPEEGFEWVD--GSALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSSYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFF------LFFRWMDG--SVMNYVAWASYEPNFANNDENCVVMYKNM-GFWNDINCGYPNPY-ICERKNSSI--NATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNIDV-WIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSR 1005          

HSP 2 Score: 36.965 bits (84), Expect = 2.130e-22
Identity = 37/154 (24.03%), Postives = 64/154 (41.56%), Query Frame = 1
Query: 1519 LEEGTWRDIACTNKYLAICTLN---PNAGAKTADYHFTKV----------KMTFEAAALYCKSVGLKVVRVRNLNSNRLL-ADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSFATGLWVDSKCDDFNSVVC 1938
            L+ G+W +  C+     IC  +   P +        F K           KM+++ A   CKS   ++V + +  +N  L   ++KY   + +W+  N N    ++  T+N  L Y  +AAE P   +   C+     G W  S C +    +C
Sbjct: 1024 LDAGSWFEEECSLSRGYICQTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYR--EPFWIGLNSNKTGNQYKWTDNWKLRYTKWAAEEPK--KTTACVYMDIDGQWKTSSCTENYFSIC 1173          

HSP 3 Score: 84.3445 bits (207), Expect = 4.114e-16
Identity = 112/535 (20.93%), Postives = 190/535 (35.51%), Query Frame = 3
Query:   69 RSDIDVNTLFVT-KTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVST----------------DQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGG--GRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGADPNTL----------------IASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEG--KWVDSEENDLKH-KGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKD----------------NENFEIDMDNMMVS---AERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWI--DGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRG 1496
            R D+     F+  +  +T+ +A +SC  +   L+ +    +   + G +N  +  S W   N       +  S G+   Y N+    P+     NC+ +    +G W +  C  ++  IC+K S  S+                  L   GN + V K    + +A   C      +    +  + + + S      +   W+  ND  +   +  SDG  + Y  +  GEP     + E+C   +      W+D  C      IC R  +       + +                + S    +F EA   C   G  +V   +  E A +           +W    D+   G  KW + E     H     PG   G V     N      GLW+   C  K  F +C + +  +                    + EI       S    E+ T+ E+  FC+  G  L  +NS+ +  +L+      +   +WI    +D  E  +WVD +A  L Y+NWA  EPN ++G
Sbjct:  202 RKDLLTTLFFINNQAALTWFQARKSCLQQESELLSITEIHEQTFLTGLSN-TMTTSLWTGLNSLNFNAGWQWSGGSPFRYLNWVPGNPSSEPGINCVTLNTGKNGKWENKECNQKLGYICKKGSITSSTFVMPSESDSPISCPPSWLPYAGNCYTVKKENKIWKEALSSCRKEEGDLASFHNVEELSFISSQFEFEQTTKVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCV-AFDPKSGHWSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPGRRRGCVVMRTGNK----GGLWDVITCEEKAKF-VCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGEEEKRTWFESRSFCKAIGGDLVSINSKEEETILSQLYYNQI---FWIGLQTSDPEEGFEWVDGSA--LSYENWAYGEPNNHQG 724          

HSP 4 Score: 68.9366 bits (167), Expect = 2.412e-11
Identity = 86/402 (21.39%), Postives = 155/402 (38.56%), Query Frame = 3
Query:  138 SCKSRGMRLVRVNSAEDNAVVNGFANKVLAD---SYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGR------SENCINVYR---LPSGLWNDITCLARIWAICQKDSEV--------STDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGADPNT----------------------LIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDL--YWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIK 1211
            S ++  MR     +  +N +V  F    L D     WI  ND+  E  F+ +    + Y N+    P G R        +C+++ R   L +G W +  C      ICQ D  +        S    +     F +   KM++ +A   C +   +++ I     N+ +  +  +   + +W+  N   T  ++  +D   L Y  +   EP   +   C   Y++ D  W    C  N + IC +S+  AP   P                        +  SY +  +Q + + C   G  +   +++ E+  V     R+   +  +W+ G    +E KW+  +   +    ++ GEP+   +E+C+  Y S  G WN+  C     + IC     KIK
Sbjct:  935 SARTACMRFNGNLATVENELVQAFLTYNLKDLNIDVWIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYR-EPFWIGLNSNKTGNQYKWTDNWKLRYTKWAAEEPK--KTTACV--YMDIDGQWKTSSCTENYFSICKQSDAIAPTDPPQKPGKCPPDSDDRSWIPFRGHCYLIQVSYTKNWYQASLE-CLRFGGSLASFDDSLESNFVWHQIERLEDRVKSFWI-GMYQNVENKWLWLDNAPVDFVNWNIGEPSDHNDEHCVEMY-SSHGTWNNLYCSSYRGY-ICKIQKNKIK 1327          

HSP 5 Score: 66.6254 bits (161), Expect = 6.170e-11
Identity = 112/535 (20.93%), Postives = 214/535 (40.00%), Query Frame = 3
Query:   87 NTLFVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPN-GGRSENCINVYRLPSGLWNDITCLARIWAICQK-----DSEVSTDQLEIEGNIFV--VSKGKMTF-------ADAQEYCSARSLKMIRIGH--ALDNAIVHSFARETNSDL---YWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRV------ENCA---HGYLNYDSLWNDLPCHFNLWVICY--RSEIRAPGADPNTLIASYDRLTFQ---------EAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYW--LDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAK-DSLKIKDNEN----FEIDMDN------------MMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKV--VADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENCI 1508
            N  F++  +V  ++A + CK     LV +N   +   +  +        Y+           F    G+++ Y  + + EPN     ENC+ +Y+   G WNDI C      IC++     ++  +      +G      ++ GK  +        +A ++ SAR+  M   G+   ++N +V +F      DL    W+  ND   E +++ +D + + Y N+  G P G R        +C     G       W +  C  +   IC   ++   +P   P+     +   TF+         EA   CK++  ++V   +   N+ +  +  +   + +W  L+ N    + KW D+ +  L++  +   EP       C+  Y+ +DG W    C  +N F+IC + D++   D          D D+            + VS  +  Y  +L+ C   G  LA  +  +++  +    +++      +WI G     E KW+  +   + + NW   EP+ +  E+C+
Sbjct:  782 NQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFF--------LFFRWMDGSVMNYVAWASYEPNFANNDENCVVMYK-NMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNIDVWIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKY-REPFWIGLNSNKTGNQYKWTDNWK--LRYTKWAAEEPKKTTA--CV--YMDIDGQWKTSSCT-ENYFSICKQSDAIAPTDPPQKPGKCPPDSDDRSWIPFRGHCYLIQVSYTKNWYQASLE-CLRFGGSLASFDDSLESNFVWHQIERLEDRVKSFWI-GMYQNVENKWLWLDNAPVDFVNWNIGEPSDHNDEHCV 1297          

HSP 6 Score: 21.1718 bits (43), Expect = 6.170e-11
Identity = 8/25 (32.00%), Postives = 13/25 (52.00%), Query Frame = 1
Query: 1516 YLEEGTWRDIACTNKYLAICTLNPN 1590
            Y   GTW ++ C++    IC +  N
Sbjct: 1300 YSSHGTWNNLYCSSYRGYICKIQKN 1324          

HSP 7 Score: 53.1434 bits (126), Expect = 1.637e-6
Identity = 60/261 (22.99%), Postives = 105/261 (40.23%), Query Frame = 3
Query:   90 TLFVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAIC-QKDSEVSTDQLEIEGNIFVVSKGKMTFADAQEYCS-----------ARSLKMIRIGHAL--------DNAIVHSFAR-ETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVIC 809
            T  +  + ++++EA + CKS    LV +     N+ +  + +K   + +WI  N       +  +    L Y  +   EP   ++  C  VY    G W   +C    ++IC Q D+   TD  +  G     S  + ++   + +C              SL+ +R G +L         N + H   R E     +W+ G     E KW+  D   + + N+ +GEP     E+C   Y ++ + WN+L C      IC
Sbjct: 1067 TFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSK-YREPFWIGLNSNKTGNQYKWTDNWKLRYTKWAAEEPK--KTTAC--VYMDIDGQWKTSSCTENYFSICKQSDAIAPTDPPQKPGKCPPDSDDR-SWIPFRGHCYLIQVSYTKNWYQASLECLRFGGSLASFDDSLESNFVWHQIERLEDRVKSFWI-GMYQNVENKWLWLDNAPVDFVNWNIGEPSDHNDEHCVEMYSSHGT-WNNLYCSSYRGYIC 1319          
BLAST of Lectin 2b vs. Ensembl Xenopus
Match: orc3 (origin recognition complex subunit 3 [Source:Xenbase;Acc:XB-GENE-984200])

HSP 1 Score: 88.9669 bits (219), Expect = 5.086e-22
Identity = 119/533 (22.33%), Postives = 205/533 (38.46%), Query Frame = 3
Query:   96 FVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRL--PSGLWNDITCLARIWAICQKDSE---------------VSTD---QLEIEGNIFVVSKG---KMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWV--DGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGR-VENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGADP--------------------NTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVN-ENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFE---------IDMDNMMVSAERYT-----------YNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNR 1493
             ++ T  ++ EA Q+C   G  LV V    + A +           +W    D    G++  + G  + + ++ +  P  GR   C+ V R     GLW+ ITC  +   +C++ +E                 TD     EI       S+G   K T+ +++ +C A    ++ I    +  I+        + ++W+    +D     +WVD  G  L Y+N+  GEP   + +E C   +++Y   WND  C  +   IC   +      +P                    N    S + +   +A+++CK     +V  N+  E   +  +       LY+       L  +W+D   + + +  +   EPN   N ENC+  Y ++ G WND  C Y N + IC + +  I  N  F             D +      Y            ++ A   C      LA V +++  A L    K +  D  WI  ND  EE +++ ++   + Y NWA   P G+R
Sbjct:  514 LISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMP--GRRRGCV-VMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGEEEKRTWFESRSFCKAIGGDLVSINSKEEETILSQLYY---NQIFWIGLQTSDPEEGFEWVD--GSALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSSVPEYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFF------LFFRWMDG--SVMNYVAWASYEPNFANNDENCVVMYKNM-GFWNDINCGYPNPY-ICERKNSSI--NATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNIDV-WIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSR 1025          

HSP 2 Score: 36.965 bits (84), Expect = 5.086e-22
Identity = 37/154 (24.03%), Postives = 64/154 (41.56%), Query Frame = 1
Query: 1519 LEEGTWRDIACTNKYLAICTLN---PNAGAKTADYHFTKV----------KMTFEAAALYCKSVGLKVVRVRNLNSNRLL-ADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSFATGLWVDSKCDDFNSVVC 1938
            L+ G+W +  C+     IC  +   P +        F K           KM+++ A   CKS   ++V + +  +N  L   ++KY   + +W+  N N    ++  T+N  L Y  +AAE P   +   C+     G W  S C +    +C
Sbjct: 1044 LDAGSWFEEECSLSRGYICQTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYR--EPFWIGLNSNKTGNQYKWTDNWKLRYTKWAAEEPK--KTTACVYMDIDGQWKTSSCTENYFSIC 1193          

HSP 3 Score: 81.6481 bits (200), Expect = 2.951e-15
Identity = 109/522 (20.88%), Postives = 185/522 (35.44%), Query Frame = 3
Query:  105 KTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVST----------------DQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGG--GRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGADPNTL----------------IASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEG--KWVDSEENDLKH-KGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKD----------------NENFEIDMDNMMVS---AERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWI--DGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRG 1496
            +  +T+ +A +SC  +   L+ +    +   + G +N  +  S W   N       +  S G+   Y N+    P+     NC+ +    +G W +  C  ++  IC+K S  S+                  L   GN + V K    + +A   C      +    +  + + + S      +   W+  ND  +   +  SDG  + Y  +  GEP     + E+C   +      W+D  C      IC R  +       + +                + S    +F EA   C   G  +V   +  E A +           +W    D+   G  KW + E     H     PG   G V     N      GLW+   C  K  F +C + +  +                    + EI       S    E+ T+ E+  FC+  G  L  +NS+ +  +L+      +   +WI    +D  E  +WVD +A  L Y+NWA  EPN ++G
Sbjct:  232 QAALTWFQARKSCLQQESELLSITEIHEQTFLTGLSN-TMTTSLWTGLNSLNFNAGWQWSGGSPFRYLNWVPGNPSSEPGINCVTLNTGKNGKWENKECNQKLGYICKKGSITSSTFVMPSESDSPISCPPSWLPYAGNCYTVKKENKIWKEALSSCRKEEGDLASFHNVEELSFISSQFEFEQTTKVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCV-AFDPKSGHWSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPGRRRGCVVMRTGNK----GGLWDVITCEEKAKF-VCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGEEEKRTWFESRSFCKAIGGDLVSINSKEEETILSQLYYNQI---FWIGLQTSDPEEGFEWVDGSA--LSYENWAYGEPNNHQG 741          

HSP 4 Score: 72.7886 bits (177), Expect = 1.454e-12
Identity = 103/540 (19.07%), Postives = 199/540 (36.85%), Query Frame = 3
Query:   87 NTLFVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNG--GRSENCINVYRLPSGLWNDITCLARIWAICQKDS-EVSTDQLEIEGN------------IFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYL-NYDSLWNDLPCHFNLWVIC------------------------YRSEIRAPGADPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYW--LDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVN-ENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNEN------FEIDMDNMM--------VSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYY------WIDGNDHTEEGKWVDSNANVLPYKNWAATEPN-GNRGENCIFI 1514
            N   V K    + EAL SC+     L   ++ E+ + ++           WI  ND+ +   F  S G  ++Y  +   EP+    + E+C+  +   SG W+D  C  +   IC++        Q++I                +++S    +F +A + C      ++ +    + A + S         +W    D    G +  ++G+ +++ ++    P  GR   C      N   LW+ + C      +C                        +++         +      ++ T+ E++ +CKA G  +V  N+  E  ++   ++   + ++W  L  +D +   +WVD   + L ++ +  GEPN     E C   ++S    WND  C     +    K    ++          +E+  D  +        +S E    ++A +FC+     L  +N   +   L  +        Y      W+DG              +V+ Y  WA+ EPN  N  ENC+ +
Sbjct:  369 NCYTVKKENKIWKEALSSCRKEEGDLASFHNVEELSFISSQFEFEQTTKVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCV-AFDPKSGHWSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMP--GRRRGCVVMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGEEEKRTWFESRSFCKAIGGDLVSINSKEEETIL---SQLYYNQIFWIGLQTSDPEEGFEWVDG--SALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSSVPEYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFFLFFRWMDG--------------SVMNYVAWASYEPNFANNDENCVVM 886          

HSP 5 Score: 67.781 bits (164), Expect = 5.094e-11
Identity = 81/385 (21.04%), Postives = 149/385 (38.70%), Query Frame = 3
Query:  138 SCKSRGMRLVRVNSAEDNAVVNGFANKVLAD---SYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGR------SENCINVYR---LPSGLWNDITCLARIWAICQKDSEV--------STDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGADPNT----------------------LIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDL--YWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPC 1160
            S ++  MR     +  +N +V  F    L D     WI  ND+  E  F+ +    + Y N+    P G R        +C+++ R   L +G W +  C      ICQ D  +        S    +     F +   KM++ +A   C +   +++ I     N+ +  +  +   + +W+  N   T  ++  +D   L Y  +   EP     +  A  Y++ D  W    C  N + IC +S+  AP   P                        +  SY +  +Q + + C   G  +   +++ E+  V     R+   +  +W+ G    +E KW+  +   +    ++ GEP+   +E+C+  Y S  G WN+  C
Sbjct:  955 SARTACMRFNGNLATVENELVQAFLTYNLKDLNIDVWIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYR-EPFWIGLNSNKTGNQYKWTDNWKLRYTKWAAEEPK----KTTACVYMDIDGQWKTSSCTENYFSICKQSDAIAPTDPPQKPGKCPPDSDDRSWIPFRGHCYLIQVSYTKNWYQASLE-CLRFGGSLASFDDSLESNFVWHQIERLEDRVKSFWI-GMYQNVENKWLWLDNAPVDFVNWNIGEPSDHNDEHCVEMY-SSHGTWNNLYC 1331          

HSP 6 Score: 66.6254 bits (161), Expect = 1.197e-10
Identity = 112/535 (20.93%), Postives = 214/535 (40.00%), Query Frame = 3
Query:   87 NTLFVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPN-GGRSENCINVYRLPSGLWNDITCLARIWAICQK-----DSEVSTDQLEIEGNIFV--VSKGKMTF-------ADAQEYCSARSLKMIRIGH--ALDNAIVHSFARETNSDL---YWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRV------ENCA---HGYLNYDSLWNDLPCHFNLWVICY--RSEIRAPGADPNTLIASYDRLTFQ---------EAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYW--LDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAK-DSLKIKDNEN----FEIDMDN------------MMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKV--VADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENCI 1508
            N  F++  +V  ++A + CK     LV +N   +   +  +        Y+           F    G+++ Y  + + EPN     ENC+ +Y+   G WNDI C      IC++     ++  +      +G      ++ GK  +        +A ++ SAR+  M   G+   ++N +V +F      DL    W+  ND   E +++ +D + + Y N+  G P G R        +C     G       W +  C  +   IC   ++   +P   P+     +   TF+         EA   CK++  ++V   +   N+ +  +  +   + +W  L+ N    + KW D+ +  L++  +   EP       C+  Y+ +DG W    C  +N F+IC + D++   D          D D+            + VS  +  Y  +L+ C   G  LA  +  +++  +    +++      +WI G     E KW+  +   + + NW   EP+ +  E+C+
Sbjct:  802 NQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFF--------LFFRWMDGSVMNYVAWASYEPNFANNDENCVVMYK-NMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNIDVWIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKY-REPFWIGLNSNKTGNQYKWTDNWK--LRYTKWAAEEPKKTTA--CV--YMDIDGQWKTSSCT-ENYFSICKQSDAIAPTDPPQKPGKCPPDSDDRSWIPFRGHCYLIQVSYTKNWYQASLE-CLRFGGSLASFDDSLESNFVWHQIERLEDRVKSFWI-GMYQNVENKWLWLDNAPVDFVNWNIGEPSDHNDEHCV 1317          

HSP 7 Score: 54.299 bits (129), Expect = 7.498e-7
Identity = 63/273 (23.08%), Postives = 110/273 (40.29%), Query Frame = 3
Query:   90 TLFVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAIC-QKDSEVSTDQLEIEGNIFVVSKGKMTFADAQEYCS-----------ARSLKMIRIGHAL--------DNAIVHSFAR-ETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGADP 845
            T  +  + ++++EA + CKS    LV +     N+ +  + +K   + +WI  N       +  +    L Y  +   EP   ++  C  VY    G W   +C    ++IC Q D+   TD  +  G     S  + ++   + +C              SL+ +R G +L         N + H   R E     +W+ G     E KW+  D   + + N+ +GEP     E+C   Y ++ + WN+L C      IC   +I+    DP
Sbjct: 1087 TFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSK-YREPFWIGLNSNKTGNQYKWTDNWKLRYTKWAAEEPK--KTTAC--VYMDIDGQWKTSSCTENYFSICKQSDAIAPTDPPQKPGKCPPDSDDR-SWIPFRGHCYLIQVSYTKNWYQASLECLRFGGSLASFDDSLESNFVWHQIERLEDRVKSFWI-GMYQNVENKWLWLDNAPVDFVNWNIGEPSDHNDEHCVEMYSSHGT-WNNLYCSSYRGYIC---KIQKSKKDP 1348          
BLAST of Lectin 2b vs. Ensembl Xenopus
Match: orc3 (origin recognition complex subunit 3 [Source:Xenbase;Acc:XB-GENE-984200])

HSP 1 Score: 80.4925 bits (197), Expect = 1.530e-19
Identity = 114/520 (21.92%), Postives = 196/520 (37.69%), Query Frame = 3
Query:   96 FVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRL--PSGLWNDITCLARIWAICQKDSE---------------VSTD---QLEIEGNIFVVSKG---KMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWV--DGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGR-VENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGADPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVN-ENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFE--------------IDMDNMMVSAERYT--YNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENCIFILLRR 1526
             ++ T  ++ EA Q+C   G  LV V    + A +           +W    D    G++  + G  + + ++ +  P  GR   C+ V R     GLW+ ITC  +   +C++ +E                 TD     EI       S+G   K T+ +++ +C A    ++ I    +  I+        + ++W+    +D     +WVD     L Y+N+  GEP   + +E C   +++Y   WND  C  +   IC   +      +P         LT                 ++    N   H F       + W+DG              + + +  +   EPN   N ENC+  Y ++ G WND  C Y N + IC + +  I  N  F               I     ++     T  ++ A   C      LA V +++  A L    K +  D  WI  ND  EE +++ ++   + Y NWA   P G+R  +   + ++R
Sbjct:  507 LISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMP--GRRRGCV-VMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGEEEKRTWFESRSFCKAIGGDLVSINSKEEETILSQLNYRYYNQIFWIGLQTSDPEEGFEWVDG---SLSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSSVPEYELT-----------------SDGWIANKDNHFFI------IMWMDG--------------SVMNYVAWASYEPNFANNDENCVVMYKNM-GFWNDINCGYPNPY-ICERKNSSI--NATFAPTPASPQGGCPSDWITFGKRVIKNSNRTTDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNID-VWIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSTDCVSIKR 978          

HSP 2 Score: 36.5798 bits (83), Expect = 1.530e-19
Identity = 37/154 (24.03%), Postives = 64/154 (41.56%), Query Frame = 1
Query: 1519 LEEGTWRDIACTNKYLAICTLN---PNAGAKTADYHFTKV----------KMTFEAAALYCKSVGLKVVRVRNLNSNRLL-ADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSFATGLWVDSKCDDFNSVVC 1938
            L+ G+W +  C+     IC  +   P +        F K           KM+++ A   CKS   ++V + +  +N  L   ++KY   + +W+  N N    ++  T+N  L Y  +AAE P   +   C+     G W  S C +    +C
Sbjct:  982 LDAGSWFEEECSLSRGYICQTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYR--EPFWIGLNSNKTGNQYKWTDNWKLRYTKWAAEEPK--KTTACVYMDIDGQWKTSSCTENYFSIC 1131          

HSP 3 Score: 83.1889 bits (204), Expect = 8.165e-16
Identity = 110/522 (21.07%), Postives = 184/522 (35.25%), Query Frame = 3
Query:  105 KTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVST----------------DQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGG--GRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGADPNTL----------------IASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEG--KWVDSEENDLKH-KGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKD----------------NENFEIDMDNMMVS---AERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWI--DGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRG 1496
            +  +T+ +A +SC  +   L+ +    +   + G +N  +  S W   N       +  S G+   Y N+    P+     NC+ +    +G W +  C  ++  IC+K S  S+                  L   GN + V K    + +A   C      +    +  + + + S      +   W+  ND  +   +  SDG  + Y  +  GEP     + E+C   YL YD       C      IC R  +       + +                + S    +F EA   C   G  +V   +  E A +           +W    D+   G  KW + E     H     PG   G V     N      GLW+   C  K  F +C + +  +                    + EI       S    E+ T+ E+  FC+  G  L  +NS+ +  +L+    +     +WI    +D  E  +WVD +   L Y+NWA  EPN ++G
Sbjct:  231 QAALTWFQARKSCLQQESELLSITEIHEQTFLTGLSN-TMTTSLWTGLNSLNFNAGWQWSGGSPFRYLNWVPGNPSSEPGINCVTLNTGKNGKWENKECNQKLGYICKKGSITSSTFVMPSESDSPISCPPSWLPYAGNCYTVKKENKIWKEALSSCRKEEGDLASFHNVEELSFISSQFEFEQTTKVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCPF-YLFYDM------CEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPGRRRGCVVMRTGNK----GGLWDVITCEEKAKF-VCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGEEEKRTWFESRSFCKAIGGDLVSINSKEEETILSQLNYRYYNQIFWIGLQTSDPEEGFEWVDGS---LSYENWAYGEPNNHQG 736          

HSP 4 Score: 72.4034 bits (176), Expect = 2.110e-12
Identity = 87/398 (21.86%), Postives = 156/398 (39.20%), Query Frame = 3
Query:  138 SCKSRGMRLVRVNSAEDNAVVNGFANKVLAD---SYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGR--SENCINVYR---LPSGLWNDITCLARIWAICQKDSEV--------STDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGADPNT----------------------LIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDL--YWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIK 1211
            S ++  MR     +  +N +V  F    L D     WI  ND+  E  F+ +    + Y N+    P G R  S +C+++ R   L +G W +  C      ICQ D  +        S    +     F +   KM++ +A   C +   +++ I     N+ +  +  +   + +W+  N   T  ++  +D   L Y  +   EP   +   C   Y++ D  W    C  N + IC +S+  AP   P                        +  SY +  +Q + + C   G  +   +++ E+  V     R+   +  +W+ G    +E KW+  +   +    ++ GEP+   +E+C+  Y S  G WN+  C     + IC     KIK
Sbjct:  897 SARTACMRFNGNLATVENELVQAFLTYNLKDLNIDVWIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYR-EPFWIGLNSNKTGNQYKWTDNWKLRYTKWAAEEPK--KTTACV--YMDIDGQWKTSSCTENYFSICKQSDAIAPTDPPQKPGKCPPDSDDRSWIPFRGHCYLIQVSYTKNWYQASLE-CLRFGGSLASFDDSLESNFVWHQIERLEDRVKSFWI-GMYQNVENKWLWLDNAPVDFVNWNIGEPSDHNDEHCVEMY-SSHGTWNNLYCSSYRGY-ICKIQKNKIK 1285          

HSP 5 Score: 63.929 bits (154), Expect = 4.100e-10
Identity = 99/460 (21.52%), Postives = 191/460 (41.52%), Query Frame = 3
Query:  288 GNLLTYKNFGTNEPN-GGRSENCINVYRLPSGLWNDITCLARIWAICQK-----DSEVSTDQLEIEGNIFV--VSKGKMTFADA---QEYCSARSLKMIRIGH--ALDNAIVHSFARETNSDL---YWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSL-----WNDLPCHFNLWVICY--RSEIRAPGADPNTLIASYDRLTFQ---------EAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYW--LDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAK-DSLKIKDNEN----FEIDMDN------------MMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKV--VADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENCI 1508
            G+++ Y  + + EPN     ENC+ +Y+   G WNDI C      IC++     ++  +      +G      ++ GK    ++    ++ SAR+  M   G+   ++N +V +F      DL    W+  ND   E +++ +D + + Y N+  G P G R  +     +   S      W +  C  +   IC   ++   +P   P+     +   TF+         EA   CK++  ++V   +   N+ +  +  +   + +W  L+ N    + KW D+ +  L++  +   EP       C+  Y+ +DG W    C  +N F+IC + D++   D          D D+            + VS  +  Y  +L+ C   G  LA  +  +++  +    +++      +WI G     E KW+  +   + + NW   EP+ +  E+C+
Sbjct:  807 GSVMNYVAWASYEPNFANNDENCVVMYK-NMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRVIKNSNRTTDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNIDVWIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKY-REPFWIGLNSNKTGNQYKWTDNWK--LRYTKWAAEEPKKTT--ACV--YMDIDGQWKTSSCT-ENYFSICKQSDAIAPTDPPQKPGKCPPDSDDRSWIPFRGHCYLIQVSYTKNWYQASLE-CLRFGGSLASFDDSLESNFVWHQIERLEDRVKSFWI-GMYQNVENKWLWLDNAPVDFVNWNIGEPSDHNDEHCV 1255          

HSP 6 Score: 21.1718 bits (43), Expect = 4.100e-10
Identity = 8/25 (32.00%), Postives = 13/25 (52.00%), Query Frame = 1
Query: 1516 YLEEGTWRDIACTNKYLAICTLNPN 1590
            Y   GTW ++ C++    IC +  N
Sbjct: 1258 YSSHGTWNNLYCSSYRGYICKIQKN 1282          

HSP 7 Score: 53.1434 bits (126), Expect = 1.671e-6
Identity = 60/261 (22.99%), Postives = 105/261 (40.23%), Query Frame = 3
Query:   90 TLFVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAIC-QKDSEVSTDQLEIEGNIFVVSKGKMTFADAQEYCS-----------ARSLKMIRIGHAL--------DNAIVHSFAR-ETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVIC 809
            T  +  + ++++EA + CKS    LV +     N+ +  + +K   + +WI  N       +  +    L Y  +   EP   ++  C  VY    G W   +C    ++IC Q D+   TD  +  G     S  + ++   + +C              SL+ +R G +L         N + H   R E     +W+ G     E KW+  D   + + N+ +GEP     E+C   Y ++ + WN+L C      IC
Sbjct: 1025 TFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSK-YREPFWIGLNSNKTGNQYKWTDNWKLRYTKWAAEEPK--KTTAC--VYMDIDGQWKTSSCTENYFSICKQSDAIAPTDPPQKPGKCPPDSDDR-SWIPFRGHCYLIQVSYTKNWYQASLECLRFGGSLASFDDSLESNFVWHQIERLEDRVKSFWI-GMYQNVENKWLWLDNAPVDFVNWNIGEPSDHNDEHCVEMYSSHGT-WNNLYCSSYRGYIC 1277          
BLAST of Lectin 2b vs. Ensembl Mouse
Match: Mrc1 (mannose receptor, C type 1 [Source:MGI Symbol;Acc:MGI:97142])

HSP 1 Score: 65.0846 bits (157), Expect = 3.177e-17
Identity = 111/537 (20.67%), Postives = 195/537 (36.31%), Query Frame = 3
Query:  117 TYNEALQSCKSRGMRLVRVNSAEDNAVVNGF--ANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRS-ENCINVYRLPSGLWNDITCLARIWAICQ---------KDSEVSTDQLEIEGNIFVV--------SKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPG-GGRVENCAHGYLNYDSLWNDLPCHFNLWVICYR--SEIRAPGADPNTL---------------------IASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNE------NC---LNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFEIDMDNMMVSAE--------RYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENCIFILLRRRDMEGY 1544
            T+ E+   CK+ G  L  + S ++  V+     ++    + +W+     +    F  S G+ ++Y+N+   EPN  ++ E C  +   P   WNDI C      ICQ         + +    D   +  + +V+        SK K T  +A+ +C      +  I    +   +  +  +      +  G  I  + K++  DG  + +  +  GEP      ENC   Y N    WND+ C +    IC R  S I A                              A+ ++ ++Q+A+  CK     +V   NA E A V    R  T +  W   ND   E  ++ +    + +  +  G P G  +       +C   + G     G W D  C  K  + IC   +             D  +   +        +  ++EA  +C+   + LA +     NA  A           WI  N +    ++  ++   + Y NW A EP       C+++     D++GY
Sbjct:  672 TWFESRDFCKAIGGELASIKSKDEQQVIWRLITSSGSYHELFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPGMSWNDINCEHLNNWICQIQKGKTLLPEPTPAPQDNPPVTADGWVIYKDYQYYFSKEKETMDNARAFCKKNFGDLATIKSESEKKFLWKYINKNGGQSPYFIGMLISMDKKFIWMDGSKVDFVAWATGEPNFANDDENCVTMYTN-SGFWNDINCGYPNNFICQRHNSSINATAMPTTPTTPGGCKEGWHLYKNKCFKIFGFANEEKKSWQDARQACKGLKGNLVSIENAQEQAFVTYHMRDSTFNA-WTGLNDINAEHMFLWTAGQGVHYTNWGKGYPGGRRSSLSYEDADCVVVIGGNSREAGTWMDDTCDSKQGY-ICQTQTDPSLPVSPTTTPKDGFVTYGKSSYSLMKLKLPWHEAETYCKDHTSLLASILDPYSNA-FAWMKMHPFNVPIWIALNSNLTNNEYTWTDRWRVRYTNWGADEPKLKSA--CVYM-----DVDGY 1197          

HSP 2 Score: 43.5134 bits (101), Expect = 3.177e-17
Identity = 34/161 (21.12%), Postives = 67/161 (41.61%), Query Frame = 1
Query: 1525 EGTWRDIACTNKYLAIC--------TLNPNAGAKTAD-------------YHF-TKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDS-YWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSFATGLWVDSKCDDFNSVVC 1938
            +G WR   C   +  +C        T  P    K  +             Y+F +    ++  A+L C  +G  +V +     +  L+   + LK  + +W+    N E GKW+  N++ + + N+    P+G R+   + + ++GLW +  C  +   +C
Sbjct: 1195 DGYWRTSYCNESFYFLCKKSDEIPATEPPQLPGKCPESEQTAWIPFYGHCYYFESSFTRSWGQASLECLRMGASLVSIETAAESSFLSYRVEPLKSKTNFWIGMFRNVE-GKWLWLNDNPVSFVNWKTGDPSGERNDCVVLASSSGLWNNIHCSSYKGFIC 1354          

HSP 3 Score: 82.8037 bits (203), Expect = 1.004e-15
Identity = 93/395 (23.54%), Postives = 167/395 (42.28%), Query Frame = 3
Query:   96 FVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSE------NCINVY---RLPSGLWNDITCLARIWAICQKDSE----VSTDQLEIEGNI------FVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYRS-EIRA------PGADPNT--------------LIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPC 1160
            F  +   ++ +A Q+CK     LV + +A++ A V         ++ W   ND  AE +F+ + G  + Y N+G   P G RS       +C+ V       +G W D TC ++   ICQ  ++    VS      +G +      + + K K+ + +A+ YC   +  +  I     NA         N  + W+  N  +T  ++  +D   + Y N+   EP   ++++ A  Y++ D  W    C+ + + +C +S EI A      PG  P +                +S+ R ++ +A   C   G  +V    AAE++ +      + S   +  G    +EGKW+   +N +    +  G+P+G  N+  +    S  GLWN+  C
Sbjct:  961 FANEEKKSWQDARQACKGLKGNLVSIENAQEQAFVTYHMRDSTFNA-WTGLNDINAEHMFLWTAGQGVHYTNWGKGYPGGRRSSLSYEDADCVVVIGGNSREAGTWMDDTCDSKQGYICQTQTDPSLPVSPTTTPKDGFVTYGKSSYSLMKLKLPWHEAETYCKDHTSLLASILDPYSNAFAWMKMHPFNVPI-WIALNSNLTNNEYTWTDRWRVRYTNWGADEP---KLKS-ACVYMDVDGYWRTSYCNESFYFLCKKSDEIPATEPPQLPGKCPESEQTAWIPFYGHCYYFESSFTR-SWGQASLECLRMGASLVSIETAAESSFLSYRVEPLKSKTNFWIGMFRNVEGKWLWLNDNPVSFVNWKTGDPSGERNDCVV--LASSSGLWNNIHC 1346          

HSP 4 Score: 76.6406 bits (187), Expect = 6.744e-14
Identity = 116/525 (22.10%), Postives = 200/525 (38.10%), Query Frame = 3
Query:  129 ALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPN--GGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVSTDQLEIEGN--------------IFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNY-DSLWNDLPCHFNLWVICYR--------------SEIRAP---GADPNTLI-------ASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITS-----DLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVN-ENCLNGYLSLD-GL-WNDFPCPYKNLFAICAKDSLKIKDNENFEIDMDNMMVSA---------------ERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPN-GNRGENCI 1508
            ALQ+C+  G  L  ++S E+   +         D  WI  ND   +  F  S G  +T+  +   EP+    R E+C+ V +   G W D  C   +  IC+  S+  +  +  EG                +++     TF DA   C+     +  +    + A + S         +W   +D+  +G +  +  + + + ++    P  GR   C          LW+ L C      +C                 E + P   G    T +         +++ T+ E++D+CKA G ++    +  E  ++    R ITS     +L+WL          +  S+ + + ++ +  GEPN   N E C  G L  D G+ WND  C + N + IC     K    E      DN  V+A               E+ T + A  FC+     LA + S+ +   L  +  K      +  G   + + K++  + + + +  WA  EPN  N  ENC+
Sbjct:  387 ALQACRKEGGDLASIHSIEEFDFIFSQLGYEPNDELWIGLNDIKIQMYFEWSDGTPVTFTKWLPGEPSHENNRQEDCV-VMKGKDGYWADRACEQPLGYICKMVSQ--SHAVVPEGADKGCRKGWKRHGFYCYLIGSTLSTFTDANHTCTNEKAYLTTVEDRYEQAFLTSLVGLRPEKYFWTGLSDVQNKGTFRWTVDEQVQFTHWNADMP--GRKAGCVAMKTGVAGGLWDVLSCEEKAKFVCKHWAEGVTRPPEPTTTPEPKCPENWGTTSKTSMCFKLYAKGKHEKKTWFESRDFCKAIGGELASIKSKDEQQVIW---RLITSSGSYHELFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYC--GELKGDPGMSWNDINCEHLNNW-ICQIQKGKTLLPEPTPAPQDNPPVTADGWVIYKDYQYYFSKEKETMDNARAFCKKNFGDLATIKSESEKKFLWKYINKNGGQSPYFIGMLISMDKKFIWMDGSKVDFVAWATGEPNFANDDENCV 900          

HSP 5 Score: 74.3294 bits (181), Expect = 3.672e-13
Identity = 115/536 (21.46%), Postives = 203/536 (37.87%), Query Frame = 3
Query:   96 FVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPN-GGRSENCINVYRLPSGLWNDITCLARIWAICQK-DSEVSTDQLEI---------EG---------NIF-VVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVE------NCA---HGYLNYDSLWNDLPCHFNLWVICYR----SEIRAPGADPNTLIASYD---------RLTFQEAQDYCKAQGLKMVRANNAAENAL----VHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAK-DSLKIKDNENFEIDMDNMMVSAERYTYNEALQF--------------CRTRGTQLARVNSQVDNAMLAAFAKKVVADY-YWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENCIFI 1514
            + +K   T + A   CK     L  + S  +   +  + NK    S +  G   + +  F+   G+ + +  + T EPN     ENC+ +Y   SG WNDI C      ICQ+ +S ++   +           EG          IF   ++ K ++ DA++ C      ++ I +A + A V    R++  +  W   NDI  E  ++ + G+ + Y N+  G PGG R        +C     G       W D  C      IC      S   +P   P     +Y          +L + EA+ YCK     +    +   NA     +H F   I     W+  N      ++  ++   +++  +   EP   +   C+  Y+ +DG W    C  ++ + +C K D +   +             +A    Y     F              C   G  L  + +  +++ L+   + + +   +WI G     EGKW+  N N + + NW   +P+G R + C+ +
Sbjct:  813 YFSKEKETMDNARAFCKKNFGDLATIKSESEKKFLWKYINKNGGQSPYFIGMLISMDKKFIWMDGSKVDFVAWATGEPNFANDDENCVTMY-TNSGFWNDINCGYPNNFICQRHNSSINATAMPTTPTTPGGCKEGWHLYKNKCFKIFGFANEEKKSWQDARQACKGLKGNLVSIENAQEQAFVTYHMRDSTFNA-WTGLNDINAEHMFLWTAGQGVHYTNWGKGYPGGRRSSLSYEDADCVVVIGGNSREAGTWMDDTCDSKQGYICQTQTDPSLPVSPTTTPKDGFVTYGKSSYSLMKLKLPWHEAETYCKDHTSLLASILDPYSNAFAWMKMHPFNVPI-----WIALNSNLTNNEYTWTDRWRVRYTNWGADEPK--LKSACV--YMDVDGYWRTSYCN-ESFYFLCKKSDEIPATEPPQLPGKCPESEQTAWIPFYGHCYYFESSFTRSWGQASLECLRMGASLVSIETAAESSFLSYRVEPLKSKTNFWI-GMFRNVEGKWLWLNDNPVSFVNWKTGDPSGERND-CVVL 1334          

HSP 6 Score: 52.373 bits (124), Expect = 2.363e-6
Identity = 60/273 (21.98%), Postives = 101/273 (37.00%), Query Frame = 3
Query:  759 DSLWNDLPCHFNLWVICYRSEIRAPGADPNT----LIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAK-----DSLKIKDNENFEIDMDNM----------MVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPN--GNRGENCIFI 1514
            D L+   P HF           R    DP T     I S   LT+ +A+  CK Q   ++      E   + G    ++S L W+  N   +   W  +  +  ++  + PG P+    ++C++     +  W +  C  K L  IC K     +   I    +      N           +   E+     ALQ CR  G  LA ++S  +   + +       D  WI  ND   +  +  S+   + +  W   EP+   NR E+C+ +
Sbjct:  203 DKLFGFCPLHF-------EGSERLWNKDPLTGILYQINSKSALTWHQARASCKQQNADLLSVTEIHEQMYLTGLTSSLSSGL-WIGLNSLSVRSGWQWAGGSPFRYLNWLPGSPSSEPGKSCVSLNPGKNAKWENLECVQK-LGYICKKGNNTLNPFIIPSASDVPTGCPNQWWPYAGHCYRIHREEKKIQKYALQACRKEGGDLASIHSIEEFDFIFSQLGYEPNDELWIGLNDIKIQMYFEWSDGTPVTFTKWLPGEPSHENNRQEDCVVM 466          
BLAST of Lectin 2b vs. Ensembl Mouse
Match: Mrc2 (mannose receptor, C type 2 [Source:MGI Symbol;Acc:MGI:107818])

HSP 1 Score: 84.3445 bits (207), Expect = 2.533e-16
Identity = 111/569 (19.51%), Postives = 216/569 (37.96%), Query Frame = 3
Query:   42 FILITLDSCRSDIDVNTL------FVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVSTDQLE-----------------IEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGR--VENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGA--------------DPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEG--KWVDSEENDLKHKGF-HPGEPNGGV-------------NENCLN---GYLSLDGLWNDF------PCPYKNLFAICAKDSLK-IKDNENFEIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVAD---------YYWIDGN--DHTEEGKWVDSNANVLPYKNWAATEPNGNRGENCIFILL 1520
            F  I  + C +  D + L      F  ++ +++ EA  SC+ +G  L+ +    +   +NG      + + WI  ND    G +  S  + L Y N+ +++P+    ENC  +    SG W +  C   +  +C+K    + + ++                  +G+ + +   K ++ +++  C      ++ I    +   +    ++   +L W+  ND+  +  +  SDG  + + ++   EP   R  +E+C   +   +  WND PC+ +L  IC ++   + GA               P+      D++ + +A+  C   G ++V   N  E A V         + +W    D    G  +W+  +E    H     PG   GG               +NC +    Y+    L          P P  +L   C +  +   K    +++     +   E+ ++ +AL  CR  G QL  + S  +   +A    K+  +         ++WI  N  D  E   W  S+     Y N+A +  + +    C  + L
Sbjct:  226 FCPIKSNDCETFWDKDQLTDSCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGY-SSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKKKPNATVEPIQPDRWTNVKVECDPSWQPFQGHCYRLQAEKRSWQESKRACLRGGGDLLSIHSMAELEFITKQIKQEVEEL-WIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVTIW-GPEGRWNDSPCNQSLPSICKKAGRLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQVIYSDARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFRWLSGDEVIYTHWNRDQPGYRRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWVSDPKLRHCYKVFSSERL--QEKKSWIQALGVCRELGAQLLSLASYEEEHFVAHMLNKIFGESEPESHEQHWFWIGLNRRDPREGHSWRWSDGLGFSYHNFARSRHDDDDIRGCAVLDL 789          
BLAST of Lectin 2b vs. Ensembl Mouse
Match: Mrc2 (mannose receptor, C type 2 [Source:MGI Symbol;Acc:MGI:107818])

HSP 1 Score: 83.9593 bits (206), Expect = 4.464e-16
Identity = 111/569 (19.51%), Postives = 216/569 (37.96%), Query Frame = 3
Query:   42 FILITLDSCRSDIDVNTL------FVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVSTDQLE-----------------IEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGR--VENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGA--------------DPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEG--KWVDSEENDLKHKGF-HPGEPNGGV-------------NENCLN---GYLSLDGLWNDF------PCPYKNLFAICAKDSLK-IKDNENFEIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVAD---------YYWIDGN--DHTEEGKWVDSNANVLPYKNWAATEPNGNRGENCIFILL 1520
            F  I  + C +  D + L      F  ++ +++ EA  SC+ +G  L+ +    +   +NG      + + WI  ND    G +  S  + L Y N+ +++P+    ENC  +    SG W +  C   +  +C+K    + + ++                  +G+ + +   K ++ +++  C      ++ I    +   +    ++   +L W+  ND+  +  +  SDG  + + ++   EP   R  +E+C   +   +  WND PC+ +L  IC ++   + GA               P+      D++ + +A+  C   G ++V   N  E A V         + +W    D    G  +W+  +E    H     PG   GG               +NC +    Y+    L          P P  +L   C +  +   K    +++     +   E+ ++ +AL  CR  G QL  + S  +   +A    K+  +         ++WI  N  D  E   W  S+     Y N+A +  + +    C  + L
Sbjct:  226 FCPIKSNDCETFWDKDQLTDSCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGY-SSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKKKPNATVEPIQPDRWTNVKVECDPSWQPFQGHCYRLQAEKRSWQESKRACLRGGGDLLSIHSMAELEFITKQIKQEVEEL-WIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVTIW-GPEGRWNDSPCNQSLPSICKKAGRLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQVIYSDARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFRWLSGDEVIYTHWNRDQPGYRRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWVSDPKLRHCYKVFSSERL--QEKKSWIQALGVCRELGAQLLSLASYEEEHFVAHMLNKIFGESEPESHEQHWFWIGLNRRDPREGHSWRWSDGLGFSYHNFARSRHDDDDIRGCAVLDL 789          

HSP 2 Score: 73.559 bits (179), Expect = 2.976e-15
Identity = 114/536 (21.27%), Postives = 201/536 (37.50%), Query Frame = 3
Query:  117 TYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADS---------YWIDGN--DETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVSTDQLEI--EGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFA---------RETNSDL---YWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGG-GRVENCAHGYLNYDSLWNDLPCHFNLWVICYRS----EIRAPGADPNTLIA-------------------SYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNG------GVNENCLNGYL-----SLDGLWNDFPCPYKNLFAICAKDS--------LKIKDNENFEIDMDN--MMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENCIFI 1514
            ++ +AL  C+  G +L+ + S E+   V    NK+  +S         +WI  N  D      +  S G   +Y NF  +  +      C  V  L S  W  + C  ++  IC+    V   + +I  +G +  V   +  +   + + S    + I      D   VHS A         ++ +SD    +W+  + + ++G++  +DG  + + ++  G+P   G+ + C +     +  W D  CH  L  IC RS    E +     P+ L                       DR+ + EAQ  C+ Q  ++V   N  E A +      +T DL W+  + ++ + +W+  E+  L +  + PGEP+G      G         L        G W+D  C  +    IC K +                 E+   N    +  +   + +AL  C +R   LA V      A L   A+ +     WI         ++   +   L Y +W   EP  + G  C ++
Sbjct:  695 SWIQALGVCRELGAQLLSLASYEEEHFVAHMLNKIFGESEPESHEQHWFWIGLNRRDPREGHSWRWSDGLGFSYHNFARSRHDDDDIRGCA-VLDLASLQWVPMQCQTQLDWICKIPRGVDVREPDIGRQGRLEWVRFQEAEYKFFEHHSSWAQAQRICTWFQADLTSVHSQAELDFLGQNLQKLSSDQEQHWWIGLHTLESDGRFRWTDGSIINFISWAPGKPRPIGKDKKCVYMTARQED-WGDQRCHTALPYICKRSNSSGETQPQDLPPSALGGCPSGWNQFLNKCFRIQGQDPQDRVKWSEAQFSCEQQEAQLVTIANPLEQAFITASLPNVTFDL-WIGLHASQRDFQWI--EQEPLLYTNWAPGEPSGPSPAPSGTKPTSCAVILHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLSPSPAATPPAPGAELSYLNHTFRLLQKPLRWKDALLLCESRNASLAHVPDPYTQAFLTQAARGLQTP-LWIGLASEEGSRRYSWLSEEPLNYVSWQDEEPQHSGG--CAYV 1222          

HSP 3 Score: 28.4906 bits (62), Expect = 2.976e-15
Identity = 37/173 (21.39%), Postives = 68/173 (39.31%), Query Frame = 1
Query: 1510 SYYLEEGTWRDIACTNKYL-AICTLNPNAGAKTADYHFT----------------------KVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSY--WLDGNDNAEEGKWVDTNNSTLLYKNFAAE--APNGGRDKNC--LQSFATGLWVDSKCDDFN-SVVC 1938
            +Y   +GTWR  +C  K   A+C ++     +  +Y  +                      +V +  + A   C+  G  V+ + +   N  + +  +  +  S   WL  N N + G  V  +N+ + Y N+      P+     +C  +QS ++GLW    C +    VVC
Sbjct: 1220 AYVDVDGTWRTTSCDTKLQGAVCGVSRGPPPRRINYRGSCPQGLADSSWIPFREHCYSFHMEVLLGHKEALQRCQKAGGTVLSILDEMENVFVWEHLQTAEAQSRGAWLGMNFNPKGGTLVWQDNTAVNYSNWGPPGLGPSMLSHNSCYWIQS-SSGLWRPGACTNITMGVVC 1391          
BLAST of Lectin 2b vs. Ensembl Mouse
Match: Clec3b (C-type lectin domain family 3, member b [Source:MGI Symbol;Acc:MGI:104540])

HSP 1 Score: 62.3882 bits (150), Expect = 1.508e-10
Identity = 38/124 (30.65%), Postives = 64/124 (51.61%), Query Frame = 3
Query:   72 SDIDVNTLFVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLAD--SYWIDGNDETAEGIFVNSKGNLLTYKNFGT---NEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQ 428
            + +++  L       T++EA + C S+G  L    S  +N  +  +A   + +  + W+  ND  AEG +V+  G LL YKN+ T    +P+GG++ENC  +    +G W D  C  ++  ICQ
Sbjct:   75 TKVNLKCLLAFTQPKTFHEASEDCISQGGTLGTPQSELENEALFEYARHSVGNDANIWLGLNDMAAEGAWVDMTGGLLAYKNWETEITTQPDGGKAENCAALSGAANGKWFDKRCRDQLPYICQ 198          

HSP 2 Score: 61.2326 bits (147), Expect = 3.704e-10
Identity = 32/110 (29.09%), Postives = 58/110 (52.73%), Query Frame = 3
Query: 1191 KDSLKIKDNENFEIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVAD--YYWIDGNDHTEEGKWVDSNANVLPYKNWA---ATEPNGNRGENC 1505
            K +L+    +  ++++  ++   +  T++EA + C ++G  L    S+++N  L  +A+  V +    W+  ND   EG WVD    +L YKNW     T+P+G + ENC
Sbjct:   64 KQALQTVCLKGTKVNLKCLLAFTQPKTFHEASEDCISQGGTLGTPQSELENEALFEYARHSVGNDANIWLGLNDMAAEGAWVDMTGGLLAYKNWETEITTQPDGGKAENC 173          

HSP 3 Score: 56.6102 bits (135), Expect = 1.241e-8
Identity = 41/118 (34.75%), Postives = 58/118 (49.15%), Query Frame = 1
Query: 1618 FTKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLD--SYWLDGNDNAEEGKWVDTNNSTLLYKNFAAE---APNGGRDKNC--LQSFATGLWVDSKCDDFNSVVCYGSI 1950
            FT+ K TF  A+  C S G  +   ++   N  L + A++   +  + WL  ND A EG WVD     L YKN+  E    P+GG+ +NC  L   A G W D +C D    +C  +I
Sbjct:   85 FTQPK-TFHEASEDCISQGGTLGTPQSELENEALFEYARHSVGNDANIWLGLNDMAAEGAWVDMTGGLLAYKNWETEITTQPDGGKAENCAALSGAANGKWFDKRCRDQLPYICQFAI 201          

HSP 4 Score: 54.299 bits (129), Expect = 8.517e-8
Identity = 36/108 (33.33%), Postives = 50/108 (46.30%), Query Frame = 3
Query:  501 TFADAQEYCSARSLKMIRIGHALDNAIVHSFARET--NSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFP---VGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVIC 809
            TF +A E C ++   +      L+N  +  +AR +  N    W+  ND+  EG WVD  G  L YKN+      +P GG+ ENCA      +  W D  C   L  IC
Sbjct:   90 TFHEASEDCISQGGTLGTPQSELENEALFEYARHSVGNDANIWLGLNDMAAEGAWVDMTGGLLAYKNWETEITTQPDGGKAENCAALSGAANGKWFDKRCRDQLPYIC 197          

HSP 5 Score: 50.0618 bits (118), Expect = 2.434e-6
Identity = 40/120 (33.33%), Postives = 55/120 (45.83%), Query Frame = 3
Query:  852 LIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARR-ITSDL-YWLDGNDAKLEGKWVDSEENDLKHKGFH---PGEPNGGVNENCLNGYLSLDGLWNDFPC----PYKNLFAI 1184
            L+A     TF EA + C +QG  +    +  EN  +  +AR  + +D   WL  ND   EG WVD     L +K +      +P+GG  ENC     + +G W D  C    PY   FAI
Sbjct:   82 LLAFTQPKTFHEASEDCISQGGTLGTPQSELENEALFEYARHSVGNDANIWLGLNDMAAEGAWVDMTGGLLAYKNWETEITTQPDGGKAENCAALSGAANGKWFDKRCRDQLPYICQFAI 201          
BLAST of Lectin 2b vs. Ensembl Mouse
Match: Clec3a (C-type lectin domain family 3, member a [Source:MGI Symbol;Acc:MGI:2685642])

HSP 1 Score: 57.3806 bits (137), Expect = 5.555e-9
Identity = 30/113 (26.55%), Postives = 59/113 (52.21%), Query Frame = 3
Query:   96 FVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVL--ADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQ 428
              ++ L  Y+EA + C S+G  LV   ++++   +  +  + L   + +W+  ND   EG F++  G  +++ N+   +P+GG+ ENC+   +   G W+D  C +    IC+
Sbjct:   80 LASEGLKHYHEANEDCISKGGTLVVPRNSDEINALRDYGKRSLPGVNDFWLGINDMVTEGKFLDVHGFAVSFLNWDRAQPSGGKRENCVLFSQSAQGKWSDEACRSSKRYICE 192          

HSP 2 Score: 51.9878 bits (123), Expect = 4.117e-7
Identity = 32/145 (22.07%), Postives = 68/145 (46.90%), Query Frame = 3
Query:  381 LWNDITCLARIWAICQKDSEVSTDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDL--YWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVIC 809
            LW ++  L  + A+      V     ++    ++ S+G   + +A E C ++   ++   ++ +   +  + + +   +  +W+  ND+VTEGK++D  G  + + N+   +P GG+ ENC     +    W+D  C  +   IC
Sbjct:   51 LWREVNALKEMQAL----QTVCLRGTKVHKKCYLASEGLKHYHEANEDCISKGGTLVVPRNSDEINALRDYGKRSLPGVNDFWLGINDMVTEGKFLDVHGFAVSFLNWDRAQPSGGKRENCVLFSQSAQGKWSDEACRSSKRYIC 191          
BLAST of Lectin 2b vs. UniProt/SwissProt
Match: sp|P22897|MRC1_HUMAN (Macrophage mannose receptor 1 OS=Homo sapiens OX=9606 GN=MRC1 PE=1 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 3.787e-20
Identity = 111/546 (20.33%), Postives = 206/546 (37.73%), Query Frame = 3
Query:   96 FVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYR-LPSGLWNDITCLARIWAICQKDSEV--------------------STDQLEIEGNIFVVSKG-KMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNS--DLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGR-VENCAHGYLNYDSLWNDLPC-HFNLWVICYRSEIRAPGADPNTLIA--------------------SYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPN-GGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKI----------------KDNENFEIDMDNMM---VSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGE------NCIFIL 1517
             +  TL T+ EA Q+C +    L  +    + A +  F        +W   +D   +G F  +    + + ++ ++ P  GR   C+ +   +  GLW+ + C  +   +C+  +E                     ++ +  +   ++   K  K T+ +++++C A    +  I +  +   +      + S   L+W+          +  SDG  + Y+N+  GEP   + VE C     +    WND+ C H N W IC   + + P  +P                         S ++ T   A+ +CK     +V   + +E   +  +  R  +   +  G    L+ K+   + + + +  +  GEPN    +ENC+  Y S  G WND  C Y N F IC + +  I                K+  NF  +    +   +  ER  + EA + C   G  L  + ++ + A L    K       W   ND   E  ++ ++   + Y NW    P G R        +C+ I+
Sbjct:  517 MIGHTLSTFAEANQTCNNENAYLTTIEDRYEQAFLTSFVGLRPEKYFWTGLSDIQTKGTFQWTIEEEVRFTHWNSDMP--GRKPGCVAMRTGIAGGLWDVLKCDEKAKFVCKHWAEGVTHPPKPTTTPEPKCPEDWGASSRTSLCFKLYAKGKHEKKTWFESRDFCRALGGDLASINNKEEQQTIWRLITASGSYHKLFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPTMSWNDINCEHLNNW-ICQIQKGQTPKPEPTPAPQDNPPVTEDGWVIYKDYQYYFSKEKETMDNARAFCKRNFGDLVSIQSESEKKFLWKYVNRNDAQSAYFIGLLISLDKKFAWMDGSKVDYVSWATGEPNFANEDENCVTMY-SNSGFWNDINCGYPNAF-ICQRHNSSINATTVMPTMPSVPSGCKEGWNFYSNKCFKIFGFMEEERKNWQEARKACIGFGGNLVSIQNEKEQAFLTYHMKDSTFS-AWTGLNDVNSEHTFLWTDGRGVHYTNWGKGYPGGRRSSLSYEDADCVVII 1056          

HSP 2 Score: 34.2686 bits (77), Expect = 3.787e-20
Identity = 35/158 (22.15%), Postives = 61/158 (38.61%), Query Frame = 1
Query: 1522 EEGTWRDIACTNKYLAICTL-------NPNAGAKT--------ADYHFTKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDS----YWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSFATGLWVDSKCDDFNSVVC 1938
            E G W D  C +K   IC         NP A  +T        + Y   + K  +  A  YCK     +  + +  SN        +L++++     W+  N N  + ++  T+   + Y N+AA+ P       C+     G W  + C++    +C
Sbjct: 1062 EAGKWMDDTCDSKRGYICQTRSDPSLTNPPATIQTDGFVKYGKSSYSLMRQKFQWHEAETYCKLHNSLIASILDPYSNAF-----AWLQMETSNERVWIALNSNLTDNQYTWTDKWRVRYTNWAADEPK--LKSACVYLDLDGYWKTAHCNESFYFLC 1212          

HSP 3 Score: 82.8037 bits (203), Expect = 5.914e-15
Identity = 118/527 (22.39%), Postives = 202/527 (38.33%), Query Frame = 3
Query:  126 EALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPN--GGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVSTDQL-EIEGNI-----------FVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEG--KWVDSDGKDLIYKN--FPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYR--------------SEIRAP---GADPNTLI-------ASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSD-----LYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVN-ENC--LNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFEIDMDNMMV---------------SAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPN-GNRGENCI 1508
            +AL +C+  G  L  +++ E+   +         D  WI  ND   +  F  S G  +T+  +   EP+    R E+C+ V +   G W D  C   +  IC+  S     ++ E+E              +++     TFA+A + C+  +  +  I    + A + SF        +W   +DI T+G  +W   +     + N   P  +PG   +     G      LW+ L C      +C                 E + P   GA   T +         +++ T+ E++D+C+A G  +   NN  E   +    R IT+      L+WL          +  S+ + + ++ +  GEPN   N E C  L G  ++   WND  C + N + IC     +    E      DN  V               S E+ T + A  FC+     L  + S+ +   L  +  +  A   +  G   + + K+   + + + Y +WA  EPN  N  ENC+
Sbjct:  386 DALTTCRKEGGDLTSIHTIEELDFIISQLGYEPNDELWIGLNDIKIQMYFEWSDGTPVTFTKWLRGEPSHENNRQEDCV-VMKGKDGYWADRGCEWPLGYICKMKSRSQGPEIVEVEKGCRKGWKKHHFYCYMIGHTLSTFAEANQTCNNENAYLTTIEDRYEQAFLTSFVGLRPEKYFWTGLSDIQTKGTFQWTIEEEVRFTHWNSDMPGRKPGCVAMRTGIAG-----GLWDVLKCDEKAKFVCKHWAEGVTHPPKPTTTPEPKCPEDWGASSRTSLCFKLYAKGKHEKKTWFESRDFCRALGGDLASINNKEEQQTIW---RLITASGSYHKLFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPTMS--WNDINCEHLNNW-ICQIQKGQTPKPEPTPAPQDNPPVTEDGWVIYKDYQYYFSKEKETMDNARAFCKRNFGDLVSIQSESEKKFLWKYVNRNDAQSAYFIGLLISLDKKFAWMDGSKVDYVSWATGEPNFANEDENCV 900          

HSP 4 Score: 79.7221 bits (195), Expect = 6.143e-14
Identity = 97/410 (23.66%), Postives = 176/410 (42.93%), Query Frame = 3
Query:   96 FVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSE------NCINVYRLPS---GLWNDITCLARIWAICQ--KDSEVSTDQLEIEGNIFV--------VSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYRS-EIRA------PGADPNT--------------LIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPC-PYKNLFAICAKDSL 1202
            F+ +    + EA ++C   G  LV + + ++ A +  +  K    S W   ND  +E  F+ + G  + Y N+G   P G RS       +C+ +    S   G W D TC ++   ICQ   D  ++     I+ + FV        + + K  + +A+ YC   +  +  I     NA       ET+++  W+  N  +T+ ++  +D   + Y N+   EP   ++++ A  YL+ D  W    C+ + + +C RS EI A      PG  P +              + +SY R  + +A   C   G  +V   +AAE++ +      + S   +  G    +EG W+    + +    ++ G+P+G  N+ C+  + S  G W++  C  YK    IC +  +
Sbjct:  962 FMEEERKNWQEARKACIGFGGNLVSIQNEKEQAFLT-YHMKDSTFSAWTGLNDVNSEHTFLWTDGRGVHYTNWGKGYPGGRRSSLSYEDADCVVIIGGASNEAGKWMDDTCDSKRGYICQTRSDPSLTNPPATIQTDGFVKYGKSSYSLMRQKFQWHEAETYCKLHNSLIASILDPYSNAFAW-LQMETSNERVWIALNSNLTDNQYTWTDKWRVRYTNWAADEP---KLKS-ACVYLDLDGYWKTAHCNESFYFLCKRSDEIPATEPPQLPGRCPESDHTAWIPFHGHCYYIESSYTR-NWGQASLECLRMGSSLVSIESAAESSFLSYRVEPLKSKTNFWIGLFRNVEGTWLWINNSPVSFVNWNTGDPSGERND-CVALHAS-SGFWSNIHCSSYKGY--ICKRPKI 1360          

HSP 5 Score: 73.9442 bits (180), Expect = 3.435e-12
Identity = 101/522 (19.35%), Postives = 198/522 (37.93%), Query Frame = 3
Query:  102 TKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQK------------DSEVST----DQLEIEGNIFVVSKG-KMTFADAQEYCSARSLKMIRIGHALD--NAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPG--GGRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGADPNTL----------------IASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSL-DGLWNDFPCPYKNLFAI--------------------CAKD-SLKIKDNENFEIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAF--AKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPN 1484
            +K+ +T+++A +SC+ +   L+ +    +   + G  +  L    WI  N  +    +  S  +   Y N+    P+    ++C+++    +  W ++ C+ ++  IC+K            +S+V T          G+ + + +  K    DA   C      +  I H ++  + I+     E N +L W+  NDI  +  +  SDG  + +  +  GEP     R E+C       D  W D  C + L  IC + + R+ G +   +                +  +   TF EA   C  +   +    +  E A +  F        +W   +D + +G +  + E +++   ++   P  G    C+     +  GLW+   C  K  F                      C +D     + +  F++         E+ T+ E+  FCR  G  LA +N++ +   +     A       +W+     +    +  S+ + + Y+NWA  EPN
Sbjct:  234 SKSALTWHQARKSCQQQNAELLSITEIHEQTYLTGLTSS-LTSGLWIGLNSLSFNSGWQWSDRSPFRYLNWLPGSPSAEPGKSCVSLNPGKNAKWENLECVQKLGYICKKGNTTLNSFVIPSESDVPTHCPSQWWPYAGHCYKIHRDEKKIQRDALTTCRKEGGDLTSI-HTIEELDFIISQLGYEPNDEL-WIGLNDIKIQMYFEWSDGTPVTFTKWLRGEPSHENNRQEDCV-VMKGKDGYWADRGCEWPLGYIC-KMKSRSQGPEIVEVEKGCRKGWKKHHFYCYMIGHTLSTFAEANQTCNNENAYLTTIEDRYEQAFLTSFVGLRPEKYFWTGLSDIQTKGTFQWTIEEEVRFTHWNSDMP--GRKPGCVAMRTGIAGGLWDVLKCDEKAKFVCKHWAEGVTHPPKPTTTPEPKCPEDWGASSRTSLCFKLYAKG---KHEKKTWFESRDFCRALGGDLASINNKEEQQTIWRLITASGSYHKLFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPN 745          

HSP 6 Score: 72.7886 bits (177), Expect = 8.081e-12
Identity = 109/528 (20.64%), Postives = 202/528 (38.26%), Query Frame = 3
Query:   96 FVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPN-GGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVSTDQLEIEGNIFVVSKG----------------------KMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVE------NCA---HGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGADPNTLI---------ASY----DRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFEI-----DMDNM-----------MVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADY-YWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNR 1493
            + +K   T + A   CK     LV + S  +   +  + N+  A S +  G   + +  F    G+ + Y ++ T EPN     ENC+ +Y   SG WNDI C      ICQ+ +  S +   +   +  V  G                      +  + +A++ C      ++ I +  + A +    +++     W   ND+ +E  ++ +DG+ + Y N+  G PGG R        +C     G  N    W D  C      IC      +    P T+          +SY     +  + EA+ YCK     +    +   NA         +++  W+  N    + ++  +++  +++  +   EP   +   C+  YL LDG W    C     F    K S +I   E  ++     + D+            + S+    + +A   C   G+ L  + S  +++ L+   + + +   +WI G     EG W+  N + + + NW   +P+G R
Sbjct:  813 YFSKEKETMDNARAFCKRNFGDLVSIQSESEKKFLWKYVNRNDAQSAYFIGLLISLDKKFAWMDGSKVDYVSWATGEPNFANEDENCVTMYS-NSGFWNDINCGYPNAFICQRHNS-SINATTVMPTMPSVPSGCKEGWNFYSNKCFKIFGFMEEERKNWQEARKACIGFGGNLVSIQNEKEQAFLTYHMKDSTFSA-WTGLNDVNSEHTFLWTDGRGVHYTNWGKGYPGGRRSSLSYEDADCVVIIGGASNEAGKWMDDTCDSKRGYICQTRSDPSLTNPPATIQTDGFVKYGKSSYSLMRQKFQWHEAETYCKLHNSLIASILDPYSNAFAW-LQMETSNERVWIALNSNLTDNQYTWTDKWRVRYTNWAADEPK--LKSACV--YLDLDGYWKTAHC--NESFYFLCKRSDEIPATEPPQLPGRCPESDHTAWIPFHGHCYYIESSYTRNWGQASLECLRMGSSLVSIESAAESSFLSYRVEPLKSKTNFWI-GLFRNVEGTWLWINNSPVSFVNWNTGDPSGER 1329          
BLAST of Lectin 2b vs. UniProt/SwissProt
Match: sp|Q61830|MRC1_MOUSE (Macrophage mannose receptor 1 OS=Mus musculus OX=10090 GN=Mrc1 PE=1 SV=2)

HSP 1 Score: 65.0846 bits (157), Expect = 1.928e-16
Identity = 111/537 (20.67%), Postives = 195/537 (36.31%), Query Frame = 3
Query:  117 TYNEALQSCKSRGMRLVRVNSAEDNAVVNGF--ANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRS-ENCINVYRLPSGLWNDITCLARIWAICQ---------KDSEVSTDQLEIEGNIFVV--------SKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPG-GGRVENCAHGYLNYDSLWNDLPCHFNLWVICYR--SEIRAPGADPNTL---------------------IASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNE------NC---LNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFEIDMDNMMVSAE--------RYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENCIFILLRRRDMEGY 1544
            T+ E+   CK+ G  L  + S ++  V+     ++    + +W+     +    F  S G+ ++Y+N+   EPN  ++ E C  +   P   WNDI C      ICQ         + +    D   +  + +V+        SK K T  +A+ +C      +  I    +   +  +  +      +  G  I  + K++  DG  + +  +  GEP      ENC   Y N    WND+ C +    IC R  S I A                              A+ ++ ++Q+A+  CK     +V   NA E A V    R  T +  W   ND   E  ++ +    + +  +  G P G  +       +C   + G     G W D  C  K  + IC   +             D  +   +        +  ++EA  +C+   + LA +     NA  A           WI  N +    ++  ++   + Y NW A EP       C+++     D++GY
Sbjct:  672 TWFESRDFCKAIGGELASIKSKDEQQVIWRLITSSGSYHELFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPGMSWNDINCEHLNNWICQIQKGKTLLPEPTPAPQDNPPVTADGWVIYKDYQYYFSKEKETMDNARAFCKKNFGDLATIKSESEKKFLWKYINKNGGQSPYFIGMLISMDKKFIWMDGSKVDFVAWATGEPNFANDDENCVTMYTN-SGFWNDINCGYPNNFICQRHNSSINATAMPTTPTTPGGCKEGWHLYKNKCFKIFGFANEEKKSWQDARQACKGLKGNLVSIENAQEQAFVTYHMRDSTFNA-WTGLNDINAEHMFLWTAGQGVHYTNWGKGYPGGRRSSLSYEDADCVVVIGGNSREAGTWMDDTCDSKQGY-ICQTQTDPSLPVSPTTTPKDGFVTYGKSSYSLMKLKLPWHEAETYCKDHTSLLASILDPYSNA-FAWMKMHPFNVPIWIALNSNLTNNEYTWTDRWRVRYTNWGADEPKLKSA--CVYM-----DVDGY 1197          

HSP 2 Score: 43.5134 bits (101), Expect = 1.928e-16
Identity = 34/161 (21.12%), Postives = 67/161 (41.61%), Query Frame = 1
Query: 1525 EGTWRDIACTNKYLAIC--------TLNPNAGAKTAD-------------YHF-TKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDS-YWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSFATGLWVDSKCDDFNSVVC 1938
            +G WR   C   +  +C        T  P    K  +             Y+F +    ++  A+L C  +G  +V +     +  L+   + LK  + +W+    N E GKW+  N++ + + N+    P+G R+   + + ++GLW +  C  +   +C
Sbjct: 1195 DGYWRTSYCNESFYFLCKKSDEIPATEPPQLPGKCPESEQTAWIPFYGHCYYFESSFTRSWGQASLECLRMGASLVSIETAAESSFLSYRVEPLKSKTNFWIGMFRNVE-GKWLWLNDNPVSFVNWKTGDPSGERNDCVVLASSSGLWNNIHCSSYKGFIC 1354          

HSP 3 Score: 82.8037 bits (203), Expect = 7.021e-15
Identity = 93/395 (23.54%), Postives = 167/395 (42.28%), Query Frame = 3
Query:   96 FVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSE------NCINVY---RLPSGLWNDITCLARIWAICQKDSE----VSTDQLEIEGNI------FVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYRS-EIRA------PGADPNT--------------LIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPC 1160
            F  +   ++ +A Q+CK     LV + +A++ A V         ++ W   ND  AE +F+ + G  + Y N+G   P G RS       +C+ V       +G W D TC ++   ICQ  ++    VS      +G +      + + K K+ + +A+ YC   +  +  I     NA         N  + W+  N  +T  ++  +D   + Y N+   EP   ++++ A  Y++ D  W    C+ + + +C +S EI A      PG  P +                +S+ R ++ +A   C   G  +V    AAE++ +      + S   +  G    +EGKW+   +N +    +  G+P+G  N+  +    S  GLWN+  C
Sbjct:  961 FANEEKKSWQDARQACKGLKGNLVSIENAQEQAFVTYHMRDSTFNA-WTGLNDINAEHMFLWTAGQGVHYTNWGKGYPGGRRSSLSYEDADCVVVIGGNSREAGTWMDDTCDSKQGYICQTQTDPSLPVSPTTTPKDGFVTYGKSSYSLMKLKLPWHEAETYCKDHTSLLASILDPYSNAFAWMKMHPFNVPI-WIALNSNLTNNEYTWTDRWRVRYTNWGADEP---KLKS-ACVYMDVDGYWRTSYCNESFYFLCKKSDEIPATEPPQLPGKCPESEQTAWIPFYGHCYYFESSFTR-SWGQASLECLRMGASLVSIETAAESSFLSYRVEPLKSKTNFWIGMFRNVEGKWLWLNDNPVSFVNWKTGDPSGERNDCVV--LASSSGLWNNIHC 1346          

HSP 4 Score: 74.3294 bits (181), Expect = 2.568e-12
Identity = 115/536 (21.46%), Postives = 203/536 (37.87%), Query Frame = 3
Query:   96 FVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPN-GGRSENCINVYRLPSGLWNDITCLARIWAICQK-DSEVSTDQLEI---------EG---------NIF-VVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVE------NCA---HGYLNYDSLWNDLPCHFNLWVICYR----SEIRAPGADPNTLIASYD---------RLTFQEAQDYCKAQGLKMVRANNAAENAL----VHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAK-DSLKIKDNENFEIDMDNMMVSAERYTYNEALQF--------------CRTRGTQLARVNSQVDNAMLAAFAKKVVADY-YWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENCIFI 1514
            + +K   T + A   CK     L  + S  +   +  + NK    S +  G   + +  F+   G+ + +  + T EPN     ENC+ +Y   SG WNDI C      ICQ+ +S ++   +           EG          IF   ++ K ++ DA++ C      ++ I +A + A V    R++  +  W   NDI  E  ++ + G+ + Y N+  G PGG R        +C     G       W D  C      IC      S   +P   P     +Y          +L + EA+ YCK     +    +   NA     +H F   I     W+  N      ++  ++   +++  +   EP   +   C+  Y+ +DG W    C  ++ + +C K D +   +             +A    Y     F              C   G  L  + +  +++ L+   + + +   +WI G     EGKW+  N N + + NW   +P+G R + C+ +
Sbjct:  813 YFSKEKETMDNARAFCKKNFGDLATIKSESEKKFLWKYINKNGGQSPYFIGMLISMDKKFIWMDGSKVDFVAWATGEPNFANDDENCVTMY-TNSGFWNDINCGYPNNFICQRHNSSINATAMPTTPTTPGGCKEGWHLYKNKCFKIFGFANEEKKSWQDARQACKGLKGNLVSIENAQEQAFVTYHMRDSTFNA-WTGLNDINAEHMFLWTAGQGVHYTNWGKGYPGGRRSSLSYEDADCVVVIGGNSREAGTWMDDTCDSKQGYICQTQTDPSLPVSPTTTPKDGFVTYGKSSYSLMKLKLPWHEAETYCKDHTSLLASILDPYSNAFAWMKMHPFNVPI-----WIALNSNLTNNEYTWTDRWRVRYTNWGADEPK--LKSACV--YMDVDGYWRTSYCN-ESFYFLCKKSDEIPATEPPQLPGKCPESEQTAWIPFYGHCYYFESSFTRSWGQASLECLRMGASLVSIETAAESSFLSYRVEPLKSKTNFWI-GMFRNVEGKWLWLNDNPVSFVNWKTGDPSGERND-CVVL 1334          
BLAST of Lectin 2b vs. UniProt/SwissProt
Match: sp|Q4TU93|MRC2_RAT (C-type mannose receptor 2 OS=Rattus norvegicus OX=10116 GN=Mrc2 PE=1 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 4.704e-16
Identity = 115/536 (21.46%), Postives = 203/536 (37.87%), Query Frame = 3
Query:  117 TYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADS---------YWIDGN--DETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVSTDQLEI--EGNI---------FVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDL---YWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGG-GRVENCAHGYLNYDSLWNDLPCHFNLWVICYRS----EIRAPGADPNTLIA-------------------SYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNG------GVNENCLNGYL-----SLDGLWNDFPCPYKNLFAICAKDS--------LKIKDNENFEIDMDN--MMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENCIFI 1514
            ++ EAL  C+  G +L+ + S E+   V    NK+  +S         +WI  N  D      +  S G   +Y NF  ++ +      C  V  L S  W  + C  ++  IC+    V   + +I  +G +         +   +   ++A AQ  C+    ++  +    +   +    ++ +SD    +W+  +   ++G++  SDG  + + ++  G+P   G+ + C +     +  W D  CH  L  IC RS    E R     P+TL                       DR+ + EAQ  C+ Q  ++V   N  E A +      +T DL W+  + ++ + +W+  E+  L +  + PGEP+G      G         L        G W+D  C  +    IC K +                 E+   N    +  +   + +AL  C +R   LA V      A L   A+ + A   WI         ++   +   L Y +W   EP    G  C ++
Sbjct:  695 SWIEALGVCRELGAQLLSLASYEEEHFVANMLNKIFGESEPENHEQHWFWIGLNRRDPREGHSWRWSDGLGFSYHNFARSQHDDDNIRGCA-VLDLASLQWVAMQCQTQLDWICKIPRGVDVREPDIGRQGRLEWVRFQEAEYKFFEHHSSWAQAQRICTWFQAELTSVHSQAELDFLGQNMQKLSSDQEQHWWIGLHTSESDGRFRWSDGSVINFVSWAPGKPRPIGKDKKCVYMTARQED-WGDQRCHTALPYICKRSNSSGETRPHDLPPSTLGGCPSGWNQFLNKCFRIQGQDPQDRVKWSEAQFSCEQQEAQLVTIANPLEQAYITASLPNVTFDL-WIGLHGSQRDFQWI--EQEPLLYTNWAPGEPSGPSPAPSGTKPTSCAVILHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLSPSPAAALPAPGTELSYLNRTFRLLQKPLRWKDALLLCESRNASLAHVPDPYTQAFLTQAARGLQAP-LWIGLASEEGSRRYSWLSEEPLNYASWQDGEPQHTGG--CAYV 1222          

HSP 2 Score: 27.7202 bits (60), Expect = 4.704e-16
Identity = 39/173 (22.54%), Postives = 70/173 (40.46%), Query Frame = 1
Query: 1510 SYYLEEGTWRDIACTNKYL-AICTLN--------------PNAGAKTADYHF--------TKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSY--WLDGNDNAEEGKWVDTNNSTLLYKNFAAE--APNGGRDKNC--LQSFATGLWVDSKCDDFN-SVVC 1938
            +Y   +GTWR  +C  K   A+C ++              P   A ++   F        T++ +  + A   C+  G  V+ + +   N  + +  +  +  S   WL  N N + G  V  +N+ + Y N+      P+     +C  +QS ++GLW    C +    VVC
Sbjct: 1220 AYVDVDGTWRTTSCDTKLQGAVCGVSRGPPPPRISYRGSCPQGLADSSWIPFREHCYSFHTELLLGHKEALQRCQRAGGTVLSILDEMENVFVWEHLQTAETQSRGAWLGMNFNPKGGMLVWQDNTAVNYSNWGPPGLGPSMLSHNSCYWIQS-SSGLWRPGACTNVTMGVVC 1391          

HSP 3 Score: 84.3445 bits (207), Expect = 1.915e-15
Identity = 111/569 (19.51%), Postives = 216/569 (37.96%), Query Frame = 3
Query:   42 FILITLDSCRSDIDVNTL------FVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVSTDQLE-----------------IEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGR--VENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGA--------------DPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEG--KWVDSEENDLKHKGF-HPGEPNGGV-------------NENCLN---GYLSLDGLWNDF------PCPYKNLFAICAKDSLK-IKDNENFEIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVAD---------YYWIDGN--DHTEEGKWVDSNANVLPYKNWAATEPNGNRGENCIFILL 1520
            F  I  + C +  D + L      F  ++ +++ EA  SC+ +G  L+ +    +   +NG      + + WI  ND    G +  S  + L Y N+ +++P+    ENC  +    SG W +  C   +  +C+K    + + ++                  +G+ + +   K ++ +++  C      ++ I    +   +    ++   +L W+  ND+  +  +  SDG  + + ++   EP   R  +E+C   +   +  WND PC+ +L  IC ++   + G                P+      D++ + +A+  C   G ++V   N  E A V         + +W    D    G  +W+  +E    H     PG   GG               +NC +    Y+    L          P P  +L   C +  +   K    +++     +   E+ ++ EAL  CR  G QL  + S  +   +A    K+  +         ++WI  N  D  E   W  S+     Y N+A ++ + +    C  + L
Sbjct:  226 FCPIKSNDCETFWDKDQLTDSCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGY-SSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKKKPNATAEPIQPDRWANVKVECDPSWQPFQGHCYRLQAEKRSWQESKRACLRGGGDLLSIHSMTELEFITKQIKQEVEEL-WIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVTIW-GPEGRWNDSPCNQSLPSICKKAGRLSQGTAEEDHGCRKGWTWHSPSCYWLGEDQVIYSDARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFRWLSGDEVMYTHWNRDQPGYRRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWVSDPKLRHCYKVFSSERL--QEKKSWIEALGVCRELGAQLLSLASYEEEHFVANMLNKIFGESEPENHEQHWFWIGLNRRDPREGHSWRWSDGLGFSYHNFARSQHDDDNIRGCAVLDL 789          
BLAST of Lectin 2b vs. UniProt/SwissProt
Match: sp|Q64449|MRC2_MOUSE (C-type mannose receptor 2 OS=Mus musculus OX=10090 GN=Mrc2 PE=1 SV=3)

HSP 1 Score: 83.9593 bits (206), Expect = 3.122e-15
Identity = 111/569 (19.51%), Postives = 216/569 (37.96%), Query Frame = 3
Query:   42 FILITLDSCRSDIDVNTL------FVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVSTDQLE-----------------IEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGR--VENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGA--------------DPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEG--KWVDSEENDLKHKGF-HPGEPNGGV-------------NENCLN---GYLSLDGLWNDF------PCPYKNLFAICAKDSLK-IKDNENFEIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVAD---------YYWIDGN--DHTEEGKWVDSNANVLPYKNWAATEPNGNRGENCIFILL 1520
            F  I  + C +  D + L      F  ++ +++ EA  SC+ +G  L+ +    +   +NG      + + WI  ND    G +  S  + L Y N+ +++P+    ENC  +    SG W +  C   +  +C+K    + + ++                  +G+ + +   K ++ +++  C      ++ I    +   +    ++   +L W+  ND+  +  +  SDG  + + ++   EP   R  +E+C   +   +  WND PC+ +L  IC ++   + GA               P+      D++ + +A+  C   G ++V   N  E A V         + +W    D    G  +W+  +E    H     PG   GG               +NC +    Y+    L          P P  +L   C +  +   K    +++     +   E+ ++ +AL  CR  G QL  + S  +   +A    K+  +         ++WI  N  D  E   W  S+     Y N+A +  + +    C  + L
Sbjct:  226 FCPIKSNDCETFWDKDQLTDSCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGY-SSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKKKPNATVEPIQPDRWTNVKVECDPSWQPFQGHCYRLQAEKRSWQESKRACLRGGGDLLSIHSMAELEFITKQIKQEVEEL-WIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVTIW-GPEGRWNDSPCNQSLPSICKKAGRLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQVIYSDARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFRWLSGDEVIYTHWNRDQPGYRRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWVSDPKLRHCYKVFSSERL--QEKKSWIQALGVCRELGAQLLSLASYEEEHFVAHMLNKIFGESEPESHEQHWFWIGLNRRDPREGHSWRWSDGLGFSYHNFARSRHDDDDIRGCAVLDL 789          

HSP 2 Score: 73.559 bits (179), Expect = 1.806e-14
Identity = 114/536 (21.27%), Postives = 201/536 (37.50%), Query Frame = 3
Query:  117 TYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADS---------YWIDGN--DETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVSTDQLEI--EGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFA---------RETNSDL---YWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGG-GRVENCAHGYLNYDSLWNDLPCHFNLWVICYRS----EIRAPGADPNTLIA-------------------SYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNG------GVNENCLNGYL-----SLDGLWNDFPCPYKNLFAICAKDS--------LKIKDNENFEIDMDN--MMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENCIFI 1514
            ++ +AL  C+  G +L+ + S E+   V    NK+  +S         +WI  N  D      +  S G   +Y NF  +  +      C  V  L S  W  + C  ++  IC+    V   + +I  +G +  V   +  +   + + S    + I      D   VHS A         ++ +SD    +W+  + + ++G++  +DG  + + ++  G+P   G+ + C +     +  W D  CH  L  IC RS    E +     P+ L                       DR+ + EAQ  C+ Q  ++V   N  E A +      +T DL W+  + ++ + +W+  E+  L +  + PGEP+G      G         L        G W+D  C  +    IC K +                 E+   N    +  +   + +AL  C +R   LA V      A L   A+ +     WI         ++   +   L Y +W   EP  + G  C ++
Sbjct:  695 SWIQALGVCRELGAQLLSLASYEEEHFVAHMLNKIFGESEPESHEQHWFWIGLNRRDPREGHSWRWSDGLGFSYHNFARSRHDDDDIRGCA-VLDLASLQWVPMQCQTQLDWICKIPRGVDVREPDIGRQGRLEWVRFQEAEYKFFEHHSSWAQAQRICTWFQADLTSVHSQAELDFLGQNLQKLSSDQEQHWWIGLHTLESDGRFRWTDGSIINFISWAPGKPRPIGKDKKCVYMTARQED-WGDQRCHTALPYICKRSNSSGETQPQDLPPSALGGCPSGWNQFLNKCFRIQGQDPQDRVKWSEAQFSCEQQEAQLVTIANPLEQAFITASLPNVTFDL-WIGLHASQRDFQWI--EQEPLLYTNWAPGEPSGPSPAPSGTKPTSCAVILHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLSPSPAATPPAPGAELSYLNHTFRLLQKPLRWKDALLLCESRNASLAHVPDPYTQAFLTQAARGLQTP-LWIGLASEEGSRRYSWLSEEPLNYVSWQDEEPQHSGG--CAYV 1222          

HSP 3 Score: 28.4906 bits (62), Expect = 1.806e-14
Identity = 37/173 (21.39%), Postives = 68/173 (39.31%), Query Frame = 1
Query: 1510 SYYLEEGTWRDIACTNKYL-AICTLNPNAGAKTADYHFT----------------------KVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSY--WLDGNDNAEEGKWVDTNNSTLLYKNFAAE--APNGGRDKNC--LQSFATGLWVDSKCDDFN-SVVC 1938
            +Y   +GTWR  +C  K   A+C ++     +  +Y  +                      +V +  + A   C+  G  V+ + +   N  + +  +  +  S   WL  N N + G  V  +N+ + Y N+      P+     +C  +QS ++GLW    C +    VVC
Sbjct: 1220 AYVDVDGTWRTTSCDTKLQGAVCGVSRGPPPRRINYRGSCPQGLADSSWIPFREHCYSFHMEVLLGHKEALQRCQKAGGTVLSILDEMENVFVWEHLQTAEAQSRGAWLGMNFNPKGGTLVWQDNTAVNYSNWGPPGLGPSMLSHNSCYWIQS-SSGLWRPGACTNITMGVVC 1391          
BLAST of Lectin 2b vs. UniProt/SwissProt
Match: sp|Q9UBG0|MRC2_HUMAN (C-type mannose receptor 2 OS=Homo sapiens OX=9606 GN=MRC2 PE=1 SV=2)

HSP 1 Score: 82.0333 bits (201), Expect = 1.253e-14
Identity = 82/395 (20.76%), Postives = 155/395 (39.24%), Query Frame = 3
Query:   42 FILITLDSCRSDIDVNTL------FVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQKDS-----------------EVSTDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGR--VENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGA--------------DPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGK--WVDSEENDLKHKGF-HPGEPNGGV 1100
            F  I  + C +  D + L      F  ++ +++ EA  SC+ +G  L+ +    +   +NG      + + WI  ND    G +  S  + L Y N+ +++P+    ENC  +    SG W +  C   +  +C+K                   E        +G+ + +   K ++ ++++ C      ++ I    +   +    ++   +L W+  ND+  +  +  SDG  + + ++   EP   R  +E+C   +   +  WND PC+ +L  IC ++   + GA               P+      D++T+ EA+  C   G ++V   N  E A V         + +W    D    G   W+  +E    H     PG   GG 
Sbjct:  227 FCPIKSNDCETFWDKDQLTDSCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGY-SSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPSEENCGVIRTESSGGWQNRDCSIALPYVCKKKPNATAEPTPPDRWANVKVECEPSWQPFQGHCYRLQAEKRSWQESKKACLRGGGDLVSIHSMAELEFITKQIKQEVEEL-WIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVTIW-GPEGRWNDSPCNQSLPSICKKAGQLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQVTYSEARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFFWLSGDEVMYTHWNRDQPGYSRGGC 618          

HSP 2 Score: 78.9518 bits (193), Expect = 9.388e-14
Identity = 84/404 (20.79%), Postives = 162/404 (40.10%), Query Frame = 3
Query:  414 WAIC---QKDSEVSTDQLEIEGNIFVVS-KGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYR-----SEIRAPGADPNTLIA---------------SYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEG--KWVDSEENDLKHKGFHPGEPNGGVN--ENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFEIDMDN---------MMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENCIFI 1514
            W  C     D E   D+ ++  + +  + +  +++ +A   C  +   ++ I    +   ++      +S L W+  ND+ T G W  SD   L Y N+   +P     ENC          W +  C   L  +C +     +E   P    N  +                  ++ ++QE++  C   G  +V  ++ AE   +    ++   +L W+  ND KL+   +W D       H  +HP EPN   +  E+C+  +   +G WND PC  ++L +IC K     +     +                +  ++ TY+EA + C   G+QL  + ++ + A +++       +Y+W    D    G +   + + + Y +W   +P  +RG  C+ +
Sbjct:  225 WGFCPIKSNDCETFWDKDQLTDSCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYSSTL-WIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPSEENCGVIRTESSGGWQNRDCSIALPYVCKKKPNATAEPTPPDRWANVKVECEPSWQPFQGHCYRLQAEKRSWQESKKACLRGGGDLVSIHSMAELEFITKQIKQEVEEL-WIGLNDLKLQMNFEWSDGSLVSFTH--WHPFEPNNFRDSLEDCVTIW-GPEGRWNDSPC-NQSLPSICKKAGQLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQVTYSEARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFFWLSGDEVMYTHWNRDQPGYSRG-GCVAL 621          

HSP 3 Score: 69.707 bits (169), Expect = 7.236e-11
Identity = 112/538 (20.82%), Postives = 200/538 (37.17%), Query Frame = 3
Query:  117 TYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADS---------YWIDGNDETAEG--IFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQ-----------KDSEVSTDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRI-GHALDNAIVHSFAR--ETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGG-GRVENCAHGYLNYDSLWNDLPCHFNLWVICYRS----EIRAP-------GADPNTLIA------------SYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLS-----------LDGLWNDFPCPYKNLFAICAKDS--------LKIKDNENFEIDMDN--MMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWID--GNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENCIFI 1514
            ++ +A  +C+  G +L+ + S E+   V    NK+  +S         +WI  N     G   +  S G   +Y NF  +  +      C  V  L S  W  + C  ++  IC+              +   + L  +   +   +   T+A AQ  C+    ++  +   A  + + H+  +        +W+  +   ++G++  +DG  + + ++  G+P   G+ + C +   + +  W D  C   L  IC RS    E + P       G  P+  I                R+ + EAQ  C+ Q  ++V   N  E A +      +T DL W+  + ++ + +WV  E+  L +  + PGEP+G       N   S             G W+D  C  +    IC K +          +      E+   N    +  +   +++AL  C +R   LA V      A L   A+ +     WI   G + +    WV      L Y  W   EP    G  C ++
Sbjct:  696 SWVQAQGACQELGAQLLSLASYEEEHFVANMLNKIFGESEPEIHEQHWFWIGLNRRDPRGGQSWRWSDGVGFSYHNFDRSRHDDDDIRGCA-VLDLASLQWVAMQCDTQLDWICKIPRGTDVREPDDSPQGRREWLRFQEAEYKFFEHHSTWAQAQRICTWFQAELTSVHSQAELDFLSHNLQKFSRAQEQHWWIGLHTSESDGRFRWTDGSIINFISWAPGKPRPVGKDKKCVYMTASRED-WGDQRCLTALPYICKRSNVTKETQPPDLPTTALGGCPSDWIQFLNKCFQVQGQEPQSRVKWSEAQFSCEQQEAQLVTITNPLEQAFITASLPNVTFDL-WIGLHASQRDFQWV--EQEPLMYANWAPGEPSGPSPAPSGNKPTSCAVVLHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLSPSPAALPPAPGTELSYLNGTFRLLQKPLRWHDALLLCESRNASLAYVPDPYTQAFLTQAARGLRTP-LWIGLAGEEGSRRYSWVSEEP--LNYVGWQDGEPQQPGG--CTYV 1223          
BLAST of Lectin 2b vs. TrEMBL
Match: Q8WSX0 (Lectin 2b OS=Girardia tigrina OX=6162 GN=lec2b PE=4 SV=1)

HSP 1 Score: 728.398 bits (1879), Expect = 0.000e+0
Identity = 345/520 (66.35%), Postives = 411/520 (79.04%), Query Frame = 3
Query:   15 MNLFTVLTIFILITLDSCRSDIDVNTLFVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQKDSE--VSTDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGADPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFEIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENCIFILLRRRDMEGYCMHQ*IPC 1568
            MN F ++TIF+ I + +CRSDID NTLFVTK LVTYNEA+QSCK+RGM LVR+ SAEDN +VNG+ANKVLAD YWIDGND   EG +V+++GN L YKNF  N PNG ++ENC  VYR+ +GLW D  C+ R+WAICQ+D       +Q+EIEG+  +VS+GKMTFADAQEYCS R +KM++IGHALDNA+VHSFARET SD YW+D NDIVTEGKWVD DGK+L++KNF  GEP GGR ENC HGYL  D LWND PC + LW ICYR + R   AD NT+IAS++R TF EAQDYCK  GLKM +AN+AAEN L+HGF RR   DLYWLDGNDAK+EGKWVDS++ +LKHKGFHPGEPNGG+NENCLNGYL LDGLWNDFPC YKNLFA+C KD L +   E++E+D DN+M+S ERYTYNEALQ+CRTRGTQL R+ ++    +LAAFAKK+VADYYWIDGNDHT EG W+D+N  +L YKNWA  EPNG R ENCI   +   ++EG      IPC
Sbjct:    1 MNNFIIVTIFLAI-VGNCRSDIDANTLFVTKVLVTYNEAIQSCKARGMVLVRITSAEDNTIVNGYANKVLADKYWIDGNDHANEGTWVDARGNQLPYKNFAPNGPNGNQNENCALVYRV-NGLWYDYNCVYRLWAICQRDPSQLYLGNQIEIEGSGLIVSRGKMTFADAQEYCSNRGMKMVKIGHALDNAVVHSFARETYSDYYWIDANDIVTEGKWVDPDGKELVHKNFHPGEPNGGRGENCGHGYLTIDGLWNDFPCSYQLWAICYREDNRNTNADTNTIIASHERFTFPEAQDYCKGLGLKMAKANSAAENGLIHGFTRRAFLDLYWLDGNDAKVEGKWVDSDDVELKHKGFHPGEPNGGINENCLNGYLLLDGLWNDFPCTYKNLFALCYKDGLTMPYMEDYEVDADNLMISTERYTYNEALQYCRTRGTQLVRIKNEAAKGLLAAFAKKIVADYYWIDGNDHTTEGTWMDANGRLLTYKNWANNEPNGGRAENCI---ISHNNLEGAWWD--IPC 513          

HSP 2 Score: 377.867 bits (969), Expect = 1.688e-118
Identity = 190/486 (39.09%), Postives = 289/486 (59.47%), Query Frame = 3
Query:   75 DIDVNTLFVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVSTDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHF-NLWVICYRSEIRAP-----GADPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFEIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENCIFI 1514
            +I+ + L V++  +T+ +A + C +RGM++V++  A DNAVV+ FA +  +D YWID ND   EG +V+  G  L +KNF   EPNGGR ENC + Y    GLWND  C  ++WAIC ++   +T+    + N  + S  + TF +AQ+YC    LKM +   A +N ++H F R    DLYW+DGND   EGKWVDSD  +L +K F  GEP GG  ENC +GYL  D LWND PC + NL+ +CY+  +  P       D + L+ S +R T+ EA  YC+ +G ++VR  N A   L+  FA++I +D YW+DGND   EG W+D+    L +K +   EPNGG  ENC+  + +L+G W D PC  K  FAIC+++    +D+   ++       +  + T++ A+ +C++ G ++ R+     + ++   + K     YWIDGND+ +E +WVD++   L YKN+ + EP+G R +NC+ +
Sbjct:  149 EIEGSGLIVSRGKMTFADAQEYCSNRGMKMVKIGHALDNAVVHSFARETYSDYYWIDANDIVTEGKWVDPDGKELVHKNFHPGEPNGGRGENCGHGYLTIDGLWNDFPCSYQLWAICYREDNRNTNA---DTNTIIASHERFTFPEAQDYCKGLGLKMAKANSAAENGLIHGFTRRAFLDLYWLDGNDAKVEGKWVDSDDVELKHKGFHPGEPNGGINENCLNGYLLLDGLWNDFPCTYKNLFALCYKDGLTMPYMEDYEVDADNLMISTERYTYNEALQYCRTRGTQLVRIKNEAAKGLLAAFAKKIVADYYWIDGNDHTTEGTWMDANGRLLTYKNWANNEPNGGRAENCIISHNNLEGAWWDIPCTNK-YFAICSRNPY--EDDTALDV-----HYTKTKMTFDGAMAYCKSIGLKMIRIKDPETDRLINGGSLKHKLSTYWIDGNDNDQEDRWVDADKTELSYKNFTSGEPSGGREKNCLTV 623          

HSP 3 Score: 265.774 bits (678), Expect = 8.719e-76
Identity = 133/357 (37.25%), Postives = 209/357 (58.54%), Query Frame = 3
Query:   60 DSCRSDIDVNTLFVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLAR-IWAICQKD--SEVSTDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGADPNTLIASY--DRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCL 1115
            D+  ++ D NT+  +    T+ EA   CK  G+++ + NSA +N +++GF  +   D YW+DGND   EG +V+S    L +K F   EPNGG +ENC+N Y L  GLWND  C  + ++A+C KD  +    +  E++ +  ++S  + T+ +A +YC  R  +++RI +     ++ +FA++  +D YW+DGND  TEG W+D++G+ L YKN+   EP GGR ENC   + N +  W D+PC    + IC R+    P  D   L   Y   ++TF  A  YCK+ GLKM+R  +   + L++G + +     YW+DGND   E +WVD+++ +L +K F  GEP+GG  +NCL
Sbjct:  269 DNRNTNADTNTIIASHERFTFPEAQDYCKGLGLKMAKANSAAENGLIHGFTRRAFLDLYWLDGNDAKVEGKWVDSDDVELKHKGFHPGEPNGGINENCLNGYLLLDGLWNDFPCTYKNLFALCYKDGLTMPYMEDYEVDADNLMISTERYTYNEALQYCRTRGTQLVRIKNEAAKGLLAAFAKKIVADYYWIDGNDHTTEGTWMDANGRLLTYKNWANNEPNGGRAENCIISHNNLEGAWWDIPCTNKYFAICSRN----PYEDDTALDVHYTKTKMTFDGAMAYCKSIGLKMIRIKDPETDRLINGGSLKHKLSTYWIDGNDNDQEDRWVDADKTELSYKNFTSGEPSGGREKNCL 621          

HSP 4 Score: 193.741 bits (491), Expect = 2.270e-49
Identity = 101/246 (41.06%), Postives = 143/246 (58.13%), Query Frame = 3
Query:   75 DIDVNTLFVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVSTDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICY 812
            ++D + L ++    TYNEALQ C++RG +LVR+ +     ++  FA K++AD YWIDGND T EG ++++ G LLTYKN+  NEPNGGR+ENCI  +    G W DI C  + +AIC ++       L++       +K KMTF  A  YC +  LKMIRI     + +++  + +     YW+DGND   E +WVD+D  +L YKNF  GEP GGR +NC    +N    W    C     V+CY
Sbjct:  405 EVDADNLMISTERYTYNEALQYCRTRGTQLVRIKNEAAKGLLAAFAKKIVADYYWIDGNDHTTEGTWMDANGRLLTYKNWANNEPNGGRAENCIISHNNLEGAWWDIPCTNKYFAICSRNPYEDDTALDVH-----YTKTKMTFDGAMAYCKSIGLKMIRIKDPETDRLINGGSLKHKLSTYWIDGNDNDQEDRWVDADKTELSYKNFTSGEPSGGREKNCLT--VNKTGQWFAEGCTRLNRVVCY 643          

HSP 5 Score: 169.474 bits (428), Expect = 6.177e-41
Identity = 77/161 (47.83%), Postives = 104/161 (64.60%), Query Frame = 1
Query: 1486 GTEEKIVFSYYLEEGTWRDIACTNKYLAICTLNPNAGAKTADYHFTKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSFATGLWVDSKCDDFNSVVCYGSIKRVSKF 1968
            G  E  + S+   EG W DI CTNKY AIC+ NP       D H+TK KMTF+ A  YCKS+GLK++R+++  ++RL+   +   KL +YW+DGNDN +E +WVD + + L YKNF +  P+GGR+KNCL    TG W    C   N VVCYG++KR+ KF
Sbjct:  492 GRAENCIISHNNLEGAWWDIPCTNKYFAICSRNPYEDDTALDVHYTKTKMTFDGAMAYCKSIGLKMIRIKDPETDRLINGGSLKHKLSTYWIDGNDNDQEDRWVDADKTELSYKNFTSGEPSGGREKNCLTVNKTGQWFAEGCTRLNRVVCYGNLKRILKF 652          

HSP 6 Score: 98.2117 bits (243), Expect = 1.501e-17
Identity = 58/161 (36.02%), Postives = 81/161 (50.31%), Query Frame = 1
Query: 1486 GTEEKIVFSYYLEEGTWRDIACTNKYL-AICTLNPNAGAKTADYH-------FTKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSFAT--GLWVDSKCDDFNSVVC 1938
            G  E  +  Y L +G W D  CT K L A+C  +        DY         +  + T+  A  YC++ G ++VR++N  +  LLA  AK +  D YW+DGND+  EG W+D N   L YKN+A   PNGGR +NC+ S     G W D  C +    +C
Sbjct:  361 GINENCLNGYLLLDGLWNDFPCTYKNLFALCYKDGLTMPYMEDYEVDADNLMISTERYTYNEALQYCRTRGTQLVRIKNEAAKGLLAAFAKKIVADYYWIDGNDHTTEGTWMDANGRLLTYKNWANNEPNGGRAENCIISHNNLEGAWWDIPCTNKYFAIC 521          

HSP 7 Score: 96.2857 bits (238), Expect = 7.855e-17
Identity = 55/147 (37.41%), Postives = 73/147 (49.66%), Query Frame = 1
Query: 1486 GTEEKIVFSYYLEEGTWRDIACTNKYLAICTL--NPNAGAKTADYHFTKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSF--ATGLWVDSKC 1914
            G  E     Y   +G W D  C+ +  AIC    N N  A T     +  + TF  A  YCK +GLK+ +  +   N L+    +   LD YWLDGND   EGKWVD+++  L +K F    PNGG ++NCL  +    GLW D  C
Sbjct:  236 GRGENCGHGYLTIDGLWNDFPCSYQLWAICYREDNRNTNADTNTIIASHERFTFPEAQDYCKGLGLKMAKANSAAENGLIHGFTRRAFLDLYWLDGNDAKVEGKWVDSDDVELKHKGFHPGEPNGGINENCLNGYLLLDGLWNDFPC 382          

HSP 8 Score: 92.8189 bits (229), Expect = 9.576e-16
Identity = 53/156 (33.97%), Postives = 76/156 (48.72%), Query Frame = 1
Query: 1516 YLEEGTWRDIACTNKYLAICTLNPNA-------GAKTADYHFTKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSFAT--GLWVDSKCDDFNSVVCYGSIKR 1956
            Y   G W D  C  +  AIC  +P+          + +    ++ KMTF  A  YC + G+K+V++ +   N ++   A+    D YW+D ND   EGKWVD +   L++KNF    PNGGR +NC   + T  GLW D  C      +CY    R
Sbjct:  116 YRVNGLWYDYNCVYRLWAICQRDPSQLYLGNQIEIEGSGLIVSRGKMTFADAQEYCSNRGMKMVKIGHALDNAVVHSFARETYSDYYWIDANDIVTEGKWVDPDGKELVHKNFHPGEPNGGRGENCGHGYLTIDGLWNDFPCSYQLWAICYREDNR 271          

HSP 9 Score: 84.3445 bits (207), Expect = 3.591e-13
Identity = 41/99 (41.41%), Postives = 58/99 (58.59%), Query Frame = 1
Query: 1621 TKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSF-ATGLWVDSKC 1914
            TKV +T+  A   CK+ G+ +VR+ +   N ++   A  +  D YW+DGND+A EG WVD   + L YKNFA   PNG +++NC   +   GLW D  C
Sbjct:   29 TKVLVTYNEAIQSCKARGMVLVRITSAEDNTIVNGYANKVLADKYWIDGNDHANEGTWVDARGNQLPYKNFAPNGPNGNQNENCALVYRVNGLWYDYNC 127          
BLAST of Lectin 2b vs. TrEMBL
Match: Q8WSW9 (Lectin 2c OS=Girardia tigrina OX=6162 GN=lec2c PE=4 SV=1)

HSP 1 Score: 726.472 bits (1874), Expect = 0.000e+0
Identity = 340/520 (65.38%), Postives = 417/520 (80.19%), Query Frame = 3
Query:   15 MNLFTVLTIFILITLDSCRSDIDVNTLFVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQKDSE--VSTDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGADPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFEIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENCIFILLRRRDMEGYCMHQ*IPC 1568
            MN F ++TIF+ I + +CRSDID NTLFVTK LVTYNEA+QSCK+RGM LVRV SAEDN +VNG+ANKVLAD+YWIDGND T EG +V+++GN L YKNF  +EPNG ++ENC+ VYR+ + +WND+ C+ARIWAICQ+D       +Q+EIEG+  +VS+GKMTFADAQEYCS R +KM++IGHALDNA+VHSFARET SD YW+D NDIV EGKWVD+DGK+L++KNF  GEP GGR ENC HGYL  D LWND PC + LW ICY+ + R   ADPNT+IAS++RLTF EAQDYCK  GLKM +AN+AAE+ ++HGF RR+  DLYWLDGNDAK+EGKWVDS++ +LKHKGF+PGEPNGG NENC+NGYL  D LWND PC YKNLFA+C KD L +   +++E+++DN+M+S ERYTYNEALQ+CRTRGTQL R+ ++     LAAFAKK+VADYYWIDGNDHT EG WVD+N  ++ YKNWA  EPNG RGENCI   +   ++EG      IPC
Sbjct:    1 MNNFILVTIFLTI-VGNCRSDIDANTLFVTKVLVTYNEAIQSCKARGMVLVRVTSAEDNTIVNGYANKVLADTYWIDGNDHTNEGTWVDARGNQLPYKNFAPHEPNGNKNENCLMVYRV-NRMWNDLNCVARIWAICQRDPSQLYLGNQIEIEGSGLIVSRGKMTFADAQEYCSNRGMKMVKIGHALDNAVVHSFARETYSDYYWIDANDIVNEGKWVDADGKELVHKNFHPGEPKGGRGENCGHGYLTVDGLWNDFPCSYQLWAICYKEDNRNTNADPNTIIASHERLTFYEAQDYCKGLGLKMAKANSAAESGMIHGFTRRVYLDLYWLDGNDAKVEGKWVDSDDVELKHKGFYPGEPNGGRNENCINGYLLHDALWNDLPCTYKNLFALCYKDGLTMPYMDDYEVNVDNLMISTERYTYNEALQYCRTRGTQLVRIKNEASKGFLAAFAKKIVADYYWIDGNDHTSEGTWVDANGRLMTYKNWANNEPNGGRGENCI---ISHNNLEGAWWD--IPC 513          

HSP 2 Score: 380.948 bits (977), Expect = 1.168e-119
Identity = 191/487 (39.22%), Postives = 294/487 (60.37%), Query Frame = 3
Query:   75 DIDVNTLFVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVSTDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHF-NLWVICYRSEIRAPGADP-----NTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFEIDMD-NMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENCIFI 1514
            +I+ + L V++  +T+ +A + C +RGM++V++  A DNAVV+ FA +  +D YWID ND   EG +V++ G  L +KNF   EP GGR ENC + Y    GLWND  C  ++WAIC K+   +T+    + N  + S  ++TF +AQ+YC    LKM +   A ++ ++H F R    DLYW+DGND   EGKWVDSD  +L +K F  GEP GGR ENC +GYL +D+LWNDLPC + NL+ +CY+  +  P  D      + L+ S +R T+ EA  YC+ +G ++VR  N A    +  FA++I +D YW+DGND   EG WVD+    + +K +   EPNGG  ENC+  + +L+G W D PC  K  FA+C+++         +E D   ++  +  + T++ A+ +C++ G ++ R+     + ++   + K     YWIDGND+ +E +WVD++   L YKN+A+ EP+G R +NC+ +
Sbjct:  149 EIEGSGLIVSRGKMTFADAQEYCSNRGMKMVKIGHALDNAVVHSFARETYSDYYWIDANDIVNEGKWVDADGKELVHKNFHPGEPKGGRGENCGHGYLTVDGLWNDFPCSYQLWAICYKEDNRNTNA---DPNTIIASHERLTFYEAQDYCKGLGLKMAKANSAAESGMIHGFTRRVYLDLYWLDGNDAKVEGKWVDSDDVELKHKGFYPGEPNGGRNENCINGYLLHDALWNDLPCTYKNLFALCYKDGLTMPYMDDYEVNVDNLMISTERYTYNEALQYCRTRGTQLVRIKNEASKGFLAAFAKKIVADYYWIDGNDHTSEGTWVDANGRLMTYKNWANNEPNGGRGENCIISHNNLEGAWWDIPCSNK-YFAVCSRNP--------YEGDSSLDVHYTKAKMTFDGAMAYCKSIGLKMIRIKDPETDRLINGGSLKHKVCSYWIDGNDNEQEDRWVDADKTELSYKNFASGEPSGGREKNCLIV 623          

HSP 3 Score: 261.922 bits (668), Expect = 2.475e-74
Identity = 132/357 (36.97%), Postives = 212/357 (59.38%), Query Frame = 3
Query:   60 DSCRSDIDVNTLFVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLAR-IWAICQKD--SEVSTDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGADPNTLIASYD--RLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCL 1115
            D+  ++ D NT+  +   +T+ EA   CK  G+++ + NSA ++ +++GF  +V  D YW+DGND   EG +V+S    L +K F   EPNGGR+ENCIN Y L   LWND+ C  + ++A+C KD  +    D  E+  +  ++S  + T+ +A +YC  R  +++RI +      + +FA++  +D YW+DGND  +EG WVD++G+ + YKN+   EP GGR ENC   + N +  W D+PC    + +C R+    P    ++L   Y   ++TF  A  YCK+ GLKM+R  +   + L++G + +     YW+DGND + E +WVD+++ +L +K F  GEP+GG  +NCL
Sbjct:  269 DNRNTNADPNTIIASHERLTFYEAQDYCKGLGLKMAKANSAAESGMIHGFTRRVYLDLYWLDGNDAKVEGKWVDSDDVELKHKGFYPGEPNGGRNENCINGYLLHDALWNDLPCTYKNLFALCYKDGLTMPYMDDYEVNVDNLMISTERYTYNEALQYCRTRGTQLVRIKNEASKGFLAAFAKKIVADYYWIDGNDHTSEGTWVDANGRLMTYKNWANNEPNGGRGENCIISHNNLEGAWWDIPCSNKYFAVCSRN----PYEGDSSLDVHYTKAKMTFDGAMAYCKSIGLKMIRIKDPETDRLINGGSLKHKVCSYWIDGNDNEQEDRWVDADKTELSYKNFASGEPSGGREKNCL 621          

HSP 4 Score: 194.126 bits (492), Expect = 1.624e-49
Identity = 100/246 (40.65%), Postives = 143/246 (58.13%), Query Frame = 3
Query:   75 DIDVNTLFVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVSTDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICY 812
            +++V+ L ++    TYNEALQ C++RG +LVR+ +      +  FA K++AD YWIDGND T+EG +V++ G L+TYKN+  NEPNGGR ENCI  +    G W DI C  + +A+C ++       L++       +K KMTF  A  YC +  LKMIRI     + +++  + +     YW+DGND   E +WVD+D  +L YKNF  GEP GGR +NC    +N    W    C     V+CY
Sbjct:  405 EVNVDNLMISTERYTYNEALQYCRTRGTQLVRIKNEASKGFLAAFAKKIVADYYWIDGNDHTSEGTWVDANGRLMTYKNWANNEPNGGRGENCIISHNNLEGAWWDIPCSNKYFAVCSRNPYEGDSSLDVH-----YTKAKMTFDGAMAYCKSIGLKMIRIKDPETDRLINGGSLKHKVCSYWIDGNDNEQEDRWVDADKTELSYKNFASGEPSGGREKNCL--IVNKTGQWFAESCRKLNRVVCY 643          

HSP 5 Score: 171.4 bits (433), Expect = 1.571e-41
Identity = 77/161 (47.83%), Postives = 107/161 (66.46%), Query Frame = 1
Query: 1486 GTEEKIVFSYYLEEGTWRDIACTNKYLAICTLNPNAGAKTADYHFTKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSFATGLWVDSKCDDFNSVVCYGSIKRVSKF 1968
            G  E  + S+   EG W DI C+NKY A+C+ NP  G  + D H+TK KMTF+ A  YCKS+GLK++R+++  ++RL+   +   K+ SYW+DGNDN +E +WVD + + L YKNFA+  P+GGR+KNCL    TG W    C   N VVCYG++KR+ KF
Sbjct:  492 GRGENCIISHNNLEGAWWDIPCSNKYFAVCSRNPYEGDSSLDVHYTKAKMTFDGAMAYCKSIGLKMIRIKDPETDRLINGGSLKHKVCSYWIDGNDNEQEDRWVDADKTELSYKNFASGEPSGGREKNCLIVNKTGQWFAESCRKLNRVVCYGNLKRILKF 652          

HSP 6 Score: 100.138 bits (248), Expect = 4.134e-18
Identity = 58/161 (36.02%), Postives = 80/161 (49.69%), Query Frame = 1
Query: 1486 GTEEKIVFSYYLEEGTWRDIACTNKYL-AICTLNPNAGAKTADYH-------FTKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSFAT--GLWVDSKCDDFNSVVC 1938
            G  E  +  Y L +  W D+ CT K L A+C  +        DY         +  + T+  A  YC++ G ++VR++N  S   LA  AK +  D YW+DGND+  EG WVD N   + YKN+A   PNGGR +NC+ S     G W D  C +    VC
Sbjct:  361 GRNENCINGYLLHDALWNDLPCTYKNLFALCYKDGLTMPYMDDYEVNVDNLMISTERYTYNEALQYCRTRGTQLVRIKNEASKGFLAAFAKKIVADYYWIDGNDHTSEGTWVDANGRLMTYKNWANNEPNGGRGENCIISHNNLEGAWWDIPCSNKYFAVC 521          

HSP 7 Score: 93.2041 bits (230), Expect = 6.992e-16
Identity = 51/149 (34.23%), Postives = 75/149 (50.34%), Query Frame = 1
Query: 1480 QTGTEEKIVFSYYLEEGTWRDIACTNKYLAIC--TLNPNAGAKTADYHFTKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSF--ATGLWVDSKC 1914
            + G  E     Y   +G W D  C+ +  AIC    N N  A       +  ++TF  A  YCK +GLK+ +  +   + ++    + + LD YWLDGND   EGKWVD+++  L +K F    PNGGR++NC+  +     LW D  C
Sbjct:  234 KGGRGENCGHGYLTVDGLWNDFPCSYQLWAICYKEDNRNTNADPNTIIASHERLTFYEAQDYCKGLGLKMAKANSAAESGMIHGFTRRVYLDLYWLDGNDAKVEGKWVDSDDVELKHKGFYPGEPNGGRNENCINGYLLHDALWNDLPC 382          

HSP 8 Score: 90.1225 bits (222), Expect = 5.346e-15
Identity = 50/150 (33.33%), Postives = 74/150 (49.33%), Query Frame = 1
Query: 1534 WRDIACTNKYLAICTLNPNA-------GAKTADYHFTKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSFAT--GLWVDSKCDDFNSVVCYGSIKR 1956
            W D+ C  +  AIC  +P+          + +    ++ KMTF  A  YC + G+K+V++ +   N ++   A+    D YW+D ND   EGKWVD +   L++KNF    P GGR +NC   + T  GLW D  C      +CY    R
Sbjct:  122 WNDLNCVARIWAICQRDPSQLYLGNQIEIEGSGLIVSRGKMTFADAQEYCSNRGMKMVKIGHALDNAVVHSFARETYSDYYWIDANDIVNEGKWVDADGKELVHKNFHPGEPKGGRGENCGHGYLTVDGLWNDFPCSYQLWAICYKEDNR 271          

HSP 9 Score: 82.4185 bits (202), Expect = 1.481e-12
Identity = 40/99 (40.40%), Postives = 58/99 (58.59%), Query Frame = 1
Query: 1621 TKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSFATG-LWVDSKC 1914
            TKV +T+  A   CK+ G+ +VRV +   N ++   A  +  D+YW+DGND+  EG WVD   + L YKNFA   PNG +++NCL  +    +W D  C
Sbjct:   29 TKVLVTYNEAIQSCKARGMVLVRVTSAEDNTIVNGYANKVLADTYWIDGNDHTNEGTWVDARGNQLPYKNFAPHEPNGNKNENCLMVYRVNRMWNDLNC 127          
BLAST of Lectin 2b vs. TrEMBL
Match: Q8WSX1 (Lectin 2a OS=Girardia tigrina OX=6162 GN=lec2a PE=4 SV=1)

HSP 1 Score: 718.383 bits (1853), Expect = 0.000e+0
Identity = 334/511 (65.36%), Postives = 411/511 (80.43%), Query Frame = 3
Query:   15 MNLFTVLTIFILITLDSCRSDIDVNTLFVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQKDSE--VSTDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGADPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFEIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENCIFILLRRRDMEG 1541
            MN F ++TIF+ I + +CRSDID NTLFVTK +VTYNEA+QSCK+RGM LVRV SAEDN +VNG+ANKVLAD+YW+DGND T EG +V+++GN L YKNF  +EPNG ++ENC+ VYR+ +G+WND+ C+ARIWAICQ+D       +Q+EIEG+  ++S+GKMTFADAQE+C+ R ++M++IGHALDNA+VHSFARET SD YW+D NDIV E KWVD+DGK+L++KNF  GEP GGR ENC HGYL  D LWN  PC++ LW ICYR      G DPNT+IAS++RLTF EAQDYCK  GLKM +A+NAAEN ++HGF+RRI  DLYWLDGNDAK EGKWVDS++ DLKHKGF+PGEPNG +NENC+NGYL  DGLWNDFPC YKNLFA+C KD L +   E+ E D++++M+S ERYTYNEALQ+CRTRG+QL RV S     +LAA+ KK+VADYYWIDGNDHT EG WVD+N  V+ YKNWA  EPNG RGENCI   +   ++EG
Sbjct:    1 MNNFILVTIFLTI-VGNCRSDIDANTLFVTKVVVTYNEAIQSCKARGMVLVRVTSAEDNTIVNGYANKVLADTYWLDGNDHTNEGTWVDARGNQLPYKNFAPHEPNGNKNENCLMVYRV-NGMWNDLNCVARIWAICQRDPSQLYLGNQIEIEGSGLIISRGKMTFADAQEFCTNRGMRMVKIGHALDNAVVHSFARETYSDYYWIDANDIVNEVKWVDADGKELVHKNFHPGEPNGGRGENCGHGYLTVDGLWNHFPCNYQLWAICYREGETNNGPDPNTIIASHERLTFSEAQDYCKGLGLKMAKADNAAENGMIHGFSRRIYLDLYWLDGNDAKEEGKWVDSDDVDLKHKGFYPGEPNGRINENCINGYLLHDGLWNDFPCTYKNLFALCYKDGLTMPYPEDIEYDVNSLMISTERYTYNEALQYCRTRGSQLVRVKSAASKDILAAYTKKIVADYYWIDGNDHTTEGTWVDANGQVMTYKNWANNEPNGGRGENCI---ISHNNLEG 506          

HSP 2 Score: 369.007 bits (946), Expect = 4.364e-115
Identity = 196/525 (37.33%), Postives = 299/525 (56.95%), Query Frame = 3
Query:   75 DIDVNTLFVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVSTDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHF-NLWVICYRSEIRAPGA-----DPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFEIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENCIFILLRRRDMEGYCMHQ*IPCYLYLKPKCRSQNS*LSFHKSK 1631
            +I+ + L +++  +T+ +A + C +RGMR+V++  A DNAVV+ FA +  +D YWID ND   E  +V++ G  L +KNF   EPNGGR ENC + Y    GLWN   C  ++WAIC ++ E +      + N  + S  ++TF++AQ+YC    LKM +  +A +N ++H F+R    DLYW+DGND   EGKWVDSD  DL +K F  GEP G   ENC +GYL +D LWND PC + NL+ +CY+  +  P       D N+L+ S +R T+ EA  YC+ +G ++VR  +AA   ++  + ++I +D YW+DGND   EG WVD+    + +K +   EPNGG  ENC+  + +L+G W D  C  K   A+C      I D    E  +D    S  + T++ A+++C + G  +  +    +N+++   AKK+    +WIDGND+ EEGKWV+     L +KN+ + EP+G R  +C+               Q +P   ++  KC S NS + +   K
Sbjct:  149 EIEGSGLIISRGKMTFADAQEFCTNRGMRMVKIGHALDNAVVHSFARETYSDYYWIDANDIVNEVKWVDADGKELVHKNFHPGEPNGGRGENCGHGYLTVDGLWNHFPCNYQLWAICYREGETNNGP---DPNTIIASHERLTFSEAQDYCKGLGLKMAKADNAAENGMIHGFSRRIYLDLYWLDGNDAKEEGKWVDSDDVDLKHKGFYPGEPNGRINENCINGYLLHDGLWNDFPCTYKNLFALCYKDGLTMPYPEDIEYDVNSLMISTERYTYNEALQYCRTRGSQLVRVKSAASKDILAAYTKKIVADYYWIDGNDHTTEGTWVDANGQVMTYKNWANNEPNGGRGENCIISHNNLEGAWWDIACTNK-YIAVC------ITDPSGGERTVD-YHFSRTKLTWDAAVKYCNSMGLNIIHIKDDNENSLILGSAKKLNLGTHWIDGNDNAEEGKWVNRKNGELSFKNFISGEPSGGRERSCL---------------QSLPSGYWIDSKCDSLNSVICYGSVK 647          

HSP 3 Score: 198.749 bits (504), Expect = 3.262e-51
Identity = 85/161 (52.80%), Postives = 118/161 (73.29%), Query Frame = 1
Query: 1486 GTEEKIVFSYYLEEGTWRDIACTNKYLAICTLNPNAGAKTADYHFTKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSFATGLWVDSKCDDFNSVVCYGSIKRVSKF 1968
            G  E  + S+   EG W DIACTNKY+A+C  +P+ G +T DYHF++ K+T++AA  YC S+GL ++ +++ N N L+  SAK L L ++W+DGNDNAEEGKWV+  N  L +KNF +  P+GGR+++CLQS  +G W+DSKCD  NSV+CYGS+KR SKF
Sbjct:  492 GRGENCIISHNNLEGAWWDIACTNKYIAVCITDPSGGERTVDYHFSRTKLTWDAAVKYCNSMGLNIIHIKDDNENSLILGSAKKLNLGTHWIDGNDNAEEGKWVNRKNGELSFKNFISGEPSGGRERSCLQSLPSGYWIDSKCDSLNSVICYGSVKRASKF 652          

HSP 4 Score: 189.504 bits (480), Expect = 5.765e-48
Identity = 101/252 (40.08%), Postives = 145/252 (57.54%), Query Frame = 3
Query:   75 DIDVNTLFVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVSTDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRA 830
            + DVN+L ++    TYNEALQ C++RG +LVRV SA    ++  +  K++AD YWIDGND T EG +V++ G ++TYKN+  NEPNGGR ENCI  +    G W DI C  +  A+C  D       ++     +  S+ K+T+  A +YC++  L +I I    +N+++   A++ N   +W+DGND   EGKWV+    +L +KNF  GEP GGR  +C     +    W D  C     VICY S  RA
Sbjct:  405 EYDVNSLMISTERYTYNEALQYCRTRGSQLVRVKSAASKDILAAYTKKIVADYYWIDGNDHTTEGTWVDANGQVMTYKNWANNEPNGGRGENCIISHNNLEGAWWDIACTNKYIAVCITDPSGGERTVD-----YHFSRTKLTWDAAVKYCNSMGLNIIHIKDDNENSLILGSAKKLNLGTHWIDGNDNAEEGKWVNRKNGELSFKNFISGEPSGGRERSCLQSLPS--GYWIDSKCDSLNSVICYGSVKRA 649          

HSP 5 Score: 97.0561 bits (240), Expect = 3.604e-17
Identity = 59/179 (32.96%), Postives = 88/179 (49.16%), Query Frame = 1
Query: 1432 IQMQMFYLTKIGQQLNQTGTEEKIVFSYYLEEGTWRDIACTNKYL-AICTLNPNAGAKTADYHF-------TKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSFAT--GLWVDSKCDDFNSVVC 1938
            ++ + FY  +   ++N     E  +  Y L +G W D  CT K L A+C  +        D  +       +  + T+  A  YC++ G ++VRV++  S  +LA   K +  D YW+DGND+  EG WVD N   + YKN+A   PNGGR +NC+ S     G W D  C +    VC
Sbjct:  348 LKHKGFYPGEPNGRIN-----ENCINGYLLHDGLWNDFPCTYKNLFALCYKDGLTMPYPEDIEYDVNSLMISTERYTYNEALQYCRTRGSQLVRVKSAASKDILAAYTKKIVADYYWIDGNDHTTEGTWVDANGQVMTYKNWANNEPNGGRGENCIISHNNLEGAWWDIACTNKYIAVC 521          

HSP 6 Score: 92.4337 bits (228), Expect = 1.121e-15
Identity = 51/147 (34.69%), Postives = 72/147 (48.98%), Query Frame = 1
Query: 1486 GTEEKIVFSYYLEEGTWRDIACTNKYLAICTLN--PNAGAKTADYHFTKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSF--ATGLWVDSKC 1914
            G  E     Y   +G W    C  +  AIC      N G        +  ++TF  A  YCK +GLK+ +  N   N ++   ++ + LD YWLDGND  EEGKWVD+++  L +K F    PNG  ++NC+  +    GLW D  C
Sbjct:  236 GRGENCGHGYLTVDGLWNHFPCNYQLWAICYREGETNNGPDPNTIIASHERLTFSEAQDYCKGLGLKMAKADNAAENGMIHGFSRRIYLDLYWLDGNDAKEEGKWVDSDDVDLKHKGFYPGEPNGRINENCINGYLLHDGLWNDFPC 382          

HSP 7 Score: 87.4261 bits (215), Expect = 4.685e-14
Identity = 49/161 (30.43%), Postives = 78/161 (48.45%), Query Frame = 1
Query: 1486 GTEEKIVFSYYLEEGTWRDIACTNKYLAICTLNPNA-------GAKTADYHFTKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSFAT--GLWVDSKCDDFNSVVCY 1941
            G + +     Y   G W D+ C  +  AIC  +P+          + +    ++ KMTF  A  +C + G+++V++ +   N ++   A+    D YW+D ND   E KWVD +   L++KNF    PNGGR +NC   + T  GLW    C+     +CY
Sbjct:  106 GNKNENCLMVYRVNGMWNDLNCVARIWAICQRDPSQLYLGNQIEIEGSGLIISRGKMTFADAQEFCTNRGMRMVKIGHALDNAVVHSFARETYSDYYWIDANDIVNEVKWVDADGKELVHKNFHPGEPNGGRGENCGHGYLTVDGLWNHFPCNYQLWAICY 266          

HSP 8 Score: 86.6557 bits (213), Expect = 7.629e-14
Identity = 42/99 (42.42%), Postives = 59/99 (59.60%), Query Frame = 1
Query: 1621 TKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSF-ATGLWVDSKC 1914
            TKV +T+  A   CK+ G+ +VRV +   N ++   A  +  D+YWLDGND+  EG WVD   + L YKNFA   PNG +++NCL  +   G+W D  C
Sbjct:   29 TKVVVTYNEAIQSCKARGMVLVRVTSAEDNTIVNGYANKVLADTYWLDGNDHTNEGTWVDARGNQLPYKNFAPHEPNGNKNENCLMVYRVNGMWNDLNC 127          
BLAST of Lectin 2b vs. TrEMBL
Match: Q8WSX2 (Lectin 1 (Fragment) OS=Girardia tigrina OX=6162 GN=lec1 PE=2 SV=1)

HSP 1 Score: 262.692 bits (670), Expect = 5.124e-72
Identity = 166/528 (31.44%), Postives = 264/528 (50.00%), Query Frame = 3
Query:   99 VTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPN-GGRSENCINVYRLPSGLWNDITCLARIWAICQ------KDSEVSTDQLEIEGNI----FVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEP-GGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGA--------------DPNTLIASYDR--------------LTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEP-NGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICA----------------KDSLKIKDNENFEIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRG-ENCI 1508
            V+    T+++A++ CKS+ M LVR+ +A++N  V   A K     YWI+GND+  EG +V +    LTYKN+ + EPN  G S++CI     P+G W+D  C  +   +C+       DS    ++ +  G +    + V+  KMTF DA +YC    + +++I +A +N  V++ A +     YW++GND   EG WVD++ K+L YKN+  GEP   G  ++C  G    +  W+D  C     VIC   E+   G+              D N      D                TF +A  YCK + + +VR  NA  N  V+  A +     YW++GND + EG WVD+   +L +K +  GEP N G +++C+ G    +G W+DF C  KN   IC                  +++  KDNE   I + N  ++  +  +++A+++C+ +   + R+++   N  +   ++K     YWI+GND   +G WVD+N   LPYKNW   EPN   G ++CI
Sbjct:  288 VSNAKKTFDDAVKYCKSQPMDLVRITNADNNEFVYNLAVKYKIGRYWINGNDKEKEGTWVYTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNRVVCELVKGDTDDSNEEYEETDSTGKVVKRNYRVNNAKMTFDDAVKYCKDNQMDLVKITNANNNGFVYNLAVKYKIGRYWINGNDRAKEGTWVDTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNAVIC---ELVKGGSGTDEDNGDNGKVTEDSNEEYEEKDNNGKVVKRNYRVSNAKTFDDAVKYCKDKQMDLVRITNADNNKFVYNLAVKYKIGRYWINGNDREKEGTWVDTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNR-VICELVRGDTGTASGKGTDDSNNVIFKDNEGKVISI-NYQINNAKMNFDDAVKYCKDKQMDVVRISNAEINTFVFKLSEKYGLGKYWINGNDRAVDGTWVDTNNKELPYKNWQKGEPNNGGGVQHCI 810          

HSP 2 Score: 262.692 bits (670), Expect = 5.278e-72
Identity = 162/491 (32.99%), Postives = 243/491 (49.49%), Query Frame = 3
Query:  108 TLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNG-GRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVSTDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGG-GRVENCAHGYLNYDSLWNDLPCHFNLWVIC-------------YRSEIRAPGADPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEP-NGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFE-------IDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRG-ENCI 1508
            T +T N+A + CK R M LVR+ + + N +V   A K     YWI+GND   EG +V +    LTYKN+   EPN  G S++CI     P+G W+D  C  +   IC+   +   D  E     + +   KMTF DA +YC  R + ++RI +   N IV + A + N   YW++GND   EG WV ++ ++L YKN+  GEP   G  ++C  G    +  W+D  C     VIC             Y                S  + TF +A  YCK+Q + +VR  NA  N  V+  A +     YW++GND + EG WV +   +L +K +  GEP N G +++C+ G    +G W+DF C  KN              NE +E       +   N  V+  + T+++A+++C+     L ++ +  +N  +   A K     YWI+GND  +EG WVD+N   L YKNW + EPN + G ++CI
Sbjct:   27 TKMTSNDAAKYCKDRKMDLVRIPNKDVNMIVFNLAAKNNLGRYWINGNDREKEGTWVYTNNRELTYKNWQAGEPNNWGGSQHCILGAYFPNGFWDDFNCDTKNSVICEVPKDTDNDNNEG----YHMGNTKMTFDDAVKYCKDRKMDLVRIPNNSVNMIVFNLAAKNNLGRYWINGNDREKEGTWVYTNNRELTYKNWQAGEPNNWGGSQHCILGVYFPNGFWDDFNCDTKNAVICEIAKGDTDDANEEYEETDSTGKVVKRNYRVSNAKKTFDDAVKYCKSQPMDLVRITNADNNEFVYNLAVKYKIGRYWINGNDKEKEGTWVYTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNRVVCELVKGDTDDSNEEYEETDSTGKVVKRNYRVNNAKMTFDDAVKYCKDNQMDLVKITNANNNGFVYNLAVKYKIGRYWINGNDRAKEGTWVDTNNKELTYKNWQSGEPNNSGGSQHCI 513          

HSP 3 Score: 241.506 bits (615), Expect = 1.424e-64
Identity = 172/575 (29.91%), Postives = 269/575 (46.78%), Query Frame = 3
Query:   99 VTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPN-GGRSENCINVYRLPSGLWNDITCLARIWAICQ----------------KDSEVSTDQLEIEGNI-------FVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPG-GGRVENCAHGYLNYDSLWNDLPCHFNLWVICY-----RSEIRAPGADPNTLIASYD---------------RLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPN-GGVNENCLNGYLSLDGLWNDFPCPYKNLFAIC----AKDS-------------LKIKDNE-----------------NFEI----DMDNMMVSAERY-------------------------TYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRG 1496
            V    +T+++A++ CK   M LV++ +A +N  V   A K     YWI+GND   EG +V++    LTYKN+ + EPN  G S++CI     P+G W+D  C  +   IC+                K +E S ++ E + N        + VS  K TF DA +YC  + + ++RI +A +N  V++ A +     YW++GND   EG WVD++ K+L YKN+  GEP   G  ++C  G    +  W+D  C     VIC             G D +  +   D               ++ F +A  YCK + + +VR +NA  N  V   + +     YW++GND  ++G WVD+   +L +K +  GEPN GG  ++C+ G    DG W+D  C  K +  IC    +KDS             + IKDNE                 N +I    D D+    A  Y                          +++A+++C+ +   L ++ ++  NA++   A K   + YW++GND ++EG WVD++ NVL YKNW+  EPN N G
Sbjct:  427 VNNAKMTFDDAVKYCKDNQMDLVKITNANNNGFVYNLAVKYKIGRYWINGNDRAKEGTWVDTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNAVICELVKGGSGTDEDNGDNGKVTEDSNEEYEEKDNNGKVVKRNYRVSNAK-TFDDAVKYCKDKQMDLVRITNADNNKFVYNLAVKYKIGRYWINGNDREKEGTWVDTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNRVICELVRGDTGTASGKGTDDSNNVIFKDNEGKVISINYQINNAKMNFDDAVKYCKDKQMDVVRISNAEINTFVFKLSEKYGLGKYWINGNDRAVDGTWVDTNNKELPYKNWQKGEPNNGGGVQHCIQGGYYSDGFWDDINCDVK-ISVICESRKSKDSSGKGDTDANNGLYVIIKDNEGKGTGKLVIDKGTEDSTNGQILIIRDKDDKGSEALNYGKYVITKESETKVVSTSYHLTNAKMNFDDAVKYCKDKQMDLVKIPNEEVNAVVFKKAAKYNLETYWLNGNDRSKEGTWVDTDNNVLTYKNWSTGEPNNNGG 999          

HSP 4 Score: 113.62 bits (283), Expect = 4.114e-22
Identity = 82/306 (26.80%), Postives = 133/306 (43.46%), Query Frame = 3
Query:   99 VTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPN-GGRSENCINVYRLPSGLWNDIT--------CLAR----------------IWAICQKDSEVSTDQLEIE--------GNIFVV---------------------------------SKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEP-GGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYR 815
            +    + +++A++ CK + M +VR+++AE N  V   + K     YWI+GND   +G +V++    L YKN+   EPN GG  ++CI       G W+DI         C +R                ++ I + +    T +L I+        G I ++                                 +  KM F DA +YC  + + +++I +   NA+V   A + N + YW++GND   EG WVD+D   L YKN+  GEP   G  ++C  G  N +  W    C+    V+C R
Sbjct:  724 INNAKMNFDDAVKYCKDKQMDVVRISNAEINTFVFKLSEKYGLGKYWINGNDRAVDGTWVDTNNKELPYKNWQKGEPNNGGGVQHCIQGGYYSDGFWDDINCDVKISVICESRKSKDSSGKGDTDANNGLYVIIKDNEGKGTGKLVIDKGTEDSTNGQILIIRDKDDKGSEALNYGKYVITKESETKVVSTSYHLTNAKMNFDDAVKYCKDKQMDLVKIPNEEVNAVVFKKAAKYNLETYWLNGNDRSKEGTWVDTDNNVLTYKNWSTGEPNNNGGNKHCLQGSNNLNGYWEASDCNGLNSVVCVR 1029          

HSP 5 Score: 101.293 bits (251), Expect = 2.766e-18
Identity = 61/176 (34.66%), Postives = 88/176 (50.00%), Query Frame = 1
Query: 1465 GQQLNQTGTEEKIVFSYYLEEGTWRDIACTNKYLAICTL------NPNAGAKTAD---------YHFTKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAP-NGGRDKNCLQS--FATGLWVDSKCDDFNSVVC 1938
            G+  N  G++  IV +YY   G W D  C  K   +C L      + N   +  D         Y     KMTF+ A  YCK   + +V++ N N+N  + + A   K+  YW++GND A+EG WVDTNN  L YKN+ +  P N G  ++C+    +  G W D  CD  N+V+C
Sbjct:  362 GEPNNSGGSQHCIVGAYY-PNGFWDDFNCDTKNRVVCELVKGDTDDSNEEYEETDSTGKVVKRNYRVNNAKMTFDDAVKYCKDNQMDLVKITNANNNGFVYNLAVKYKIGRYWINGNDRAKEGTWVDTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNAVIC 536          

HSP 6 Score: 100.523 bits (249), Expect = 5.164e-18
Identity = 56/160 (35.00%), Postives = 79/160 (49.38%), Query Frame = 1
Query: 1471 QLNQTGTEEKIVFSYYLEEGTWRDIACTNKYLAICTLNPNAGAKTAD-YHFTKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNG-GRDKNCLQS--FATGLWVDSKCDDFNSVVC 1938
            + N  G  +  +   Y   G W D  C  K   IC +  +      + YH    KMTF+ A  YCK   + +VR+ N + N ++ + A    L  YW++GND  +EG WV TNN  L YKN+ A  PN  G  ++C+    F  G W D  CD  N+V+C
Sbjct:   99 EPNNWGGSQHCILGAYFPNGFWDDFNCDTKNSVICEVPKDTDNDNNEGYHMGNTKMTFDDAVKYCKDRKMDLVRIPNNSVNMIVFNLAAKNNLGRYWINGNDREKEGTWVYTNNRELTYKNWQAGEPNNWGGSQHCILGVYFPNGFWDDFNCDTKNAVIC 258          

HSP 7 Score: 94.7449 bits (234), Expect = 3.100e-16
Identity = 63/183 (34.43%), Postives = 84/183 (45.90%), Query Frame = 1
Query: 1465 GQQLNQTGTEEKIVFSYYLEEGTWRDIACTNKYLAICTL-----NPNAGAKTAD-----------------YHFTKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAP-NGGRDKNCLQS--FATGLWVDSKCDDFNSVVC 1938
            G+  N  G++  IV +YY   G W D  C  K   IC L        +G  T D                 Y     KM F+ A  YCK   + VVR+ N   N  +   ++   L  YW++GND A +G WVDTNN  L YKN+    P NGG  ++C+Q   ++ G W D  CD   SV+C
Sbjct:  652 GEPNNSGGSQHCIVGAYY-PNGFWDDFNCDTKNRVICELVRGDTGTASGKGTDDSNNVIFKDNEGKVISINYQINNAKMNFDDAVKYCKDKQMDVVRISNAEINTFVFKLSEKYGLGKYWINGNDRAVDGTWVDTNNKELPYKNWQKGEPNNGGGVQHCIQGGYYSDGFWDDINCDVKISVIC 833          

HSP 8 Score: 94.3597 bits (233), Expect = 4.574e-16
Identity = 57/174 (32.76%), Postives = 81/174 (46.55%), Query Frame = 1
Query: 1471 QLNQTGTEEKIVFSYYLEEGTWRDIACTNKYLAIC------TLNPNAGAKTAD---------YHFTKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAP-NGGRDKNCLQS--FATGLWVDSKCDDFNSVVC 1938
            + N  G  +  +   Y   G W D  C  K   IC      T + N   +  D         Y  +  K TF+ A  YCKS  + +VR+ N ++N  + + A   K+  YW++GND  +EG WV TNN  L YKN+ +  P N G  ++C+    +  G W D  CD  N VVC
Sbjct:  224 EPNNWGGSQHCILGVYFPNGFWDDFNCDTKNAVICEIAKGDTDDANEEYEETDSTGKVVKRNYRVSNAKKTFDDAVKYCKSQPMDLVRITNADNNEFVYNLAVKYKIGRYWINGNDKEKEGTWVYTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNRVVC 397          

HSP 9 Score: 93.9745 bits (232), Expect = 5.207e-16
Identity = 48/115 (41.74%), Postives = 68/115 (59.13%), Query Frame = 1
Query: 1603 TADYHFTKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAP-NGGRDKNCLQSFA--TGLWVDSKCDDFNSVVC 1938
            +  YH T  KM F+ A  YCK   + +V++ N   N ++   A    L++YWL+GND ++EG WVDT+N+ L YKN++   P N G +K+CLQ      G W  S C+  NSVVC
Sbjct:  913 STSYHLTNAKMNFDDAVKYCKDKQMDLVKIPNEEVNAVVFKKAAKYNLETYWLNGNDRSKEGTWVDTDNNVLTYKNWSTGEPNNNGGNKHCLQGSNNLNGYWEASDCNGLNSVVC 1027          

HSP 10 Score: 93.5893 bits (231), Expect = 8.232e-16
Identity = 62/189 (32.80%), Postives = 88/189 (46.56%), Query Frame = 1
Query: 1465 GQQLNQTGTEEKIVFSYYLEEGTWRDIACTNKYLAICTL----------NPNAGAKTAD------------------YHFTKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAP-NGGRDKNCLQS--FATGLWVDSKCDDFNSVVC 1938
            G+  N  G++  IV +YY   G W D  C  K   IC L          N + G  T D                  Y  +  K TF+ A  YCK   + +VR+ N ++N+ + + A   K+  YW++GND  +EG WVDTNN  L YKN+ +  P N G  ++C+    +  G W D  CD  N V+C
Sbjct:  501 GEPNNSGGSQHCIVGAYY-PNGFWDDFNCDTKNAVICELVKGGSGTDEDNGDNGKVTEDSNEEYEEKDNNGKVVKRNYRVSNAK-TFDDAVKYCKDKQMDLVRITNADNNKFVYNLAVKYKIGRYWINGNDREKEGTWVDTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNRVIC 687          

HSP 11 Score: 86.6557 bits (213), Expect = 1.078e-13
Identity = 47/112 (41.96%), Postives = 62/112 (55.36%), Query Frame = 1
Query: 1612 YHFTKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNG-GRDKNCLQS--FATGLWVDSKCDDFNSVVC 1938
            YH    KMT   AA YCK   + +VR+ N + N ++ + A    L  YW++GND  +EG WV TNN  L YKN+ A  PN  G  ++C+    F  G W D  CD  NSV+C
Sbjct:   22 YHMGNTKMTSNDAAKYCKDRKMDLVRIPNKDVNMIVFNLAAKNNLGRYWINGNDREKEGTWVYTNNRELTYKNWQAGEPNNWGGSQHCILGAYFPNGFWDDFNCDTKNSVIC 133          

HSP 12 Score: 75.0998 bits (183), Expect = 3.732e-10
Identity = 43/126 (34.13%), Postives = 67/126 (53.17%), Query Frame = 3
Query:  786 HFNLWVICYRSEIRAPGADPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEP-NGGVNENCLNGYLSLDGLWNDFPC 1160
            ++  +VI   SE +      +   A   ++ F +A  YCK + + +V+  N   NA+V   A +   + YWL+GND   EG WVD++ N L +K +  GEP N G N++CL G  +L+G W    C
Sbjct:  897 NYGKYVITKESETKVVSTSYHLTNA---KMNFDDAVKYCKDKQMDLVKIPNEEVNAVVFKKAAKYNLETYWLNGNDRSKEGTWVDTDNNVLTYKNWSTGEPNNNGGNKHCLQGSNNLNGYWEASDC 1019          

HSP 13 Score: 70.8626 bits (172), Expect = 8.258e-9
Identity = 38/113 (33.63%), Postives = 66/113 (58.41%), Query Frame = 3
Query:   90 TLFVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEP-NGGRSENCINVYRLPSGLWNDITCLARIWAIC 425
            +  +T   + +++A++ CK + M LV++ + E NAVV   A K   ++YW++GND + EG +V++  N+LTYKN+ T EP N G +++C+      +G W    C      +C
Sbjct:  915 SYHLTNAKMNFDDAVKYCKDKQMDLVKIPNEEVNAVVFKKAAKYNLETYWLNGNDRSKEGTWVDTDNNVLTYKNWSTGEPNNNGGNKHCLQGSNNLNGYWEASDCNGLNSVVC 1027          
BLAST of Lectin 2b vs. TrEMBL
Match: Q8WSW7 (Scarf3b OS=Girardia tigrina OX=6162 GN=scarf3b PE=2 SV=1)

HSP 1 Score: 201.445 bits (511), Expect = 1.194e-54
Identity = 123/380 (32.37%), Postives = 200/380 (52.63%), Query Frame = 3
Query:   30 VLTIFILITLDSCRSDIDVNTLFVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNG-GRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVSTDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGG-GRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGADPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNG-GVNENCLNGYLSLDGLWNDFPC 1160
            +L  F L  +             + K  + YN+A++ C S+ MRLV++  ++ NA V   A+K    +YW++GND   EG +V+++   L YKN+   EPN  G  +NC+     P+ +W DI C      IC         ++ IE   +  +K KMT+ DA +YC+ R++ +++I ++  N  V++ A + N   YW++GNDI  EG WVD++ K L+YKN+  GEP   G  +NC     + + +W D+ C+    VIC   E+       N      +++T+ +A  YC  + + +V+  N+  N  V+  A +     YW++GND  +EG WVD+E   L +K ++ GEPN  G N+NCL      + +W D  C
Sbjct:    1 MLHFFQLFLVGLIFQLTQAQYYHLNKNKMNYNDAVKYCNSKEMRLVKITDSQTNAAVFELASKNGMGTYWMNGNDIAIEGTWVDTENKPLVYKNWYKGEPNNWGGDQNCLVAAYHPNEMWFDIGCNTLNSVIC---------EIVIEN--YHTNKNKMTYNDAVKYCNDRNMDLVKIPNSEVNMNVYNLALKHNLGTYWMNGNDIAIEGTWVDTENKPLVYKNWYKGEPNNWGGNQNCLVVAYHPNEMWFDIGCNTLNSVIC---EVVEENCHTNK-----NKMTYNDAVKYCNDRNMDLVKIPNSEVNVNVYNLALKHNLGTYWMNGNDIAIEGTWVDTENKPLVYKNWYKGEPNNWGGNQNCLVAAYHPNEMWFDIGC 361          

HSP 2 Score: 187.193 bits (474), Expect = 2.363e-49
Identity = 114/360 (31.67%), Postives = 182/360 (50.56%), Query Frame = 3
Query:  465 EGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGG-GRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGADPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNG-GVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFEIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRG-ENCIFILLRRRDM 1535
            +   + ++K KM + DA +YC+++ +++++I  +  NA V   A +     YW++GNDI  EG WVD++ K L+YKN+  GEP   G  +NC     + + +W D+ C+    VIC   EI       N      +++T+ +A  YC  + + +V+  N+  N  V+  A +     YW++GND  +EG WVD+E   L +K ++ GEPN  G N+NCL      + +W D  C   N   IC             E+  +N   +  + TYN+A+++C  R   L ++ +   N  +   A K     YW++GND   EG WVD+    L YKNW   EPN   G +NC+       +M
Sbjct:   18 QAQYYHLNKNKMNYNDAVKYCNSKEMRLVKITDSQTNAAVFELASKNGMGTYWMNGNDIAIEGTWVDTENKPLVYKNWYKGEPNNWGGDQNCLVAAYHPNEMWFDIGCNTLNSVIC---EIVIENYHTNK-----NKMTYNDAVKYCNDRNMDLVKIPNSEVNMNVYNLALKHNLGTYWMNGNDIAIEGTWVDTENKPLVYKNWYKGEPNNWGGNQNCLVVAYHPNEMWFDIGCNTLN-SVIC-------------EVVEENCHTNKNKMTYNDAVKYCNDRNMDLVKIPNSEVNVNVYNLALKHNLGTYWMNGNDIAIEGTWVDTENKPLVYKNWYKGEPNNWGGNQNCLVAAYHPNEM 355          

HSP 3 Score: 149.058 bits (375), Expect = 1.425e-35
Identity = 90/257 (35.02%), Postives = 143/257 (55.64%), Query Frame = 3
Query:   54 TLDSCRSDIDVNTLFVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNG-GRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVSTDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGG-GRVENCAHGYLNYDSLWNDLPCHFNLWVICYRS 818
            TL+S   +I +      K  +TYN+A++ C  R M LV++ ++E N  V   A K    +YW++GND   EG +V+++   L YKN+   EPN  G ++NC+ V   P+ +W DI C      IC+           +E N    +K KMT+ DA +YC+ R++ +++I ++  N  V++ A + N   YW++GNDI  EG WVD++ K L+YKN+  GEP   G  +NC     + + +W D+ C+    VICY +
Sbjct:  127 TLNSVICEIVIENYHTNKNKMTYNDAVKYCNDRNMDLVKIPNSEVNMNVYNLALKHNLGTYWMNGNDIAIEGTWVDTENKPLVYKNWYKGEPNNWGGNQNCLVVAYHPNEMWFDIGCNTLNSVICEV----------VEENCH-TNKNKMTYNDAVKYCNDRNMDLVKIPNSEVNVNVYNLALKHNLGTYWMNGNDIAIEGTWVDTENKPLVYKNWYKGEPNNWGGNQNCLVAAYHPNEMWFDIGCNTLNSVICYNA 372          

HSP 4 Score: 91.6633 bits (226), Expect = 4.800e-16
Identity = 56/161 (34.78%), Postives = 80/161 (49.69%), Query Frame = 1
Query: 1465 GQQLNQTGTEEKIVFSYYLEEGTWRDIACTNKYLAICTLNPNAGAKTADYHFTKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNG-GRDKNCL--QSFATGLWVDSKCDDFNSVVC 1938
            G+  N  G +  +V +Y+  E  W DI C      IC +         +YH  K KMT+  A  YC    + +V++ N   N  + + A    L +YW++GND A EG WVDT N  L+YKN+    PN  G ++NCL        +W D  C+  NSV+C
Sbjct:   98 GEPNNWGGDQNCLVAAYHPNE-MWFDIGCNTLNSVICEI------VIENYHTNKNKMTYNDAVKYCNDRNMDLVKIPNSEVNMNVYNLALKHNLGTYWMNGNDIAIEGTWVDTENKPLVYKNWYKGEPNNWGGNQNCLVVAYHPNEMWFDIGCNTLNSVIC 251          

HSP 5 Score: 91.6633 bits (226), Expect = 5.661e-16
Identity = 56/164 (34.15%), Postives = 82/164 (50.00%), Query Frame = 1
Query: 1465 GQQLNQTGTEEKIVFSYYLEEGTWRDIACTNKYLAICTLNPNAGAKTADYHFTKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNG-GRDKNCLQS--FATGLWVDSKCDDFNSVVCYGS 1947
            G+  N  G +  +V +Y+  E  W DI C      IC +         + H  K KMT+  A  YC    + +V++ N   N  + + A    L +YW++GND A EG WVDT N  L+YKN+    PN  G ++NCL +      +W D  C+  NSV+CY +
Sbjct:  216 GEPNNWGGNQNCLVVAYHPNE-MWFDIGCNTLNSVICEV------VEENCHTNKNKMTYNDAVKYCNDRNMDLVKIPNSEVNVNVYNLALKHNLGTYWMNGNDIAIEGTWVDTENKPLVYKNWYKGEPNNWGGNQNCLVAAYHPNEMWFDIGCNTLNSVICYNA 372          

HSP 6 Score: 84.3445 bits (207), Expect = 1.428e-13
Identity = 43/112 (38.39%), Postives = 64/112 (57.14%), Query Frame = 1
Query: 1612 YHFTKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNG-GRDKNCLQS--FATGLWVDSKCDDFNSVVC 1938
            YH  K KM +  A  YC S  +++V++ +  +N  + + A    + +YW++GND A EG WVDT N  L+YKN+    PN  G D+NCL +      +W D  C+  NSV+C
Sbjct:   22 YHLNKNKMNYNDAVKYCNSKEMRLVKITDSQTNAAVFELASKNGMGTYWMNGNDIAIEGTWVDTENKPLVYKNWYKGEPNNWGGDQNCLVAAYHPNEMWFDIGCNTLNSVIC 133          
BLAST of Lectin 2b vs. Ensembl Cavefish
Match: mrc1a (mannose receptor C-type 1 [Source:NCBI gene;Acc:103028880])

HSP 1 Score: 83.1889 bits (204), Expect = 2.677e-23
Identity = 119/527 (22.58%), Postives = 199/527 (37.76%), Query Frame = 3
Query:  117 TYNEALQSCKSRGMRLVRVNSA-EDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRS-ENCINVYRLPSGLWNDITCLARIWAICQ-------KDSEVSTDQ----------LEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPG-GGRVENCAHGYLNYDSLWNDLPCHFNLWVICYRS-----EIRAPGADPN---------------TLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGK--WVDSEENDLKH--KGFHPGEPNG----GVNENCL---NGYLSLDGLWNDFPCPYKNLFAICAKD--------SLKIKDNENFEIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGK--WVDSNANVLPYKNWAATEPNGNRGENCIFI 1514
            T+ EA   C++ G  L   +S  E NA+  G +    +D  WI  +       FV S      Y N+   EPN     E+C          WND  C +    ICQ       K     + Q          ++  G+ + ++  +++  DA+ +C      ++ I    +   +         D Y++ G  +  +  +   DG  ++Y ++   EP      ENC   Y +    WND+ C  +L  IC RS        AP   P                  +      ++ +A+ YC +QG  +V   + AE A +       + D+ W+  ND   E +  W D +     +  KG     P+G    G + +C+        + G+W    C  K  F IC ++           +     F +  ++  +  E+ +++EA + C+     LA V   V  A LA        +  WI  N +   G+  WVD+   +L Y  WA  EP  N    C++I
Sbjct:  671 TWFEARDYCRAVGGDLASFHSEDETNALPYGGS----SDPAWIGFSSLDTNVGFVWSDETPSNYDNWSYGEPNNYNDIEHCTEASFYYGHRWNDRACESYNDWICQIRLGTTPKAPPTQSPQAKFNITDDGWIQFNGSQYYINTDRLSMDDARAFCKKNHSDLVVITGQTERRFIWKQISRGTEDQYYI-GMTVGLDKSFSWVDGSPVVYTSWDQNEPNFANNDENCVTIYKSM-GFWNDINCGVSLPSICKRSANFATSTAAPTTIPKGGCAPEWTSFHGKCYKFVGKDSEKSWHDARQYCISQGGNLVSIRSHAEQAFLTTMMLSASDDM-WIGLNDVNWEMRFLWTDGKGVTFTNWAKGHPVSIPDGRRSYGADFDCVIMVKDPSRMTGMWKVEDCSEKRGF-ICKRNIDSQIQVQPTTVSSKAYFAMGNNSYKLQTEKMSWDEARRQCKADDADLASVLDTVTEA-LAMLRFNRFKEPVWIGLNSNLTSGRYRWVDNW--LLRYTKWAPGEPKRNLA--CVYI 1184          

HSP 2 Score: 45.8246 bits (107), Expect = 2.677e-23
Identity = 37/168 (22.02%), Postives = 69/168 (41.07%), Query Frame = 1
Query: 1513 YYLEEGTWRDIACTNKYLAIC--------TLNPNAGAKTADYHFTKVKMTFEA---------------AALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLD--SYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSFA-TGLWVDSKCDDFNSVVC 1938
            Y   +GTW+   C+N Y ++C        T  P       +    K  + F                 A + C  +G  +V V +      +  + + L+ D  S+W+  + N  EG+W+  +N  + Y N+A   P    D  C++  + +GLW  ++C  + + +C
Sbjct: 1183 YIDTDGTWKTADCSNTYFSLCKRSSEIAPTEPPQLPGNCPEPKRHKTWIPFRGHCYAFLAARSENWAHATVECMRMGASMVSVEDGLEAAFIQRNLEILQDDSKSFWIGMHRN-HEGEWMWIDNMVVDYTNWAPRMPTAYGD--CVEVRSDSGLWYTTRCSGYRAYIC 1347          

HSP 3 Score: 91.2781 bits (225), Expect = 1.853e-18
Identity = 104/530 (19.62%), Postives = 206/530 (38.87%), Query Frame = 3
Query:   99 VTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRS--ENCINVYRLPSGLWNDITCLARIWAICQKDSEV-------------STDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDS-LWNDLPCHFNLWVICYR------SEIRAPGADPNTLIASY-----------------DRLTFQEAQDYCKAQGLKMVRANNAAE-NALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVN-ENCLNGYLSLDGLWNDFPCPYKNLFAIC---------------AKDSLKIKDNENFEIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEG-KWVDSNANVLPYKNWAATEPN-GNRGENCIFI 1514
            + +  + + +AL +C   G  L  +++ E+++ +   +     D  WI  ND+  + +F  S    +T+  +   EP+   +  E+C+ + +   G W D  C      IC+K + +                 +    + + ++     F DA+  C   +  ++++    +NA + S         +W+  ++     ++  ++ + + + +F VG P   R + C        + LW+   C      IC +      +    P   P +  + +                 D+ T+ EA+DYC+A G  +   ++  E NAL +G     +SD  W+  +       +V S+E    +  +  GEPN   + E+C          WND  C   N + IC                +    I D+   + +     ++ +R + ++A  FC+   + L  +  Q +   +     +   D Y+I      ++   WVD +  V  Y +W   EPN  N  ENC+ I
Sbjct:  376 IRRNKMMWRDALSACHKDGAELASIHNIEEHSFIISQSGYTPTDEIWIGLNDQKTQNLFEWSDRTHVTFAKWLVGEPSHATNLREDCV-LMKGKDGKWADHMCEKEHDFICKKKASIKPAGSHEIISPGCPAGWIRYSSHCYSIAVEAKKFNDAKTTCQQSAASLVQVSGRYENAFLVSLIGLRPEKYFWIGLSNTERADRFQWTNKETVAFTHFNVGLP--DRRQGCVAMQTGTSAGLWDIQSCDTKQKYICKKMAEGVTTTKEPPTTQPLSCPSKWIKKDSTSCIRVYKSKNEDKKTWFEARDYCRAVGGDLASFHSEDETNALPYGG----SSDPAWIGFSSLDTNVGFVWSDETPSNYDNWSYGEPNNYNDIEHCTEASFYYGHRWNDRACESYNDW-ICQIRLGTTPKAPPTQSPQAKFNITDDGWIQFNGSQYYINTDRLSMDDARAFCKKNHSDLVVITGQTERRFIWKQISRGTEDQYYIGMTVGLDKSFSWVDGSPVV--YTSWDQNEPNFANNDENCVTI 895          

HSP 4 Score: 90.1225 bits (222), Expect = 3.386e-18
Identity = 114/523 (21.80%), Postives = 203/523 (38.81%), Query Frame = 3
Query:  102 TKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVST-------DQ--------LEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGR--VENCAHGYLNYDSLWNDLPCHFNLWVICYRS---------EIRAPGADPNTLIAS-------YDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYW--LDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLD-GLWNDFPCPYKNLFAICAKDSLKIKDNENFE-----------IDMDNMMV-------SAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNG-NRGENC 1505
            T++++T+++A +SC+ +G  L+ +    +   ++G  N +L  + WI  N    E  +  S GN   Y N+    P+     NC+ +    +  W  + C  ++  IC+K +  ST       DQ        +   G+ + + + KM + DA   C     ++  I +  +++ + S +  T +D  W+  ND  T+  +  SD   + +  + VGEP       E+C       D  W D  C      IC +          EI +PG     +  S        +   F +A+  C+     +V+ +   ENA +           +W  L   +     +W + E     H  F+ G P+    + C+        GLW+   C  K  + IC K +  +   +              I  D+          + ++ T+ EA  +CR  G  LA  +S+ +   L        +D  WI  +       +V S+     Y NW+  EPN  N  E+C
Sbjct:  235 TQSVLTWHQARKSCQQQGADLLSIVELHEQTYISGLTN-ILGSALWIGLNSLDFESGWQWSNGNPFRYLNWAPGHPSLEPGLNCVALNAGKASKWESMACNKKLGYICRKGNSTSTITPSGVKDQPSFCPTTWVPYSGHCYSIRRNKMMWRDALSACHKDGAELASIHNIEEHSFIISQSGYTPTDEIWIGLNDQKTQNLFEWSDRTHVTFAKWLVGEPSHATNLREDCVL-MKGKDGKWADHMCEKEHDFICKKKASIKPAGSHEIISPGCPAGWIRYSSHCYSIAVEAKKFNDAKTTCQQSAASLVQVSGRYENAFLVSLIGLRPEKYFWIGLSNTERADRFQWTNKETVAFTH--FNVGLPD--RRQGCVAMQTGTSAGLWDIQSCDTKQKY-ICKKMAEGVTTTKEPPTTQPLSCPSKWIKKDSTSCIRVYKSKNEDKKTWFEARDYCRAVGGDLASFHSEDETNALPYGGS---SDPAWIGFSSLDTNVGFVWSDETPSNYDNWSYGEPNNYNDIEHC 747          

HSP 5 Score: 85.8853 bits (211), Expect = 8.436e-17
Identity = 112/531 (21.09%), Postives = 207/531 (38.98%), Query Frame = 3
Query:   96 FVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPN-GGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVST---------------DQLEIEGNI--FVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNF----PVGEPGGGRVENCAHGYL-------NYDSLWNDLPCHFNLWVICYRSEIRAPGADPNTLIA---------SY----DRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGK--WVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFEIDMD-----------------NMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVV------ADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNG 1487
            ++    ++ ++A   CK     LV +    +   +    ++   D Y+I G     +  F    G+ + Y ++  NEPN     ENC+ +Y+   G WNDI C   + +IC++ +  +T               +     G    FV    + ++ DA++YC ++   ++ I    + A + +     + D+ W+  ND+  E +++ +DGK + + N+    PV  P G R        +           +W    C      IC R+        P T+ +         SY    +++++ EA+  CKA    +    +    AL      R    + W+  N     G+  WVD+    L++  + PGEP    N  C+  Y+  DG W    C     F++C + S +I   E  ++  +                    ++A    +  A   C   G  +      V++ + AAF ++ +      +  +WI G     EG+W+  +  V+ Y NWA   P  
Sbjct:  807 YINTDRLSMDDARAFCKKNHSDLVVITGQTERRFIWKQISRGTEDQYYI-GMTVGLDKSFSWVDGSPVVYTSWDQNEPNFANNDENCVTIYK-SMGFWNDINCGVSLPSICKRSANFATSTAAPTTIPKGGCAPEWTSFHGKCYKFVGKDSEKSWHDARQYCISQGGNLVSIRSHAEQAFLTTMMLSASDDM-WIGLNDVNWEMRFLWTDGKGVTFTNWAKGHPVSIPDGRRSYGADFDCVIMVKDPSRMTGMWKVEDCSEKRGFICKRNIDSQIQVQPTTVSSKAYFAMGNNSYKLQTEKMSWDEARRQCKADDADLASVLDTVTEALAMLRFNRFKEPV-WIGLNSNLTSGRYRWVDNWL--LRYTKWAPGEPK--RNLACV--YIDTDGTWKTADCS-NTYFSLCKRSS-EIAPTEPPQLPGNCPEPKRHKTWIPFRGHCYAFLAARSENWAHATVECMRMGASMV----SVEDGLEAAFIQRNLEILQDDSKSFWI-GMHRNHEGEWMWIDNMVVDYTNWAPRMPTA 1320          

HSP 6 Score: 37.7354 bits (86), Expect = 5.256e-7
Identity = 21/82 (25.61%), Postives = 36/82 (43.90%), Query Frame = 3
Query: 1269 TYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENCIFI 1514
            T+++A + C+ +G  L  +    +   ++     ++    WI  N    E  W  SN N   Y NWA   P+   G NC+ +
Sbjct:  240 TWHQARKSCQQQGADLLSIVELHEQTYISGLTN-ILGSALWIGLNSLDFESGWQWSNGNPFRYLNWAPGHPSLEPGLNCVAL 320          

HSP 7 Score: 35.8094 bits (81), Expect = 5.256e-7
Identity = 30/159 (18.87%), Postives = 56/159 (35.22%), Query Frame = 1
Query: 1534 WRDIACTNKYLAIC-------TLNPNAGAKTAD--------------YHFTKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGG---RDKNCLQSFATGLWVDSKCDDFNSVVC 1938
            W  +AC  K   IC       T+ P +G K                 Y   + KM +  A   C   G ++  + N+  +  +   + Y   D  W+  ND   +  +  ++ + + +  +    P+     R+   L     G W D  C+  +  +C
Sbjct:  328 WESMACNKKLGYICRKGNSTSTITP-SGVKDQPSFCPTTWVPYSGHCYSIRRNKMMWRDALSACHKDGAELASIHNIEEHSFIISQSGYTPTDEIWIGLNDQKTQNLFEWSDRTHVTFAKWLVGEPSHATNLREDCVLMKGKDGKWADHMCEKEHDFIC 485          
BLAST of Lectin 2b vs. Ensembl Cavefish
Match: mrc1a (mannose receptor C-type 1 [Source:NCBI gene;Acc:103028880])

HSP 1 Score: 91.6633 bits (226), Expect = 1.467e-18
Identity = 104/530 (19.62%), Postives = 206/530 (38.87%), Query Frame = 3
Query:   99 VTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRS--ENCINVYRLPSGLWNDITCLARIWAICQKDSEV-------------STDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDS-LWNDLPCHFNLWVICYR------SEIRAPGADPNTLIASY-----------------DRLTFQEAQDYCKAQGLKMVRANNAAE-NALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVN-ENCLNGYLSLDGLWNDFPCPYKNLFAIC---------------AKDSLKIKDNENFEIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEG-KWVDSNANVLPYKNWAATEPN-GNRGENCIFI 1514
            + +  + + +AL +C   G  L  +++ E+++ +   +     D  WI  ND+  + +F  S    +T+  +   EP+   +  E+C+ + +   G W D  C      IC+K + +                 +    + + ++     F DA+  C   +  ++++    +NA + S         +W+  ++     ++  ++ + + + +F VG P   R + C        + LW+   C      IC +      +    P   P +  + +                 D+ T+ EA+DYC+A G  +   ++  E NAL +G     +SD  W+  +       +V S+E    +  +  GEPN   + E+C          WND  C   N + IC                +    I D+   + +     ++ +R + ++A  FC+   + L  +  Q +   +     +   D Y+I      ++   WVD +  V  Y +W   EPN  N  ENC+ I
Sbjct:  376 IRRNKMMWRDALSACHKDGAELASIHNIEEHSFIISQSGYTPTDEIWIGLNDQKTQNLFEWSDRTHVTFAKWLVGEPSHATNLREDCV-LMKGKDGKWADHMCEKEHDFICKKKASIKPAGSHEIISPGCPAGWIRYSSHCYSIAVEAKKFNDAKTTCQQSAASLVQVSGRYENAFLVSLIGLRPEKYFWIGLSNTERADRFQWTNKETVAFTHFNVGLP--DRRQGCVAMQTGTSAGLWDIQSCDTKQKYICKKMAEGVTTTKEPPTTQPLSCPSKWIKKDSTSCIRVYKSKNEDKKTWFEARDYCRAVGGDLASFHSEDETNALPYGG----SSDPAWIGFSSLDTNVGFVWSDETPSNYDNWSYGEPNNYNDIEHCTEASFYYGHRWNDRACESYNDW-ICQIRLGTTPKAPPTQSPQAKFNITDDGWIQFNGSQYYINTDRLSMDDARAFCKKNHSDLVVITGQTERRFIWKQISRGTEDQYYIGMTVGLDKSFSWVDGSPVV--YTSWDQNEPNFANNDENCVTI 895          

HSP 2 Score: 90.5077 bits (223), Expect = 3.154e-18
Identity = 114/523 (21.80%), Postives = 203/523 (38.81%), Query Frame = 3
Query:  102 TKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVST-------DQ--------LEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGR--VENCAHGYLNYDSLWNDLPCHFNLWVICYRS---------EIRAPGADPNTLIAS-------YDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYW--LDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLD-GLWNDFPCPYKNLFAICAKDSLKIKDNENFE-----------IDMDNMMV-------SAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNG-NRGENC 1505
            T++++T+++A +SC+ +G  L+ +    +   ++G  N +L  + WI  N    E  +  S GN   Y N+    P+     NC+ +    +  W  + C  ++  IC+K +  ST       DQ        +   G+ + + + KM + DA   C     ++  I +  +++ + S +  T +D  W+  ND  T+  +  SD   + +  + VGEP       E+C       D  W D  C      IC +          EI +PG     +  S        +   F +A+  C+     +V+ +   ENA +           +W  L   +     +W + E     H  F+ G P+    + C+        GLW+   C  K  + IC K +  +   +              I  D+          + ++ T+ EA  +CR  G  LA  +S+ +   L        +D  WI  +       +V S+     Y NW+  EPN  N  E+C
Sbjct:  235 TQSVLTWHQARKSCQQQGADLLSIVELHEQTYISGLTN-ILGSALWIGLNSLDFESGWQWSNGNPFRYLNWAPGHPSLEPGLNCVALNAGKASKWESMACNKKLGYICRKGNSTSTITPSGVKDQPSFCPTTWVPYSGHCYSIRRNKMMWRDALSACHKDGAELASIHNIEEHSFIISQSGYTPTDEIWIGLNDQKTQNLFEWSDRTHVTFAKWLVGEPSHATNLREDCVL-MKGKDGKWADHMCEKEHDFICKKKASIKPAGSHEIISPGCPAGWIRYSSHCYSIAVEAKKFNDAKTTCQQSAASLVQVSGRYENAFLVSLIGLRPEKYFWIGLSNTERADRFQWTNKETVAFTH--FNVGLPD--RRQGCVAMQTGTSAGLWDIQSCDTKQKY-ICKKMAEGVTTTKEPPTTQPLSCPSKWIKKDSTSCIRVYKSKNEDKKTWFEARDYCRAVGGDLASFHSEDETNALPYGGS---SDPAWIGFSSLDTNVGFVWSDETPSNYDNWSYGEPNNYNDIEHC 747          

HSP 3 Score: 80.8777 bits (198), Expect = 2.833e-15
Identity = 112/555 (20.18%), Postives = 210/555 (37.84%), Query Frame = 3
Query:   96 FVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPN-GGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVST---------------DQLEIEGNI--FVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEP---GGGRVENCAHGYLNYDSLWNDLPCHFNLWV--------------------------------ICYRSEIRAPGADPNTLIA---------SY----DRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEG--KWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFEIDMD-----------------NMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVV------ADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNG 1487
            ++    ++ ++A   CK     LV +    +   +    ++   D Y+I G     +  F    G+ + Y ++  NEPN     ENC+ +Y+   G WNDI C   + +IC++ +  +T               +     G    FV    + ++ DA++YC ++   ++ I    + A + +     + D+ W+  ND+  E +++ +DGK + + N+  G P     GR    A     +  +W       ++W+                                IC R+        P T+ +         SY    +++++ EA+  CKA    +    +    AL      R    + W+  N     G  +WVD+    L++  + PGEP    N  C+  Y+  DG W    C     F++C + S +I   E  ++  +                    ++A    +  A   C   G  +      V++ + AAF ++ +      +  +WI G     EG+W+  +  V+ Y NWA   P  
Sbjct:  807 YINTDRLSMDDARAFCKKNHSDLVVITGQTERRFIWKQISRGTEDQYYI-GMTVGLDKSFSWVDGSPVVYTSWDQNEPNFANNDENCVTIYK-SMGFWNDINCGVSLPSICKRSANFATSTAAPTTIPKGGCAPEWTSFHGKCYKFVGKDSEKSWHDARQYCISQGGNLVSIRSHAEQAFLTTMMLSASDDM-WIGLNDVNWEMRFLWTDGKGVTFTNWAKGHPVSIPDGRRSYGADSDDFFRPMWEHSRAKRSMWIEEIKFDCVIMVKDPSRMTGMWKVEDCSEKRGFICKRNIDSQIQVQPTTVSSKAYFAMGNNSYKLQTEKMSWDEARRQCKADDADLASVLDTVTEALAMLRFNRFKEPV-WIGLNSNLTSGRYRWVDNWL--LRYTKWAPGEPK--RNLACV--YIDTDGTWKTADCS-NTYFSLCKRSS-EIAPTEPPQLPGNCPEPKRHKTWIPFRGHCYAFLAARSENWAHATVECMRMGASMV----SVEDGLEAAFIQRNLEILQDDSKSFWI-GMHRNHEGEWMWIDNMVVDYTNWAPRMPTA 1344          

HSP 4 Score: 72.4034 bits (176), Expect = 1.323e-12
Identity = 118/551 (21.42%), Postives = 198/551 (35.93%), Query Frame = 3
Query:  117 TYNEALQSCKSRGMRLVRVNSA-EDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRS-ENCINVYRLPSGLWNDITCLARIWAICQ-------KDSEVSTDQ----------LEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPG-GGRVENCAHGYLNYDSLWNDLPCHFNLWVICYRS-----EIRAPGADPN---------------TLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGK--WVDSEENDLKH--KGFHPGEPNGG----------------------------VNENC---LNGYLSLDGLWNDFPCPYKNLFAICAKD--------SLKIKDNENFEIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEG--KWVDSNANVLPYKNWAATEPNGNRGENCIFI 1514
            T+ EA   C++ G  L   +S  E NA+  G +    +D  WI  +       FV S      Y N+   EPN     E+C          WND  C +    ICQ       K     + Q          ++  G+ + ++  +++  DA+ +C      ++ I    +   +         D Y++ G  +  +  +   DG  ++Y ++   EP      ENC   Y +    WND+ C  +L  IC RS        AP   P                  +      ++ +A+ YC +QG  +V   + AE A +       + D+ W+  ND   E +  W D +     +  KG     P+G                             +  +C   +     + G+W    C  K  F IC ++           +     F +  ++  +  E+ +++EA + C+     LA V   V  A LA        +  WI  N +   G  +WVD+   +L Y  WA  EP  N    C++I
Sbjct:  671 TWFEARDYCRAVGGDLASFHSEDETNALPYGGS----SDPAWIGFSSLDTNVGFVWSDETPSNYDNWSYGEPNNYNDIEHCTEASFYYGHRWNDRACESYNDWICQIRLGTTPKAPPTQSPQAKFNITDDGWIQFNGSQYYINTDRLSMDDARAFCKKNHSDLVVITGQTERRFIWKQISRGTEDQYYI-GMTVGLDKSFSWVDGSPVVYTSWDQNEPNFANNDENCVTIYKSM-GFWNDINCGVSLPSICKRSANFATSTAAPTTIPKGGCAPEWTSFHGKCYKFVGKDSEKSWHDARQYCISQGGNLVSIRSHAEQAFLTTMMLSASDDM-WIGLNDVNWEMRFLWTDGKGVTFTNWAKGHPVSIPDGRRSYGADSDDFFRPMWEHSRAKRSMWIEEIKFDCVIMVKDPSRMTGMWKVEDCSEKRGF-ICKRNIDSQIQVQPTTVSSKAYFAMGNNSYKLQTEKMSWDEARRQCKADDADLASVLDTVTEA-LAMLRFNRFKEPVWIGLNSNLTSGRYRWVDN--WLLRYTKWAPGEPKRNLA--CVYI 1208          

HSP 5 Score: 37.7354 bits (86), Expect = 4.915e-7
Identity = 21/82 (25.61%), Postives = 36/82 (43.90%), Query Frame = 3
Query: 1269 TYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENCIFI 1514
            T+++A + C+ +G  L  +    +   ++     ++    WI  N    E  W  SN N   Y NWA   P+   G NC+ +
Sbjct:  240 TWHQARKSCQQQGADLLSIVELHEQTYISGLTN-ILGSALWIGLNSLDFESGWQWSNGNPFRYLNWAPGHPSLEPGLNCVAL 320          

HSP 6 Score: 35.8094 bits (81), Expect = 4.915e-7
Identity = 34/160 (21.25%), Postives = 55/160 (34.38%), Query Frame = 1
Query: 1534 WRDIACTNKYLAIC-------TLNPNAGAKTAD--------------YHFTKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEG--KWVDTNNSTLLYKNFAAEAPNGG--RDKNCLQSFATGLWVDSKCDDFNSVVC 1938
            W  +AC  K   IC       T+ P +G K                 Y   + KM +  A   C   G ++  + N+  +  +   + Y   D  W+  ND   +   +W D  + T   K    E  +    R+   L     G W D  C+  +  +C
Sbjct:  328 WESMACNKKLGYICRKGNSTSTITP-SGVKDQPSFCPTTWVPYSGHCYSIRRNKMMWRDALSACHKDGAELASIHNIEEHSFIISQSGYTPTDEIWIGLNDQKTQNLFEWSDRTHVTFA-KWLVGEPSHATNLREDCVLMKGKDGKWADHMCEKEHDFIC 485          
BLAST of Lectin 2b vs. Ensembl Cavefish
Match: ENSAMXT00000053854.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:24939255:24949357:1 gene:ENSAMXG00000040947.1 transcript:ENSAMXT00000053854.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.4261 bits (215), Expect = 1.943e-18
Identity = 78/301 (25.91%), Postives = 131/301 (43.52%), Query Frame = 3
Query:   96 FVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNA-VVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEP-NGGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVSTDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFA-RETNSD-LYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEP-GGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGADPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRIT 983
             + K    +  + ++C + G  L  V+S+E++  +VN   N   +DS WI G+D   EG +V + G+  +Y  +   EP N G+ ENC+ +     G WND+ C   + ++C K        L+ + + F V      F  ++E C +    +  +    DN  +       TNS+ + W+   D    GKWV +DG    Y  +  G+P     +E C    +NY   WND  C      +C +  I +  A+P+ +   + +L     +D   A  +K V A    E  +  G     T
Sbjct:    1 MIFKNSADWPASEENCVAMGGHLASVHSSEEHTFIVNLVLNASSSDSAWIGGSDTAQEGAWVWTDGSAFSYTYWNKGEPSNYGQWENCMEINY--HGKWNDLYCKLVLPSVCAK---CQDGWLQFKSHCFKVFTTNENFKTSEENCVSAGGHLASMHSNADNVFIKDLVWNTTNSNAVTWIGARDAGQLGKWVWTDGSAFDYSIWSNGQPDKHSPLEQCVE--INYLDQWNDANCDNRHPSVCAK-RITSQSANPSPVRMIHLQLKMTSNEDL-MASNIK-VFAEQLKEKMIKKGLPNNFT 291          

HSP 2 Score: 71.2478 bits (173), Expect = 5.197e-13
Identity = 67/282 (23.76%), Postives = 121/282 (42.91%), Query Frame = 3
Query:  480 VVSKGKMTFADAQEYCSARSLKMIRIGHALDNA-IVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGG-GRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGADPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSD--LYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVN-ENCLN-GYLSLDGLWNDFPCPYKNLFAICAKD--------------SLKIKDNENFEIDMDNMMVSAER 1265
            ++ K    +  ++E C A    +  +  + ++  IV+     ++SD  W+ G+D   EG WV +DG    Y  +  GEP   G+ ENC    +NY   WNDL C   L  +C + +        +          F+ +++ C + G  +   ++ A+N  +       T+   + W+   DA   GKWV ++ +   +  +  G+P+     E C+   YL     WND  C  ++  ++CAK                L++K   N ++   N+ V AE+
Sbjct:    1 MIFKNSADWPASEENCVAMGGHLASVHSSEEHTFIVNLVLNASSSDSAWIGGSDTAQEGAWVWTDGSAFSYTYWNKGEPSNYGQWENCME--INYHGKWNDLYCKLVLPSVCAKCQDGWLQFKSHCFKVFTTNENFKTSEENCVSAGGHLASMHSNADNVFIKDLVWNTTNSNAVTWIGARDAGQLGKWVWTDGSAFDYSIWSNGQPDKHSPLEQCVEINYLD---QWNDANCDNRHP-SVCAKRITSQSANPSPVRMIHLQLKMTSNEDLMASNIKVFAEQ 276          

HSP 3 Score: 63.1586 bits (152), Expect = 2.453e-10
Identity = 57/225 (25.33%), Postives = 96/225 (42.67%), Query Frame = 3
Query:  888 AQDYCKAQGLKMVRANNAAENALVHGFARRITS-DLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEP-NGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKDS---LKIKD--------NENFEIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVAD--YYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRG-ENCIFI 1514
            +++ C A G  +   +++ E+  +       +S D  W+ G+D   EG WV ++ +   +  ++ GEP N G  ENC+   ++  G WND  C    L ++CAK     L+ K         NENF+   +N                C + G  LA ++S  DN  +              WI   D  + GKWV ++ +   Y  W+  +P+ +   E C+ I
Sbjct:   12 SEENCVAMGGHLASVHSSEEHTFIVNLVLNASSSDSAWIGGSDTAQEGAWVWTDGSAFSYTYWNKGEPSNYGQWENCME--INYHGKWNDLYCKLV-LPSVCAKCQDGWLQFKSHCFKVFTTNENFKTSEEN----------------CVSAGGHLASMHSNADNVFIKDLVWNTTNSNAVTWIGARDAGQLGKWVWTDGSAFDYSIWSNGQPDKHSPLEQCVEI 217          
BLAST of Lectin 2b vs. Ensembl Cavefish
Match: mrc2 (mannose receptor, C type 2 [Source:ZFIN;Acc:ZDB-GENE-090915-5])

HSP 1 Score: 90.8929 bits (224), Expect = 2.002e-18
Identity = 108/548 (19.71%), Postives = 204/548 (37.23%), Query Frame = 3
Query:   42 FILITLDSCRSDIDVNTL------FVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVSTDQLEIE------------------GNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGG--GRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGA-------------DPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGK--WVDSEENDLKHKGFHPGEPNGGVNENCL---NGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFEIDMDNMMVSA------------------------ERYTYNEALQFCRTRGTQLARVNSQVDNAML-----AAFAKKVVADYYWI-DGNDHTEEGKWVDSNANVLPYKN 1463
            F  +    C +  D ++L      F  +  ++++EA  SC+ +G  L+ +   E+ + +NG      A + W+  ND    G +  +    L Y N+  ++PN    +NC  +    SG W +  C   +  IC+K    + D    E                     + ++  K+ +  AQ+ C      ++ I H L      +   + + D  W+  +D   +  +  +D   +I+  +   EP       E+C   +   +  WND PC+F+L  IC ++  +  G               P       + +TF  A+  C ++   +V  NN  E A V+      + D +WL  ++    G   W+  EE  L +  ++  +P   +   C+    G+ +  GLW    C       IC +D          +      +                           ++ T+ +A  FCR  G +LA  +   + A +      AF ++   + +WI  G    +   W  S+ + + Y+N
Sbjct:  229 FCPVKSTDCETFWDTHSLMDNCYQFNFQATLSWSEARTSCQQQGADLLSIIKVEEQSYINGLLTGYSA-ALWMGLNDLDLNGGWQWADSAPLKYLNWEADQPNHEEDQNCAVIRTESSGRWQNRDCSVALPYICKKRPNATLDPFTTESWADDGQYQCDLGWQNFQAGCYRLNSDKLDWNSAQKTCQKMDAHLVSI-HTLPELEFITVHMKKDVDELWIGLHDTAMQMNFEWTDRTPVIFTFWHPFEPNNFHNTQEDCVTMW-GPEGRWNDSPCNFSLPSICKKAAQKIDGRIQDHGCRKGWKWHSPACFWVGEEPITFNTARRACASKNSSLVVINNRFEQAFVNSLVFGRSEDHFWLGLHNENSTGPFHWLTGEE--LTYTNWNRDQP-ASIKGGCVAMATGHAT--GLWEVKECSTARSKYICRQDKGSTVPPTPPKPQPTPSLTGTCPSDWKTSGTLRHCYKVFHAGQLEKKLTWIQAHTFCRKHGAELASFSGPDEEAFIFQVLHGAFGEEDDHEQHWIWIGLSRRDSESWTWSDGSAVSYQN 768          

HSP 2 Score: 73.9442 bits (180), Expect = 4.511e-13
Identity = 83/422 (19.67%), Postives = 163/422 (38.63%), Query Frame = 3
Query:  345 ENCINVYRLPSGLWNDIT---CLARIWAIC---QKDSEVSTDQLEIEGNIFVVS-KGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVIC---------------------YRSEIRAPGADPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVN--ENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDN-------ENFEIDMDNMM-VSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRG 1496
             +C +V R    LW   T        W  C     D E   D   +  N +  + +  +++++A+  C  +   ++ I    + + ++      ++ L W+  ND+   G W  +D   L Y N+   +P     +NCA         W +  C   L  IC                     Y+ ++            + D+L +  AQ  C+     +V  +   E   +    ++   +L W+  +D  ++  +  ++   +    +HP EPN   N  E+C+  +   +G WND PC + +L +IC K + KI          + ++        V  E  T+N A + C ++ + L  +N++ + A + +       D++W+  ++    G +       L Y NW   +P   +G
Sbjct:  201 HSCTSVGREDGHLWCATTHDYAKDERWGFCPVKSTDCETFWDTHSLMDNCYQFNFQATLSWSEARTSCQQQGADLLSIIKVEEQSYINGLLTGYSAAL-WMGLNDLDLNGGWQWADSAPLKYLNWEADQPNHEEDQNCAVIRTESSGRWQNRDCSVALPYICKKRPNATLDPFTTESWADDGQYQCDLGWQNFQAGCYRLNSDKLDWNSAQKTCQKMDAHLVSIHTLPELEFITVHMKKDVDEL-WIGLHDTAMQMNFEWTDRTPVIFTFWHPFEPNNFHNTQEDCVTMW-GPEGRWNDSPCNF-SLPSICKKAAQKIDGRIQDHGCRKGWKWHSPACFWVGEEPITFNTARRACASKNSSLVVINNRFEQAFVNSLVFGRSEDHFWLGLHNENSTGPFHWLTGEELTYTNWNRDQPASIKG 618          
BLAST of Lectin 2b vs. Ensembl Cavefish
Match: mrc2 (mannose receptor, C type 2 [Source:ZFIN;Acc:ZDB-GENE-090915-5])

HSP 1 Score: 90.8929 bits (224), Expect = 2.507e-18
Identity = 108/548 (19.71%), Postives = 204/548 (37.23%), Query Frame = 3
Query:   42 FILITLDSCRSDIDVNTL------FVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVSTDQLEIE------------------GNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGG--GRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGA-------------DPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGK--WVDSEENDLKHKGFHPGEPNGGVNENCL---NGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFEIDMDNMMVSA------------------------ERYTYNEALQFCRTRGTQLARVNSQVDNAML-----AAFAKKVVADYYWI-DGNDHTEEGKWVDSNANVLPYKN 1463
            F  +    C +  D ++L      F  +  ++++EA  SC+ +G  L+ +   E+ + +NG      A + W+  ND    G +  +    L Y N+  ++PN    +NC  +    SG W +  C   +  IC+K    + D    E                     + ++  K+ +  AQ+ C      ++ I H L      +   + + D  W+  +D   +  +  +D   +I+  +   EP       E+C   +   +  WND PC+F+L  IC ++  +  G               P       + +TF  A+  C ++   +V  NN  E A V+      + D +WL  ++    G   W+  EE  L +  ++  +P   +   C+    G+ +  GLW    C       IC +D          +      +                           ++ T+ +A  FCR  G +LA  +   + A +      AF ++   + +WI  G    +   W  S+ + + Y+N
Sbjct:  232 FCPVKSTDCETFWDTHSLMDNCYQFNFQATLSWSEARTSCQQQGADLLSIIKVEEQSYINGLLTGYSA-ALWMGLNDLDLNGGWQWADSAPLKYLNWEADQPNHEEDQNCAVIRTESSGRWQNRDCSVALPYICKKRPNATLDPFTTESWADDGQYQCDLGWQNFQAGCYRLNSDKLDWNSAQKTCQKMDAHLVSI-HTLPELEFITVHMKKDVDELWIGLHDTAMQMNFEWTDRTPVIFTFWHPFEPNNFHNTQEDCVTMW-GPEGRWNDSPCNFSLPSICKKAAQKIDGRIQDHGCRKGWKWHSPACFWVGEEPITFNTARRACASKNSSLVVINNRFEQAFVNSLVFGRSEDHFWLGLHNENSTGPFHWLTGEE--LTYTNWNRDQP-ASIKGGCVAMATGHAT--GLWEVKECSTARSKYICRQDKGSTVPPTPPKPQPTPSLTGTCPSDWKTSGTLRHCYKVFHAGQLEKKLTWIQAHTFCRKHGAELASFSGPDEEAFIFQVLHGAFGEEDDHEQHWIWIGLSRRDSESWTWSDGSAVSYQN 771          

HSP 2 Score: 73.559 bits (179), Expect = 4.876e-13
Identity = 84/427 (19.67%), Postives = 165/427 (38.64%), Query Frame = 3
Query:  330 NGGRSENCINVYRLPSGLWNDIT---CLARIWAIC---QKDSEVSTDQLEIEGNIFVVS-KGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVIC---------------------YRSEIRAPGADPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVN--ENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDN-------ENFEIDMDN-MMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRG 1496
            +G    +C +V R    LW   T        W  C     D E   D   +  N +  + +  +++++A+  C  +   ++ I    + + ++      ++ L W+  ND+   G W  +D   L Y N+   +P     +NCA         W +  C   L  IC                     Y+ ++            + D+L +  AQ  C+     +V  +   E   +    ++   +L W+  +D  ++  +  ++   +    +HP EPN   N  E+C+  +   +G WND PC + +L +IC K + KI          + ++        V  E  T+N A + C ++ + L  +N++ + A + +       D++W+  ++    G +       L Y NW   +P   +G
Sbjct:  199 DGQWFHSCTSVGREDGHLWCATTHDYAKDERWGFCPVKSTDCETFWDTHSLMDNCYQFNFQATLSWSEARTSCQQQGADLLSIIKVEEQSYINGLLTGYSAAL-WMGLNDLDLNGGWQWADSAPLKYLNWEADQPNHEEDQNCAVIRTESSGRWQNRDCSVALPYICKKRPNATLDPFTTESWADDGQYQCDLGWQNFQAGCYRLNSDKLDWNSAQKTCQKMDAHLVSIHTLPELEFITVHMKKDVDEL-WIGLHDTAMQMNFEWTDRTPVIFTFWHPFEPNNFHNTQEDCVTMW-GPEGRWNDSPCNF-SLPSICKKAAQKIDGRIQDHGCRKGWKWHSPACFWVGEEPITFNTARRACASKNSSLVVINNRFEQAFVNSLVFGRSEDHFWLGLHNENSTGPFHWLTGEELTYTNWNRDQPASIKG 621          
BLAST of Lectin 2b vs. Ensembl Sea Lamprey
Match: mrc2 (mannose receptor, C type 2 [Source:ZFIN;Acc:ZDB-GENE-090915-5])

HSP 1 Score: 67.3958 bits (163), Expect = 8.978e-12
Identity = 84/412 (20.39%), Postives = 152/412 (36.89%), Query Frame = 3
Query:  411 IWAICQ---KDSEVSTDQLEIEGNIFVVS-KGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYR----SEIRAPGAD----PNTLIASY------------DRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSD--LYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFE----------IDMDN---MMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYW--IDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENCIFILLR 1523
            +W  C     D  V  D   +  N +  +    +++ +A+  C  +   ++ I    +   +  F     + + W+  ND+ ++G W  SDG  L   N+  G P     +NCA     + S W    C   L  +C +    + I+ P       P      +            ++ T+Q+A   C+  G  ++  +  A+   V    + + SD    WL  ND K +  +  S+   +    +HP  PN    E C++ +   +G W D PC  K      A  SL     ++ E           D+ N    ++  E   +  A   C  +   L  V S+ + A +++     V D +W  +      +  +W+      + + NW   EP    G   +  L R
Sbjct:  180 LWGFCPVKLPDCSVFWDTDPVTRNCYQFNVHAVLSWHEARTSCLQQGSDLLSITEMHEQTYIAGFLSGFGA-IMWIGLNDLDSDGGWQWSDGSPLKLLNWDQGHPSETDGQNCALLRAEFFSKWQTKECAAALPYVCKKRLNITSIQIPNESWENRPTVCPRGWVPFNGSCFWRDAEKRTWQDALARCRLGGGDLLSLHGLAD---VDFLVQHVLSDGEEVWLGLNDLKTKMVFEWSDFTPVTFTFWHPRHPNSRPGEGCVSLW-GKEGRWKDGPCDAKKASVCRAPGSLSEAQPDSQEGGTPTECPKGWDLHNGFCYLIGEELTDFQNAWTRCSQQQATLVSVTSRFEQAFVSSLVGPRVGDSFWTSLRNTGGLDSFRWL--GGEHVTFTNWNRNEPGWKPGSLLVGSLTR 584          

HSP 2 Score: 58.9214 bits (141), Expect = 3.687e-9
Identity = 106/545 (19.45%), Postives = 191/545 (35.05%), Query Frame = 3
Query:   42 FILITLDSCRSDIDVNTL------FVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVSTDQL---EIEGNIFVVSKGKMTF------ADAQEYCSARSLKMIRIG-------HAL---DNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGA------------DPNTLIASYD-----------RLT-FQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLD-GNDAKLEG-KWVDSEENDLK-----HKGFHPGEPNGGVNENCLN---GYLSLDGLWND-FP-------CPYKNLFAICAKDSLKIKDNENFEIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVAD-------YYWIDGNDH----TEEGKWVDSNA 1442
            F  + L  C    D + +      F    +++++EA  SC  +G  L+ +    +   + GF +   A   WI  ND  ++G +  S G+ L   N+    P+    +NC  +       W    C A +  +C+K   +++ Q+     E    V  +G + F       DA++     +L   R+G       H L   D  + H     ++ +  W+  ND+ T+  +  SD   + +  +    P     E C   +   +  W D PC      +C     RAPG+             P      +D            LT FQ A   C  Q   +V   +  E A V         D +W    N   L+  +W+  E            G+ PG    G    CL+    Y++     ++ +P       C  K +        +++     F + + +   +    ++ EA  +CR  G  L  +    +   ++   + ++ +       + WI  N       +  KW D  A
Sbjct:  183 FCPVKLPDCSVFWDTDPVTRNCYQFNVHAVLSWHEARTSCLQQGSDLLSITEMHEQTYIAGFLSGFGA-IMWIGLNDLDSDGGWQWSDGSPLKLLNWDQGHPSETDGQNCALLRAEFFSKWQTKECAAALPYVCKKRLNITSIQIPNESWENRPTVCPRGWVPFNGSCFWRDAEKRTWQDALARCRLGGGDLLSLHGLADVDFLVQHVL---SDGEEVWLGLNDLKTKMVFEWSDFTPVTFTFWHPRHPNSRPGEGCVSLW-GKEGRWKDGPCDAKKASVC-----RAPGSLSEAQPDSQEGGTPTECPKGWDLHNGFCYLIGEELTDFQNAWTRCSQQQATLVSVTSRFEQAFVSSLVGPRVGDSFWTSLRNTGGLDSFRWLGGEHVTFTNWNRNEPGWKPGSLLVGSLTRCLSVLWSYITESQYSSEIYPLMPRCSACILKWMGGCLHGSVMEVASLSYFCLQLLHFADAGNMKSWEEADGYCRELGATLLSLRDPAEGRAVSTLIRGLLGESGEQNERWLWIGLNSRNPGLIKSWKWSDGTA 717          
BLAST of Lectin 2b vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005222.1 (pep scaffold:Pmarinus_7.0:GL492592:1201:2726:-1 gene:ENSPMAG00000004753.1 transcript:ENSPMAT00000005222.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.2326 bits (147), Expect = 1.499e-11
Identity = 41/105 (39.05%), Postives = 54/105 (51.43%), Query Frame = 3
Query:  120 YNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLL-TYKNFGTNEPNG-GRSENCINVYRLPSGLWNDITCLARIWAICQ 428
            Y+ A Q C + G  L    +A  NA   G    V  D  +I  ND   E  FV S G+ L  Y+NF   EPN  G  E+C+N+Y  P+G WNDI C  ++  IC+
Sbjct:   36 YHSARQQCANHGGVLAMPKNAIQNA---GIQQVVRGDRAFIGLNDIQHENNFVFSDGSRLGLYRNFALGEPNSFGGDEDCVNIY--PNGKWNDIGCHTQLHFICE 135          

HSP 2 Score: 50.447 bits (119), Expect = 9.343e-8
Identity = 35/104 (33.65%), Postives = 52/104 (50.00%), Query Frame = 3
Query:  504 FADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDL-IYKNFPVGEPGG-GRVENCAHGYLNYDSLWNDLPCHFNLWVIC 809
            +  A++ C+     +    +A+ NA +    R    D  ++  NDI  E  +V SDG  L +Y+NF +GEP   G  E+C + Y N    WND+ CH  L  IC
Sbjct:   36 YHSARQQCANHGGVLAMPKNAIQNAGIQQVVR---GDRAFIGLNDIQHENNFVFSDGSRLGLYRNFALGEPNSFGGDEDCVNIYPN--GKWNDIGCHTQLHFIC 134          
BLAST of Lectin 2b vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003237.1 (pep scaffold:Pmarinus_7.0:GL486820:4307:11265:1 gene:ENSPMAG00000002956.1 transcript:ENSPMAT00000003237.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.5286 bits (127), Expect = 1.656e-8
Identity = 35/117 (29.91%), Postives = 59/117 (50.43%), Query Frame = 3
Query: 1257 AERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNG--NRGENCIFILLRRRDMEGYCMHQ*IPCYLYLKPKCRSQ 1601
            AER  + EA + CR+ G  LA + S+ +N  + A      +DY WI  ND   EG +  S+ + L +++W   +P+   + GE+C+ ++      EG      +PC  +L   C +Q
Sbjct:   18 AERLPWAEAEEACRSVGGHLASIASRDENNFILALG----SDYQWIGLNDRFSEGDFHWSDGSQLSFEHWRPQQPDSFFSSGEDCVVLIWHE---EGEWND--VPCTYHLPFCCETQ 125          

HSP 2 Score: 48.1358 bits (113), Expect = 1.233e-6
Identity = 28/105 (26.67%), Postives = 52/105 (49.52%), Query Frame = 3
Query:  120 YNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNG--GRSENCINVYRLPSGLWNDITCLARIWAICQ 428
            + EA ++C+S G  L  + S ++N  +        +D  WI  ND  +EG F  S G+ L+++++   +P+      E+C+ +     G WND+ C   +   C+
Sbjct:   23 WAEAEEACRSVGGHLASIASRDENNFILALG----SDYQWIGLNDRFSEGDFHWSDGSQLSFEHWRPQQPDSFFSSGEDCVVLIWHEEGEWNDVPCTYHLPFCCE 123          

HSP 3 Score: 45.8246 bits (107), Expect = 7.872e-6
Identity = 29/102 (28.43%), Postives = 49/102 (48.04%), Query Frame = 3
Query:  867 DRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNG--GVNENCLNGYLSLDGLWNDFPCPY 1166
            +RL + EA++ C++ G  +    +  EN     F   + SD  W+  ND   EG +  S+ + L  + + P +P+      E+C+      +G WND PC Y
Sbjct:   19 ERLPWAEAEEACRSVGGHLASIASRDEN----NFILALGSDYQWIGLNDRFSEGDFHWSDGSQLSFEHWRPQQPDSFFSSGEDCVVLIWHEEGEWNDVPCTY 116          
BLAST of Lectin 2b vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009130.1 (pep scaffold:Pmarinus_7.0:GL477920:28989:31537:1 gene:ENSPMAG00000008249.1 transcript:ENSPMAT00000009130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 44.2838 bits (103), Expect = 5.059e-6
Identity = 29/98 (29.59%), Postives = 46/98 (46.94%), Query Frame = 3
Query: 1227 EIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWV-DSNANVLP--YKNWAATEP-NGNRGENCI 1508
            E +    ++  E   Y+EA   CR+RG  LA    +  NA+LAA+         +I  +D   EG +  +  A++ P  +  W   EP N   GE+C+
Sbjct:  152 ETERKMYLLVREERAYSEAALHCRSRGGLLAMPRDETTNALLAAYVSHAGLARVFIGLHDGLREGAFTYEDGASLGPTAFTRWRPGEPNNAFGGEDCV 249          

HSP 2 Score: 23.483 bits (49), Expect = 5.059e-6
Identity = 7/16 (43.75%), Postives = 10/16 (62.50%), Query Frame = 1
Query: 1528 GTWRDIACTNKYLAIC 1575
            G W D++CTN    +C
Sbjct:  255 GGWNDVSCTNTMYFVC 270          
BLAST of Lectin 2b vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004475.1 (pep scaffold:Pmarinus_7.0:GL476717:437869:441498:1 gene:ENSPMAG00000004073.1 transcript:ENSPMAT00000004475.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 45.0542 bits (105), Expect = 8.788e-6
Identity = 36/112 (32.14%), Postives = 56/112 (50.00%), Query Frame = 3
Query:   84 VNTLFVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFA---NKVLADSYWIDGNDETAEGIFVNSKGNLLT-YKNFGTNEP-NGGRSENCINVYRLPSGLWNDITCL 404
            V T  V +T  T+NEAL +C+  G +L+ +NSA D   V   A   N+V+   +WI  +D+  +G    S G  ++ + N+  N P N     +C  +Y   SG W    C+
Sbjct:   41 VVTSLVRRT--TWNEALFTCQRVGAQLLSINSARDLEWVCCVATANNRVV--DFWIGASDKERDGEMKWSDGTAVSGFTNWAANHPRNTPGRWDCGQIYTGESGKWETTDCI 148          
BLAST of Lectin 2b vs. Ensembl Nematostella
Match: EDO49509 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGD7])

HSP 1 Score: 102.834 bits (255), Expect = 1.746e-22
Identity = 124/535 (23.18%), Postives = 220/535 (41.12%), Query Frame = 3
Query:  117 TYNEALQSCKSRGMRLVRVNSAEDNAVV-NGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGR-SENCINVYRLPSGLWNDITCLARIWAICQKDSE----VSTDQ--------------LEIEGNIF-VVSKGKMTFADAQEYC-----SARSLKMIRIGHALDNAIVHSFARE-TNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCA--HGYLNYDSLWNDLPCHFNLWVICYRSEIR------APGADPN-----------TLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENA-LVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKH--KGFHPGEPNGGVNENCLNGYLSL--DGLWNDFPCPYKNLFAICAKDSLKIKDNENFEIDMDNMMVSA--------------ERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRG-ENCIFILLR 1523
            T+ +A  +C+  G  L+ + SA +NA V +GF  K  + + WI  ND   E ++  S G+ L+Y N+   EPN  +  E+C+ + R  +G WND  C  +   IC+K +     +ST                L  + + +  V+  +  +A+A+  C     S+    ++ I +  + A + S     T+   +W+  NDI TEG +  +D   + Y N+   +P      +C            W   PC + +  IC  + +       AP ++P+               SY +L + EA++ CK +G  +V  ++A E A L+      + +    +      +E  W D    +  H  +G  PG P  G  + C+    S   D  W+   C  +N F +C  +    K   +    +D   +                 R T+ +A   C+  G  L  + SQ +   L    K V   + W   ND + E  +  S+ + + + +W   +PN + G +NC+ +  R
Sbjct: 1369 TWQDARAACQQAGAELISIQSAAENAFVYSGFRAKYRSWTIWIGLNDLDDESVYEWSDGSPLSYTNYNWKEPNDWQGQEDCLEMVRW-NGKWNDNQCNRKNPYICKKQNNSVPIISTPSPTPGPALGRCNSGWLHYDKSCYKFVATERQNWANARLRCDRGTNSSMYGDLVTIDNQYEQAFISSMMLSYTSKPRFWIGMNDIHTEGAFYWADNSPVRYTNWNTRQPMNRANLDCVDIEPRSWAAGKWAVRPCSWRVGYICESAALPIGPTAVAPTSNPDCPRFYSKYGDSCYRMSYIKLPWSEAREVCKKEGGDLVSIHSAFEQAFLLRNMINFVGNVWTGMTRMPNTVEFTWSDQSVKEFSHWSRG-QPGRP--GTTQMCVQAINSANSDARWSAVDCGVQNGF-MCKIN----KGEPHITPTVDGKCLPGFKRFDKHCYLFRMFHRLTWPQARLRCQREGGDLVSILSQQEKDFLIYQMKTVNGIWIWTGLNDRSVERGYEWSDGSPVSFTSWLYGQPNDHWGRDNCVAVQTR 1894          

HSP 2 Score: 81.6481 bits (200), Expect = 7.784e-16
Identity = 106/472 (22.46%), Postives = 192/472 (40.68%), Query Frame = 3
Query:   21 LFTVLTIFIL---ITLDSCRSDIDVNT----LFVTKTL----VTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEV----------STDQLEIEGNI---------FVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWV-DSDGKDLIYKNFPVGEPG--GGRVENCAHGYLNY-DSLWNDLPCHFNLWVICYRS-----------EIRAPGADPNTLIASYDRLTFQEAQDYCK------AQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYL----SLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFEIDMDNMMVSAERYT 1271
            +F  L + IL   ++  +C++  +  +    LFV ++     +++ +A   C+S G RL  +    + + +     +   + +WI  ND  +EG F    G+  ++KN+   EPN  ++E+C       +G WND  C      IC++ +             T Q  I  +          +  +  + T++ A+  C      ++++  A +   + S+   T S   W+   D   EG +V + DG  + Y N+  GEP    G+ E+C      Y    WND  C      IC +             I     + NT  A   +LT+ +AQD C+         ++ +   NA  + L    AR +     W+  ND   EG +V S+   + +  + P EP  G   +  +  +    S +G W+  PC  K  + +C +   + +D  +    M N M+   + T
Sbjct:    8 VFLSLCVLILAPEVSHGACQAGWESYSSYCYLFVVRSQSQIGLSWEDADIDCQSYGGRLTSILDRNEQSFITRSTIRYRNERFWIGFNDRGSEGNFSWVDGSNSSFKNWRKGEPNNWQNEDCAEAV-WNTGQWNDELCSNTYGYICKRLASAPWPTQGTMVPPTTQSPIVCDFGWEFFGTSCYKFNTARKTWSMAKADCHGAGGYLVKVDDATEQNFL-SYRSRTISQSMWIGATDEAAEGHFVWEGDGTVVNYTNWFRGEPNDHSGK-EDCVEMMAGYFAGYWNDNFCEQFRNFICEKPFGENLCPVNWVTIGDSCFEFNTHPA--QKLTWSQAQDSCRLNSGADLASVRTIDEQNAILSQLTDFGARNV-----WIGFNDIATEGVFVWSDRTKVDYTNWSPREPGSGTLADSKDCVVLEAGSQNGTWSSTPCALKTTY-LCRRR--RGRDQCDSPFGMQNNMIDDSQIT 466          

HSP 3 Score: 78.9518 bits (193), Expect = 4.806e-15
Identity = 99/417 (23.74%), Postives = 169/417 (40.53%), Query Frame = 3
Query:  474 IFVV---SKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGADPNTLIASYD-----------------------RLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWV-DSEENDLKHKGFHPGEPN-GGVNENC---LNGYLSLDGLWNDFPC-PYKNLFA-------ICAKDSLKIKDNENFEIDMDNMMVSAERYTYNEALQFCR-TRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEP-NGNRGENCIFILLRRRDMEGYCMHQ*IPCYLYLKPKCRSQ 1601
            +FVV   S+  +++ DA   C +   ++  I    + + +        ++ +W+  ND  +EG +   DG +  +KN+  GEP   + E+CA    N    WND  C      IC R    AP     T++                           R T+  A+  C   G  +V+ ++A E   +   +R I+  + W+   D   EG +V + +   + +  +  GEPN     E+C   + GY +  G WND  C  ++N          +C  + + I D+  FE +       A++ T+++A   CR   G  LA V +  +   + +      A   WI  ND   EG +V S+   + Y NW+  EP +G   ++   ++L      G       PC L     CR +
Sbjct:   39 LFVVRSQSQIGLSWEDADIDCQSYGGRLTSILDRNEQSFITRSTIRYRNERFWIGFNDRGSEGNFSWVDGSNSSFKNWRKGEPNNWQNEDCAEAVWN-TGQWNDELCSNTYGYICKRLA-SAPWPTQGTMVPPTTQSPIVCDFGWEFFGTSCYKFNTARKTWSMAKADCHGAGGYLVKVDDATEQNFLSYRSRTISQSM-WIGATDEAAEGHFVWEGDGTVVNYTNWFRGEPNDHSGKEDCVEMMAGYFA--GYWNDNFCEQFRNFICEKPFGENLCPVNWVTIGDS-CFEFNTH----PAQKLTWSQAQDSCRLNSGADLASVRTIDEQNAILSQLTDFGARNVWIGFNDIATEGVFVWSDRTKVDYTNWSPREPGSGTLADSKDCVVLEAGSQNGTWSS--TPCALKTTYLCRRR 443          

HSP 4 Score: 53.1434 bits (126), Expect = 3.690e-7
Identity = 81/403 (20.10%), Postives = 156/403 (38.71%), Query Frame = 3
Query:  336 GRSENCINVYRLPSGLWNDITCLARIWAICQKDSEV-STDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNA-IVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGG-RVENCAHGYLNYDSL--WNDLPCHFNLWVICYRSEIRAPGADPNTLIASYDRLTFQEAQD--YCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCP----YKNLFAICAKDSLKIKD-NENFEIDMDN---MMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAA-FAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRG 1496
            GR++   + Y    G+WN +     + AI   +  V  T   E     +  +  K  +  A+  C  R  +++ I   ++ A I         S   W+  +D   E  W  SDG  + + N+   +P      E+CAH Y    ++  WND+ C+ N+  IC R +   P A  +   A   +   +   D   C +  +  V+  N             +T  ++                 +   K +    G P   VN          + L+   PCP    Y ++  +C + ++  +     ++   D      ++ ++ T+ +A   CR +G +LA +++  ++A++ +       A   WI   D  + G +  ++ + + + NW   EPN +RG
Sbjct:  907 GRAKLPGSFYMRGLGIWNRVLSSQEVSAIFISEFGVCRTGWKEYGQYCYQFNSDKRNWQSARLMCQNRGGELVSILSPVEQAHITLEVGFFGLSTFAWIGFHDKTIESAWEWSDGSPVRFTNWWNYQPDNWINSEDCAHTYHQTSAMGRWNDISCYTNMAYICKRDKEYNPSAPVSPTTAPRQQNICEWTSDALSCPSSTVISVQKANYGRTDRQPCGPISVTGCVF-----------------DVTAKLQAMCDGNPYCSVNPT--------NQLFGKDPCPTVRKYLDVTFVCKRGAVVTQGCPAGWQRSPDGNACYGLTLDKKTWPDARDSCRAQGAELASIHTGWESALVTSLLVTSWDAGDVWIGLTDTNQRGIYRWTDGSPVDWTNWWNGEPN-DRG 1283          

HSP 5 Score: 52.7582 bits (125), Expect = 5.284e-7
Identity = 28/109 (25.69%), Postives = 58/109 (53.21%), Query Frame = 1
Query: 1621 TKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEG--KWVDTNNSTLLYKNFAAEAPNGGRDKNCLQS-FATGLWVDSKCDDFNSVVC 1938
            +++ +++E A + C+S G ++  + + N    +  S    + + +W+  ND   EG   WVD +NS+  +KN+    PN  ++++C ++ + TG W D  C +    +C
Sbjct:   46 SQIGLSWEDADIDCQSYGGRLTSILDRNEQSFITRSTIRYRNERFWIGFNDRGSEGNFSWVDGSNSS--FKNWRKGEPNNWQNEDCAEAVWNTGQWNDELCSNTYGYIC 152          

HSP 6 Score: 49.2914 bits (116), Expect = 6.187e-6
Identity = 36/113 (31.86%), Postives = 57/113 (50.44%), Query Frame = 3
Query:  120 YNEALQSCKSRGMRLVRVNSAEDNAVVN---GFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEP-NGGRSENCINVYRLPS--GLWNDITCLARIWAICQKDSE 440
            +  A   C++RG  LV + S  + A +    GF    L+   WI  +D+T E  +  S G+ + + N+   +P N   SE+C + Y   S  G WNDI+C   +  IC++D E
Sbjct:  964 WQSARLMCQNRGGELVSILSPVEQAHITLEVGFFG--LSTFAWIGFHDKTIESAWEWSDGSPVRFTNWWNYQPDNWINSEDCAHTYHQTSAMGRWNDISCYTNMAYICKRDKE 1074          
BLAST of Lectin 2b vs. Ensembl Nematostella
Match: EDO49512 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGE1])

HSP 1 Score: 83.1889 bits (204), Expect = 2.005e-16
Identity = 124/559 (22.18%), Postives = 208/559 (37.21%), Query Frame = 3
Query:   99 VTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVV-NGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRS-ENCINVYRLPSGLWNDITCLARIWAICQKDSEVSTDQLEI-------------EGNI--------FVVSKGKMTFADAQEYCSARSLKMIRIGH--ALDNAIVHSFARE---TNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSL--WNDLPCHFNLWVICYRSEIR-------------APGA----DPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALV------------HGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCL--NGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFEIDMDNMMVSAERY-----------TYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRG-ENCIFILLRRRDMEGYCMHQ 1556
             T  L T+ EA   C+     LV + +A +NA V +    +    + WI  ND   EG+   S G+ ++Y N+G  EPN     E+C  + R   G WND  C  +   +C+K +        +              G I        FV  + +  + +A+  CS + L     GH   ++N    +F      +N    W+  ND+ TEG +   D   + Y N+  G+PG     +C     +  SL  W+   C      +C    +               P        +  +  Y++L ++EA + C+  G +++  +   E A +             G  R   S ++       K    W   +          PG+P  G ++ C+  N  ++ +G W+   C  KN F +C     +     +   +     V  +++           T+++A   C  +G  L  + +Q +   L  +  K      WI  ND   EG W  S+ + L Y  W   EPN   G ENC  ++   R    Y   Q
Sbjct: 1350 TTADLKTWMEARDFCRKSRGDLVSLRTANENAFVFSEIKTRYYYWTVWIGLNDLGTEGVNTWSDGSPMSYINWGNKEPNNWNGMEDCGEMSRF-DGRWNDQNCNLKRTFVCRKHNNTIFPPFTMIPPSPGPAVGKCDSGWINYDKSCYKFVFDQ-RQNWVNAESVCS-QGLNSTNSGHLVVINNLYEQAFLTTMLASNRGNVWIGLNDLHTEGTFGWVDYSSVAYTNWIAGKPGWSYWADCVGMSTSSSSLGEWDVEVCSGFQGYVCETDALPLGPTTAPPTPSPDCPSGYSKYGESCYLMYYNKLNWKEAGEVCQKDGAQLISIHGVKEQAYMIKNLKDLVGNVWTGMVRMPNSLMFTWSDQSVKQYTNWARGQ----------PGQP--GTSQTCVQVNNSITSNGRWSAVDCGLKNSF-MCKIYKGEPHVTPSLLGECQPGWVKFDKFCYLFSGISAYVTWSQARSTCTRQGADLVSILNQEEQDFL-IYQSKSSYRSIWIGLNDRNIEGGWQWSDGSPLAYVAWNGGEPNDLVGVENCGEMVAGNRLWNDYSCSQ 1891          

HSP 2 Score: 78.1814 bits (191), Expect = 7.088e-15
Identity = 90/382 (23.56%), Postives = 159/382 (41.62%), Query Frame = 3
Query:  477 FVVS----KGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGK--WVDSDGKDLIYKNFPVGEPGGGRV-ENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAP----------GADPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWV---DSEENDLKHKGFHPGEPNGGVN-ENCLNGYL-SLDGLWND--------FPCPYKNLFAICAKDSLKIKDN-ENFEIDMDNMMVSAERYTYNEALQFCRTR--GTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPN--GNRGENCIFIL 1517
            F+VS    +G+ ++ +A+  C +    +  I    +   +    ++  ++ +WV  ND   E    W D   K   Y N+  GEP   +  E+C    L  D LWND  C      IC    ++AP          GA       S    T+  AQ  C   G  +V+ +N+ E   +    + +     W+  ND  +EG +V   D+ +    +  ++ GEPN   + E+C++ Y  SL G WND        + C   N  ++C  + +  KD+  +F          A+  T+ +A   C+    G+ L  +  + +   +        +   W+  ND   EG +V S+ + + Y NW   EP+  G+   +C+ ++
Sbjct:   39 FIVSSLTVRGQ-SWENAENLCQSYGGHLASISDQSEQNFITGRIKQYTNEHFWVGFNDRANESSYNWTDGTAKPF-YTNWRRGEPNNFQDNEDCTE-LLYQDGLWNDDDCSKEYSFIC--KTLKAPLSCDAGWSQYGASCYKFSTS--SKTWLIAQQDCHQSGGYLVKVDNSDEQHFLSYMMKTVMKQAAWIGLNDRAIEGTYVWEGDNTKLGQNYSHWYSGEPNDHASVEDCISMYSGSLGGFWNDDYCDTLRAYVCEKPNGQSLCPVNWVPYKDSCYHFNTHQ------AQLVTWEKAYNVCQAAMPGSDLLSILEKDEQQFIEQVLSDRKSGDIWLGLNDRVSEGTFVWSDRSPVNYTNWGQYEPSKYGSDSRDCVSLI 407          

HSP 3 Score: 60.8474 bits (146), Expect = 1.533e-9
Identity = 94/467 (20.13%), Postives = 183/467 (39.19%), Query Frame = 3
Query:   96 FVTKTLVTYNEALQS----CKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLT-YKNFGTNEPNGGR-SENCINVYRLPSGLWNDITCLARIWAICQK-DSEVSTDQ--LEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWV-DSDGKDLI--YKNFPVGEPG-GGRVENCAHGYL-NYDSLWNDLPCHFNLWVICYRSEIRA-------PGADPNTLIASYDR--LTFQEAQDYCKA--QGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPN--GGVNENCLN--GYLSL-DGLWNDFPCPYKNLFAICAKDSLKIKDNENF---EIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWID 1397
            F+  +L    ++ ++    C+S G  L  ++   +   + G   +   + +W+  ND   E  +  + G     Y N+   EPN  + +E+C  +     GLWND  C      IC+   + +S D    +   + +  S    T+  AQ+ C      ++++ ++ +   +    +       W+  ND   EG +V + D   L   Y ++  GEP     VE+C   Y  +    WND  C      +C +   ++       P  D      ++    +T+++A + C+A   G  ++      E   +        S   WL  ND   EG +V S+ + + +  +   EP+  G  + +C++   +     G W    C   N + +C K     K +  F   +  +D+ +++A          F R       R+ S+  ++     AK  + +Y  +D
Sbjct:   39 FIVSSLTVRGQSWENAENLCQSYGGHLASISDQSEQNFITGRIKQYTNEHFWVGFNDRANESSYNWTDGTAKPFYTNWRRGEPNNFQDNEDCTELL-YQDGLWNDDDCSKEYSFICKTLKAPLSCDAGWSQYGASCYKFSTSSKTWLIAQQDCHQSGGYLVKVDNSDEQHFLSYMMKTVMKQAAWIGLNDRAIEGTYVWEGDNTKLGQNYSHWYSGEPNDHASVEDCISMYSGSLGGFWNDDYCDTLRAYVCEKPNGQSLCPVNWVPYKDSCYHFNTHQAQLVTWEKAYNVCQAAMPGSDLLSILEKDEQQFIEQVLSDRKSGDIWLGLNDRVSEGTFVWSDRSPVNYTNWGQYEPSKYGSDSRDCVSLIPWTPFGSGDWGTVSCTTTNAY-VCKKTRASSKCDAPFGLADYTIDDSLLTASSSDRTSVPAFARL------RLQSKPGSSGAWCSAKNTLGEYLQVD 497          

HSP 4 Score: 59.6918 bits (143), Expect = 4.256e-9
Identity = 60/267 (22.47%), Postives = 105/267 (39.33%), Query Frame = 3
Query:  495 KMTFADAQEYCSARSLKMIRIGHALDNA-IVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRV-ENCAHGYLNYDSL--WNDLPCHFNLWVICYRSEIRAP-GADPNTLIAS-----------------------YDRLTFQEAQDYCKAQGLKMVRANNAAENALVHG-FARRITSDLYWLDGNDAKLEG--KWVDSEENDLKHKGFHPGEPNG-GVNENCLNGYLSLDG----LWNDFPCPYKNLFAIC 1187
            K +++ A++ C A    ++ I   ++ A I     +    +  W+  +D   E  W  SDG  + + N+   +P      E+CAH Y    ++  WND+PC+     IC   +   P G   N    +                        D+ T+ +A+D C+AQG ++   +   E+ALV         +   W+   D    G  +W D    D  H  +  GEPN  G+  +C+   +++       W D  C   +   +C
Sbjct:  952 KKSWSAARQQCQANGGDLVSIQSPVEQAHITLEVGQFGVREYAWIGLHDESVESAWEWSDGSPVRFTNWYNNQPDNWLAQEDCAHTYHEPHAVGRWNDMPCYSGNSYICKAKKAYVPFGGSVNPTTGTVVTPGCPVGWKRSPDGNVCYGLILDKKTWPDARDSCRAQGAELASIHTGWESALVTSLLVTSWDAGDVWIGLTDTNQRGMYRWTDGSPVDWTH--WWNGEPNDRGITGSCVRATMTVSSRDWMYWVDSDCTENSHAYVC 1216          

HSP 5 Score: 54.6842 bits (130), Expect = 1.462e-7
Identity = 53/225 (23.56%), Postives = 99/225 (44.00%), Query Frame = 3
Query:  117 TYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSY-WIDGNDETAEGIFVNSKGNLLTYKNFGTNEP-NGGRSENCINVYRLPS--GLWNDITCLARIWAICQKD--------------SEVSTDQLEI------EGNI-FVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARET-NSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEP 713
            +++ A Q C++ G  LV + S  + A +     +     Y WI  +DE+ E  +  S G+ + + N+  N+P N    E+C + Y  P   G WND+ C +    IC+                  V T    +      +GN+ + +   K T+ DA++ C A+  ++  I    ++A+V S    + ++   W+   D    G +  +DG  + + ++  GEP
Sbjct:  954 SWSAARQQCQANGGDLVSIQSPVEQAHITLEVGQFGVREYAWIGLHDESVESAWEWSDGSPVRFTNWYNNQPDNWLAQEDCAHTYHEPHAVGRWNDMPCYSGNSYICKAKKAYVPFGGSVNPTTGTVVTPGCPVGWKRSPDGNVCYGLILDKKTWPDARDSCRAQGAELASIHTGWESALVTSLLVTSWDAGDVWIGLTDTNQRGMYRWTDGSPVDWTHWWNGEP 1178          

HSP 6 Score: 49.6766 bits (117), Expect = 4.771e-6
Identity = 40/154 (25.97%), Postives = 69/154 (44.81%), Query Frame = 1
Query: 1522 EEGTWRDIACTNKYLAIC-----TLNPNAGAK---TADYHFTKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKN----FAAEAPNGGRDKNCLQSFA---TGLWVDSKCDDFNSVVC 1938
            ++G W D  C+ +Y  IC      L+ +AG      + Y F+    T+  A   C   G  +V+V N +    L+   K +   + W+  ND A EG +V   ++T L +N    ++ E  +    ++C+  ++    G W D  CD   + VC
Sbjct:  136 QDGLWNDDDCSKEYSFICKTLKAPLSCDAGWSQYGASCYKFSTSSKTWLIAQQDCHQSGGYLVKVDNSDEQHFLSYMMKTVMKQAAWIGLNDRAIEGTYVWEGDNTKLGQNYSHWYSGEPNDHASVEDCISMYSGSLGGFWNDDYCDTLRAYVC 289          
BLAST of Lectin 2b vs. Ensembl Nematostella
Match: EDO38432 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD09])

HSP 1 Score: 61.2326 bits (147), Expect = 2.271e-11
Identity = 31/111 (27.93%), Postives = 58/111 (52.25%), Query Frame = 3
Query:   99 VTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQK 431
            +    ++Y++A + CK RG  L  V  A +++ +    +      Y+I   DE  E +FV   G   +Y ++G ++P+G  +ENC+ ++   S  + DI+C   +  IC+K
Sbjct:   17 LASPFLSYDQAREDCKGRGANLTDVQDANEHSFLKRHISPDANIGYFIGLTDEAEEEVFVWQDGKKASYLDWGLSDPSGSTNENCVALHSSSSFKFVDISCADSLGHICKK 127          
BLAST of Lectin 2b vs. Ensembl Nematostella
Match: EDO31778 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWZ4])

HSP 1 Score: 53.9138 bits (128), Expect = 6.715e-9
Identity = 28/108 (25.93%), Postives = 56/108 (51.85%), Query Frame = 3
Query:  465 EGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGY-LNYDSLWNDLPC 785
            +G  +  S   +T+  A+  C+  S  ++ + +  +N  +    ++ N +  WV  +D+ TEG++V +DG    + N+   +P   + ++C H   +NY   WND+PC
Sbjct:    5 KGYCYKTSNTCLTWKRAESACAVMSSGLVSVHNHEENVFIQ---QQHNGEKSWVGLSDVTTEGQFVWADGSPTNFTNWAPNQPNDYKNQDCVHTLGVNYGYKWNDVPC 109          

HSP 2 Score: 51.6026 bits (122), Expect = 3.699e-8
Identity = 29/104 (27.88%), Postives = 53/104 (50.96%), Query Frame = 3
Query:   99 VTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGL-WNDITCLA 407
             + T +T+  A  +C      LV V++ E+N  +    N    +  W+  +D T EG FV + G+   + N+  N+PN  ++++C++   +  G  WND+ C A
Sbjct:   11 TSNTCLTWKRAESACAVMSSGLVSVHNHEENVFIQQQHN---GEKSWVGLSDVTTEGQFVWADGSPTNFTNWAPNQPNDYKNQDCVHTLGVNYGYKWNDVPCTA 111          
BLAST of Lectin 2b vs. Ensembl Nematostella
Match: EDO26420 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TC24])

HSP 1 Score: 52.7582 bits (125), Expect = 2.349e-8
Identity = 31/124 (25.00%), Postives = 62/124 (50.00%), Query Frame = 3
Query:   42 FILITLDSCRSD---IDVNTLFVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGL-WNDITC 401
            + L  LD C  +    +      + T +++ ++  +C   G  LV V++ E+N  +    N    +  W+  +D T+EG FV + G+   + N+  N+PN  ++++C++   +  G  WND+ C
Sbjct:    4 YFLFLLDVCGENWTFFNGYCYLTSNTCLSWKQSESACAVLGSGLVSVHNYEENVFIQQQHN---GEKSWVGLSDVTSEGRFVWADGSPTNFTNWAPNQPNDYKNQDCVHTLGVNYGYKWNDVQC 124          

HSP 2 Score: 46.2098 bits (108), Expect = 4.682e-6
Identity = 23/109 (21.10%), Postives = 54/109 (49.54%), Query Frame = 3
Query:  462 IEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGY-LNYDSLWNDLPC 785
              G  ++ S   +++  ++  C+     ++ + +  +N  +    ++ N +  WV  +D+ +EG++V +DG    + N+   +P   + ++C H   +NY   WND+ C
Sbjct:   19 FNGYCYLTSNTCLSWKQSESACAVLGSGLVSVHNYEENVFIQ---QQHNGEKSWVGLSDVTSEGRFVWADGSPTNFTNWAPNQPNDYKNQDCVHTLGVNYGYKWNDVQC 124          
BLAST of Lectin 2b vs. Ensembl Medaka
Match: mrc1a (mannose receptor C-type 1 [Source:NCBI gene;Acc:101161518])

HSP 1 Score: 76.6406 bits (187), Expect = 7.809e-18
Identity = 122/523 (23.33%), Postives = 203/523 (38.81%), Query Frame = 3
Query:  117 TYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGR-SENCINVYRLPSGLWNDITCLARIWAICQ-KDSEVSTDQLEIEGNIFVVSK-GKMTFADAQEYCSARSLKM---------------IRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPG-GGRVENCAHGYLNYDSLWNDLPCHFNLWVICYRS-----EIRAPGADPNTLIASYDRL--------------TFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNE--------NCL---NGYLSLDGLWNDFPCPYKNLFAICAK--DSLKIKDN---ENF-EIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEG--KWVDSNANVLPYKNWAATEPNGNRGENCIFI 1514
            T+ EA   CK+ G  L+ ++S  D        N     S WI    +     F  S G+   ++N+G  EPN    SE+C  +++     WND  C +    ICQ K   +   +  +   ++  ++ G + + ++Q Y +  +L M               +  G +    I    AR   SD+ +  G  +  +  +   DG  + Y  +   EP      ENC   Y      WND+ C   L  +C RS        AP A PN   A    L               +++A+++C  +G  +V   N  E A +         D +W+  ND   E  +V ++   + +  +  G P    +         +C+        L G W    C  K  F IC K  DS  +      +NF ++  D+  +  ++  ++EA + C+     LA + + V  A +         +  WI  N++   G  KWVD+ +  L Y  W   EP  N G  C++I
Sbjct:  670 TWQEAQDFCKTIGGDLLSIHSTRD------LNNIEFRSSAWIGLRLQGTNEGFAWSDGSPFEFENWGYGEPNNHMDSEHCTEIHQYYGQYWNDRNCESYNDWICQIKKGVIPKPEPTVVEEVYNTTEDGWIIYNNSQFYVNNENLPMEAARAYCKKNFGDLAVMTGDSERKFIWRQIAR--FSDMQYYIGMVVNLDKSFSWLDGTPVTYTAWNHNEPNFANNDENCVTIYREM-GYWNDINCGLELPSVCRRSNSFINTTMAPTAVPNGGCAPQWILFKGKCYKFFLGNNKNWRDAREFCTNEGGNLVSILNENEQAFLTIQMFHYNED-FWIGMNDVNWEMHFVWTDGKGISYTNWAKGHPVSSPDGRYMMDEAFDCVIMTGNPAKLKGNWKVEDCGAKRGF-ICKKNVDSQIVPPPTTPQNFYKLGNDSYKLIVQKMRWDEARRQCQADDADLASILNPVTQAYMT-LQMSSHNEPVWIGLNNNVTGGRFKWVDNWS--LFYTKWGKDEPKSNYG--CVYI 1176          

HSP 2 Score: 34.2686 bits (77), Expect = 7.809e-18
Identity = 34/167 (20.36%), Postives = 68/167 (40.72%), Query Frame = 1
Query: 1531 TWRDIACTNKYLAICTLNPNAGAKTADYH---------------FTKVKMTFEA--------AALYCKSVGLKVVRVRN------LNSN-RLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSFA-TGLWVDSKCDDFNSVVC 1938
            TW+   CTN Y ++C  +          H               F     +F +        A++ C  +G  +V +++      +  N  LL D AK     ++W+ G   + + +W+  + S L Y N+ +  P   + ++C+   + +G W  + C+ + S +C
Sbjct: 1181 TWKTAPCTNTYYSVCKRSSEIAPTEIPQHPGSCPESKKQRNWIPFRGHCYSFRSSVVDNWAFASVECIKMGASLVSIQDPAEAMFIQKNLELLEDGAK-----TFWI-GLYKSHDDEWMWIDKSVLDYTNWKSGMP---KSESCVDIHSDSGQWSTTSCNRYKSYIC 1338          

HSP 3 Score: 86.6557 bits (213), Expect = 4.392e-17
Identity = 111/537 (20.67%), Postives = 195/537 (36.31%), Query Frame = 3
Query:  105 KTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVSTDQLEIE-------------GNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGG--GRVENCAHGYLNYDSLWNDLPCHFNLWVICYR------SEIRAPGADPNTLIASY-----------DRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYW--LDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLD-----GLWNDFPCPYKNLFAICAK--------------DSLKIKDNENFEIDMDNMMV-----SAERYTYNEALQFCRTRGTQLARVNSQVD--------NAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNR-GENCIFI 1514
            +  +T+++A +SC+ +G  L+ +    + + ++G  +  L  S WI  N    E  +  S GN   Y N+G   P+     NC  +    +  W    C  ++  IC+K +  +     I+             GN + + + K  + DA   C      +  I    + + V S    + +D+ W+  ND   +  +  SD   + +  +  GEP       E+C       D  W D  C      IC +      SE      +P   + S+           +  TF+EA+  C   G  ++   N  ENA +           +W      + K   KW  + +    H  F+ G+P+       L G +++      GLW+   C  K  + IC K               +L         ++ +  +      SA + T+ EA  FC+T G  L  ++S  D        +A +    +     + W DG+                 ++NW   EPN +   E+C  I
Sbjct:  235 QAALTWHQARKSCQQQGADLLSIVELHEQSYISGLTSH-LGTSLWIGLNSLDFESGWQWSNGNPFRYLNWGPGHPSSEPGLNCATINAGKASKWESNACTKKLGYICRKGNSTNLPPPPIKGPSFCPSHWVPYAGNCYFLERSKKMWRDALAACRKDGGDLASIHSIEEQSFVISQTGYSQTDMLWIGFNDQRNQLLFEWSDHSQVTFTQWDTGEPSHIINHQEDCVL-IRGKDGKWADHTCEKMHGYICKKKASTTMSEGNQEEVNPGCKLGSFRFGSFCYNIGSETKTFEEAKQACANSGGNLLDIANRYENAFLVSLVGLRPEKYFWTGFSNTEDKTIFKWTTNRKVTFTH--FNAGQPDR------LQGCVAITTGIFAGLWDVISCTNKEKY-ICKKVADNVQMTTVPPTTPALNCAPGWTPVVERNTCLKIYRKESASKKTWQEAQDFCKTIGGDLLSIHSTRDLNNIEFRSSAWIGLRLQGTNEGFAWSDGSP--------------FEFENWGYGEPNNHMDSEHCTEI 746          

HSP 4 Score: 84.3445 bits (207), Expect = 2.510e-16
Identity = 128/581 (22.03%), Postives = 226/581 (38.90%), Query Frame = 3
Query:   87 NTLFVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNG--GRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVSTDQLEIEGNIFVVSKG------------------KMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLN-YDSLWNDLPCHFNLWVICYRSEIR---------------APGADP----NTLIASY-----DRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGK-----WVDSEENDLKHKGFHPGEPNGGVN-ENCLNGYLSLDGLWNDFPCPYKNLFAIC---------------------AKDSLKIKDNENFEIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEG-KWVDSNANVLPYKNWAATEPN-GNRGENCIFILLRRRDMEGYCMHQ*IPCYLYLKPKCRSQNS 1607
            N  F+ ++   + +AL +C+  G  L  ++S E+ + V         D  WI  ND+  + +F  S  + +T+  + T EP+      E+C+ + R   G W D TC      IC+K +  +      EGN   V+ G                    TF +A++ C+     ++ I +  +NA + S         +W   ++   +  +  +  + + + +F  G+P   R++ C       +  LW+ + C      IC +                   APG  P    NT +  Y      + T+QEAQD+CK  G  ++  ++  +   ++    R ++   W+     +L+G      W D    + ++ G+  GEPN  ++ E+C   +      WND  C   N + IC                      +D   I +N  F ++ +N+ + A R        +C+     LA +    +   +     +     Y+I    + ++   W+D     + Y  W   EPN  N  ENC+ I    R+M GY     I C L L   CR  NS
Sbjct:  369 NCYFLERSKKMWRDALAACRKDGGDLASIHSIEEQSFVISQTGYSQTDMLWIGFNDQRNQLLFEWSDHSQVTFTQWDTGEPSHIINHQEDCV-LIRGKDGKWADHTCEKMHGYICKKKASTTMS----EGNQEEVNPGCKLGSFRFGSFCYNIGSETKTFEEAKQACANSGGNLLDIANRYENAFLVSLVGLRPEKYFWTGFSNTEDKTIFKWTTNRKVTFTHFNAGQP--DRLQGCVAITTGIFAGLWDVISCTNKEKYICKKVADNVQMTTVPPTTPALNCAPGWTPVVERNTCLKIYRKESASKKTWQEAQDFCKTIGGDLLSIHSTRD---LNNIEFRSSA---WI---GLRLQGTNEGFAWSDGSPFEFENWGY--GEPNNHMDSEHCTEIHQYYGQYWNDRNCESYNDW-ICQIKKGVIPKPEPTVVEEVYNTTEDGWIIYNNSQFYVNNENLPMEAAR-------AYCKKNFGDLAVMTGDSERKFIWRQIARFSDMQYYIGMVVNLDKSFSWLDGTP--VTYTAWNHNEPNFANNDENCVTIY---REM-GYWND--INCGLELPSVCRRSNS 915          

HSP 5 Score: 68.5514 bits (166), Expect = 1.758e-11
Identity = 108/470 (22.98%), Postives = 184/470 (39.15%), Query Frame = 3
Query:  288 GNLLTYKNFGTNEPN-GGRSENCINVYRLPSGLWNDITCLARIWAICQK-DSEVSTDQLEIE------GNIFVVSKGK---------MTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNF----PVGEPGG----GRVENCAHGYLNYDSL---WNDLPCHFNLWVICYR---SEIRAPGADPNTLIA----SY----DRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEG--KWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFEIDMDNMMVSAER---------YTYNEAL----QFCRTRGTQLARVNSQVDNAMLAAFAKKVV------ADYYWID-GNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENCIFI 1514
            G  +TY  +  NEPN     ENC+ +YR   G WNDI C   + ++C++ +S ++T               +++ KGK           + DA+E+C+     ++ I +  + A +       N D +W+  ND+  E  +V +DGK + Y N+    PV  P G        +C     N   L   W    C      IC +   S+I  P   P         SY     ++ + EA+  C+A    +    N    A +        ++  W+  N+    G  KWVD+    L +  +   EP    N  C+  Y+ +D  W   PC     +++C + S +I   E  +          +R         Y++  ++     F      ++      + +   A F +K +      A  +WI     H +E  W+D   +VL Y NW +  P   + E+C+ I
Sbjct:  865 GTPVTYTAWNHNEPNFANNDENCVTIYR-EMGYWNDINCGLELPSVCRRSNSFINTTMAPTAVPNGGCAPQWILFKGKCYKFFLGNNKNWRDAREFCTNEGGNLVSILNENEQAFLTIQMFHYNED-FWIGMNDVNWEMHFVWTDGKGISYTNWAKGHPVSSPDGRYMMDEAFDCVIMTGNPAKLKGNWKVEDCGAKRGFICKKNVDSQIVPPPTTPQNFYKLGNDSYKLIVQKMRWDEARRQCQADDADLASILNPVTQAYM-TLQMSSHNEPVWIGLNNNVTGGRFKWVDNW--SLFYTKWGKDEPKS--NYGCV--YIDVDKTWKTAPCT-NTYYSVCKRSS-EIAPTEIPQHPGSCPESKKQRNWIPFRGHCYSFRSSVVDNWAFASVECIKMGASLVSIQDPAEAMFIQKNLELLEDGAKTFWIGLYKSHDDEWMWIDK--SVLDYTNWKSGMP---KSESCVDI 1318          

HSP 6 Score: 53.5286 bits (127), Expect = 8.256e-7
Identity = 61/261 (23.37%), Postives = 111/261 (42.53%), Query Frame = 3
Query:  120 YNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNG---GR-----SENCINVYRLPSGL---WNDITCLARIWAICQK--DSEV----STDQ--LEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGADP 845
            + +A + C + G  LV + +  + A +         + +WI  ND   E  FV + G  ++Y N+    P     GR     + +C+ +   P+ L   W    C A+   IC+K  DS++    +T Q   ++  + + +   KM + +A+  C A    +  I + +  A + +    ++++  W+  N+ VT G++   D   L Y  +   EP      N    Y++ D  W   PC    + +C RS   AP   P
Sbjct:  953 WRDAREFCTNEGGNLVSILNENEQAFLT-IQMFHYNEDFWIGMNDVNWEMHFVWTDGKGISYTNWAKGHPVSSPDGRYMMDEAFDCVIMTGNPAKLKGNWKVEDCGAKRGFICKKNVDSQIVPPPTTPQNFYKLGNDSYKLIVQKMRWDEARRQCQADDADLASILNPVTQAYM-TLQMSSHNEPVWIGLNNNVTGGRFKWVDNWSLFYTKWGKDEPK----SNYGCVYIDVDKTWKTAPCTNTYYSVCKRSSEIAPTEIP 1207          
BLAST of Lectin 2b vs. Ensembl Medaka
Match: mrc1b (macrophage mannose receptor 1 [Source:NCBI gene;Acc:101163523])

HSP 1 Score: 85.1149 bits (209), Expect = 4.184e-17
Identity = 117/524 (22.33%), Postives = 214/524 (40.84%), Query Frame = 3
Query:  105 KTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGR-SENCINVYRLPSGLWNDITCLARIWAICQKDSEVS-TDQLEIEG----------NIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGA----DPNTLIASY-------------------DRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVN-ENCLNGYL---SLDGLWNDFPC-PYKNLFAICA------------KDSLKIKDNENFEIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGN-DHTEEGKWVDSNANVLPYKNWAATEPN-GNRGENCIFI 1514
            ++  T+++A  +C+     LV +++ E+ + +      V  D  WI  ND T EG+F  S  + + + ++   +P      E+C+ + R   G W D  C  +   IC K SE S ++ L+ EG            ++V     TF +A+  C      +  +  ++DNA + S         +W+  ++      +V ++ K + + ++    P G R    A    ++  LW+ LPC      IC +    A GA     P T+                       D+ T+ EA++YC A G  ++  +  +++ LV G  R   +   W+  +   L+  +V S+ + +  + +  GEPN   N E+C    +    ++G WND  C  Y + F                        +   E   +   ++ +  +  EA QFC+     LA +NS  +NA L     +   + YWI  N D      W+D +  +  Y+ W   +P+  +  E C+ +
Sbjct:  351 RSQKTWSDAQLTCRKEEGDLVSIHNVEEQSFIFSELGYVPTDELWIGLNDRTTEGLFDWSDQSAVRFTSWEFGKPGVQENQEDCV-LIRGQKGNWADSVCEEKHGFICMKKSEASGSEILQEEGCQTGWKRFGSYCYLVGSETKTFDEARMICDHSQSYLADVSTSVDNAFLTSLVGLRPEKHFWLGLSNQREINVFVWTNTKRVRFTHWNAEMP-GDRQGCVAMATGHHAGLWDVLPCANKEKYICKQ---LAKGAVVTPHPTTVPVQTCTVGWTKLPSGNFCFKFFGDKKTWYEAREYCTAIGGDLLSFH--SKDDLVAGRGRHSRA---WIGLSAPNLDLGYVWSDGSPVNFQHWSNGEPNNKNNIESCTEFSMYGWDMEGSWNDNQCEKYNSWFCQIPLGVTPKPPPDPVTPDYNTTSDGWLEWKGNQYFINQKSLSMEEARQFCKQFHGDLATINSYNENAFLWKRISRSHGN-YWIGLNVDFDGTRVWMDHSEVI--YQQWDEGQPDYKHYDEQCVIM 861          

HSP 2 Score: 23.0978 bits (48), Expect = 4.184e-17
Identity = 10/32 (31.25%), Postives = 18/32 (56.25%), Query Frame = 1
Query: 1519 LEEGTWRDIACTNKYLAICTLN--PNAGAKTA 1608
            +E+G W D  C  ++ +IC  +  P+A +  A
Sbjct:  863 VEDGVWHDYNCGFEHKSICKRSGPPHANSTVA 894          

HSP 3 Score: 75.8702 bits (185), Expect = 2.982e-16
Identity = 87/391 (22.25%), Postives = 154/391 (39.39%), Query Frame = 3
Query:  414 WAICQKDSEVSTDQLEIEGNIFVV-SKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSF---ARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNL-WVICYRSEIRAPGADPNTLIA-----SYD---------RLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYL--SLDGLWNDFPCPYKNLFAICAKDS----LKIKDNENFEIDMDNM-----MVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRG 1496
            W +C  +S  S  +    G  + + S   +T+A+A+  C  ++  ++ +      A V +     R      +W+ G  +  E  W  S      Y N+  G P       C       D  W +  C   L ++ C       P   P   +      SY+         + T+ +AQ  C+ +   +V  +N  E + +      + +D  W+  ND   EG +  S+++ ++   +  G+P  GV EN  +  L     G W D  C  K+ F IC K S     +I   E  +           +V +E  T++EA   C    + LA V++ VDNA L +        ++W+  ++  E   +V +N   + + +W A  P   +G
Sbjct:  183 WGVCPTNSRQSWIKHPKTGAYYQLNSDAALTWAEAESSCKQQNATLLSLTDPHQEAYVTAILTSGRMEEGYKFWI-GLTLDPEHGWKWSSQNPFRYLNWDSGYPLSSPGHVCGFADGTADYSWRNSVCSKRLGYICCSHGGPAVPTKAPEAGLCTAPWISYNGRCYQLYRSQKTWSDAQLTCRKEEGDLVSIHNVEEQSFIFSELGYVPTDELWIGLNDRTTEGLFDWSDQSAVRFTSWEFGKP--GVQENQEDCVLIRGQKGNWADSVCEEKHGF-ICMKKSEASGSEILQEEGCQTGWKRFGSYCYLVGSETKTFDEARMICDHSQSYLADVSTSVDNAFLTSLVGLRPEKHFWLGLSNQREINVFVWTNTKRVRFTHWNAEMPGDRQG 569          

HSP 4 Score: 29.6462 bits (65), Expect = 2.982e-16
Identity = 39/174 (22.41%), Postives = 62/174 (35.63%), Query Frame = 1
Query: 1528 GTWRDIACTNKYLAIC---------TLNPNA-GAKTADYHFTKV------------KMTFEAAALYCKSVGLKV---------VRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSFAT------GLWVDSKCDDFNSVVC 1938
            G W  + C NK   IC         T +P     +T    +TK+            K T+  A  YC ++G  +         V  R  +S   +  SA  L L   W DG              S + +++++   PN   +      F+       G W D++C+ +NS  C
Sbjct:  580 GLWDVLPCANKEKYICKQLAKGAVVTPHPTTVPVQTCTVGWTKLPSGNFCFKFFGDKKTWYEAREYCTAIGGDLLSFHSKDDLVAGRGRHSRAWIGLSAPNLDLGYVWSDG--------------SPVNFQHWSNGEPNNKNNIESCTEFSMYGWDMEGSWNDNQCEKYNSWFC 739          

HSP 5 Score: 58.151 bits (139), Expect = 3.271e-8
Identity = 99/506 (19.57%), Postives = 201/506 (39.72%), Query Frame = 3
Query:  117 TYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYR-LPSGLWNDITCLARIWAICQKDSE-----------------VSTDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGG-GRVENCAHGYL---NYDSLWNDLPCH-FNLWVI-----------------CYRSE----IRAPGADPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPN-GGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDN----------------ENFEIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAML-------------AAFAKKVVADYYWIDGNDHT 1412
            T++EA   C      L  V+++ DNA +           +W+  +++    +FV +    + + ++    P  G  + C+ +     +GLW+ + C  +   IC++ ++                 V   +L      F     K T+ +A+EYC+A    ++   H+ D+ +V    R + +   W+  +    +  +V SDG  + ++++  GEP     +E+C    +   + +  WND  C  +N W                    Y +     +   G   N    +   L+ +EA+ +CK     +   N+  ENA +     R   + YW+ G +   +G  V  + +++ ++ +  G+P+    +E C+   +  DG+W+D+ C +++  +IC +      ++                  F+    N+ V  +R T+  A Q CR     LA ++S+   A L               F K    ++YW +G   +
Sbjct:  494 TFDEARMICDHSQSYLADVSTSVDNAFLTSLVGLRPEKHFWLGLSNQREINVFVWTNTKRVRFTHWNAEMP--GDRQGCVAMATGHHAGLWDVLPCANKEKYICKQLAKGAVVTPHPTTVPVQTCTVGWTKLPSGNFCFKFFGDKKTWYEAREYCTAIGGDLLSF-HSKDD-LVAGRGRHSRA---WIGLSAPNLDLGYVWSDGSPVNFQHWSNGEPNNKNNIESCTEFSMYGWDMEGSWNDNQCEKYNSWFCQIPLGVTPKPPPDPVTPDYNTTSDGWLEWKG---NQYFINQKSLSMEEARQFCKQFHGDLATINSYNENAFLWKRISRSHGN-YWI-GLNVDFDGTRVWMDHSEVIYQQWDEGQPDYKHYDEQCVIMRVE-DGVWHDYNCGFEHK-SICKRSGPPHANSTVAPILTPKGGCEFPWRKFQSKCYNI-VKDQRMTWFNAGQTCRGMNANLASIDSREVQAFLLTQMVDAATTDLWIGFHKLHGGEFYWSNGRKRS 984          
BLAST of Lectin 2b vs. Ensembl Medaka
Match: mrc1b (macrophage mannose receptor 1 [Source:NCBI gene;Acc:101163769])

HSP 1 Score: 86.6557 bits (213), Expect = 5.248e-17
Identity = 115/524 (21.95%), Postives = 207/524 (39.50%), Query Frame = 3
Query:  105 KTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVSTDQLEIEGNI-------------FVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDS-LWNDLPCHFNLWVICYRSEIRA------------PGADPNTLIASY------------DRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVN-ENCLNGYL-SLD--GLWNDFPCPYKN--LFAICAKDSLKIKDNEN-----------FEIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNR-GENCI 1508
            +TL+T+ +AL+ C+  G  L  + + ED + V        +D  WI  ND + EG+F  S  + +T+ ++   +P    SENC+ + R  +G W D  C  +   IC K S       E++ NI             + +     TF +A++ C   +  ++ + + +DNA + S   +     +W+  ++      +V ++   + + ++  G P  G  + C        + LW+ LPC      IC      A              A+  T + S             +  T+ EA+DYC+A G  ++  ++ A+  L+     +    L+  D N   +   W D    +  H  +  GEPN   N E+C    L S D  G WND  C   N  L  I A  + K   N              +       ++    +  +A  FC+     LA + S  +N  L     +    +Y   G     +G +  ++ + + ++ W   +P+     +NC+
Sbjct:  359 RTLLTWADALKECRKEGGDLSSIYNVEDQSFVISQLGYASSDELWIGLNDRSTEGLFEWSDHSTVTFTSWEFGKPLKSTSENCV-LLRGENGNWADRYCEEKHGFICMKQSSSERTGDEVDLNIGCKAGWKKHGSYCYFIGTETKTFDEAKDDCKTSNSYLVDVSNGVDNAFLVSLVGQRPEKNFWLGLSNQKNIDVFVWTNTDQVKFTHWNAGMP--GHAQGCVAMATGISAGLWDLLPCTNKEKYICKHQAEGAVLTVPPPTQTPPQCAEDWTRVGSRNICYKFFTGPRSEEKTWFEARDYCRAIGGDLLSIHSQAD--LISRRGGKAWIGLHIADPNTGYV---WSDGSPVNFLH--WQEGEPNNHNNAESCAEVQLYSWDENGSWNDANCESYNDWLCQIRAGVTPKAPPNNTVTDYNKTADGWIQWKGKEYFINTMPRSMEDARHFCQRHHADLASIGSLAENIFLWKLISRSYGAFY--IGLSVDLDGSYWWTDGSPILFQQWDQDQPSTTAYDQNCV 870          

HSP 2 Score: 86.2705 bits (212), Expect = 6.505e-17
Identity = 115/529 (21.74%), Postives = 198/529 (37.43%), Query Frame = 3
Query:  102 TKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQK-----------DSEVSTDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGADPNTL----------------IASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLD-GLWNDFPCPYKNLF--------------------AICAKDSLKIKDNENFEIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNG-NRGENCIFILLRRRDMEG 1541
            T++ +T+ +A  SCK +   L+ +      AV++        +  WI    +T  G +  + G    Y  + +  P      NC  +      LW   +C  ++  IC K           +   S   +   G+ F + +  +T+ADA + C      +  I +  D + V S     +SD  W+  ND  TEG +  SD   + + ++  G+P     ENC       +  W D  C      IC +        D   L                    +  TF EA+D CK     +V  +N  +NA +     +     +WL  ++ K    +V +  + +K   ++ G P  G  + C+     +  GLW+  PC  K  +                      CA+D  ++  + N          S E+ T+ EA  +CR  G  L  ++SQ D  +++    K      WI  +       +V S+ + + + +W   EPN  N  E+C  + L   D  G
Sbjct:  221 TQSALTWAQADASCKQQASSLLSITDPVQQAVISALLGSG-RNKLWIGLVLDTEHG-WKWTDGKPFRYLKWDSGNPQPNPGHNCGLLDSSGQFLWESSSCTKKMGYICYKGGIPPAPPHVEEGFCSDPWIPYNGHCFHLHRTLLTWADALKECRKEGGDLSSIYNVEDQSFVISQLGYASSDELWIGLNDRSTEGLFEWSDHSTVTFTSWEFGKPLKSTSENCVL-LRGENGNWADRYCEEKHGFICMKQSSSERTGDEVDLNIGCKAGWKKHGSYCYFIGTETKTFDEAKDDCKTSNSYLVDVSNGVDNAFLVSLVGQRPEKNFWLGLSNQKNIDVFVWTNTDQVKFTHWNAGMP--GHAQGCVAMATGISAGLWDLLPCTNKEKYICKHQAEGAVLTVPPPTQTPPQCAEDWTRV-GSRNICYKFFTGPRSEEK-TWFEARDYCRAIGGDLLSIHSQAD--LISRRGGKA-----WIGLHIADPNTGYVWSDGSPVNFLHWQEGEPNNHNNAESCAEVQLYSWDENG 735          
BLAST of Lectin 2b vs. Ensembl Medaka
Match: mrc2 (mannose receptor C type 2 [Source:NCBI gene;Acc:101168215])

HSP 1 Score: 82.8037 bits (203), Expect = 8.133e-16
Identity = 108/547 (19.74%), Postives = 196/547 (35.83%), Query Frame = 3
Query:   42 FILITLDSCRSDIDVNTL------FVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVSTDQLE------------------IEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGR--VENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGA-------------DPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSL-DGLWNDFPCPYKNLFAICAKD---SLKI-------------------KDNENFEIDMDNMMVSA--ERYTYNEALQFCRTRGTQLARVNSQ-----VDNAMLAAFAKKVVADYYW----IDGNDHTEEGKWVDSNANVLPYKN 1463
            F  I   SC +  D + L      F  +  ++++EA  SC+ +G  L+ V    +   +NG      A + WI  ND    G +  S  + L Y N+   +PN    ENC+ +    SG W +  C   +  +C+K    + D                      +   + ++  K  +  AQ+ C      +  I H L      + +   + D  W+  +D   +  +  +D   +I+  +   EP   R   E+C   +   +  W+D PC+  L  IC +   ++ G               P       D LTF++A+  C++    +V   N  E A  +      + + +W+   D    G +     + + +  ++  EP   +   C+     +  GLW    C       IC ++   SL                     K N N          S    R ++ +A  FCR  G  L  ++       V   +  AF +    + +W    ++  +  + G W  S+   + Y+N
Sbjct:  230 FCPIKSSSCETFWDTDPLTDSCYQFNFQAALSWSEARISCQQQGADLLSVTKLHEQTYINGLLTGYSA-ALWIGLNDLDISGGWQWSDSSPLKYLNWEKEQPNHADEENCVVIRTESSGRWQNRDCSVDLPYVCKKRPNATMDPFTTDSWTDDEKYECDVGWQAFQAGCYKLNSEKTDWNAAQKNCQKVEANLASI-HTLPELEFITRSLRKDIDQLWIGLHDTDMQMDFQWTDHTPVIFTYWHPFEPNNFRNTPEDCVSIW-GAEGRWDDSPCNLTLPSICKKPGTKSDGKPQQQDCNQGWKWHSPACYWVGEDLLTFEDAKKSCESHQAALVPITNRFEQAFANSLVFGRSGESFWIGLYDQGSPGSFHWLSGDGVSYTNWNRNEP-AKIQSGCVAMATGIATGLWEVKECASAKAKFICRQNQDTSLSPEPPAPLPTPSLSGSCPSGWKSNSNLRYCYKVFHSSQMENRLSWLDAHLFCRRHGAHLLSISGPDEEHFVLQVLHEAFGESEEHEQHWFWIGLNRRNPMDNGSWKWSDGMAVTYQN 772          

HSP 2 Score: 60.8474 bits (146), Expect = 4.505e-9
Identity = 78/368 (21.20%), Postives = 144/368 (39.13%), Query Frame = 3
Query:  489 KGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGA--DPNTLIASYDRLTFQ-----------------EAQDYCKAQ-GLKMVRANNAAENAL--VHGFARRITSDL--YW--LDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVN--ENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFEIDMDN---------MMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEP 1481
            +  +++++A+  C  +   ++ +    +   ++      ++ L W+  ND+   G W  SD   L Y N+   +P     ENC          W +  C  +L  +C +     P A  DP T  +  D   ++                 E  D+  AQ   + V AN A+ + L  +    R +  D+   W  L   D +++ +W D       +  +HP EPN   N  E+C++ +   +G W+D PC    L +IC K   K  D +  + D +            V  +  T+ +A + C +    L  + ++ + A   +       + +WI   D    G +   + + + Y NW   EP
Sbjct:  257 QAALSWSEARISCQQQGADLLSVTKLHEQTYINGLLTGYSAAL-WIGLNDLDISGGWQWSDSSPLKYLNWEKEQPNHADEENCVVIRTESSGRWQNRDCSVDLPYVCKKR----PNATMDPFTTDSWTDDEKYECDVGWQAFQAGCYKLNSEKTDWNAAQKNCQKVEANLASIHTLPELEFITRSLRKDIDQLWIGLHDTDMQMDFQWTDHTPVIFTY--WHPFEPNNFRNTPEDCVSIW-GAEGRWDDSPCNL-TLPSICKKPGTK-SDGKPQQQDCNQGWKWHSPACYWVGEDLLTFEDAKKSCESHQAALVPITNRFEQAFANSLVFGRSGESFWIGLYDQGSPGSFHWLSGDGVSYTNWNRNEP 614          

HSP 3 Score: 57.3806 bits (137), Expect = 5.619e-8
Identity = 110/529 (20.79%), Postives = 193/529 (36.48%), Query Frame = 3
Query:  114 VTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADS-------YWIDGNDETA--EGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAIC-------QKDSEVSTDQLEIEGNIFVVSKGKM-----TFADAQEYCSARSLKMIRIGHALDNAIVHSFARE---TNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGG-GRVENCAHGYLNYDSL-WNDLPCHFNLWVICYRSEIRAPGADPNTLI----------ASYD-----------RLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEP--NGGVNENCLNGYLSLD---------GLWNDFPCPYKNLFAICAKDS----------LKIKDNENFEIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRG 1496
            +++ +A   C+  G  L+ ++  ++   V    ++   +S       +WI  N       G +  S G  +TY+NFG    N      C     L +  W  + C + +  IC       +K  E++      E  +F  ++ K      T+  AQ  CS     +  +  A +   + +  R+      D +W+  +    +G++  SD   L Y ++ +G P    R   C    ++   + W+D  CH +L  IC R  +        +            ASY            R+T+  A+  C  QG  +   ++  E A V    + I++DL+    +D K   +W  ++   L +  + PGEP  N G + N   G   +          G+W    C  +N   IC K            +    ++  E+      V  +R  +  +L  C +    LA V      A L      +    +    N       W+  N +V+ Y NW   EPN   G
Sbjct:  698 LSWLDAHLFCRRHGAHLLSISGPDEEHFVLQVLHEAFGESEEHEQHWFWIGLNRRNPMDNGSWKWSDGMAVTYQNFGRYYYN---VRQCAAA-DLGAMTWLAMHCDSELDWICKIPRGSVEKLPEITEGNTSPEWIMFKEAEYKFFDHRTTWDQAQRICSWFDSSLASVHSADEQMFLANTLRKMVKVEGDSWWLGLHTYENDGRFRWSDHSVLNYISWALGRPHPLSRDRRCVS--ISASKVDWSDQKCHSDLPYICKRVNVTGTVPPTPSTPHPPSGCPDGWASYQHKCFKVFDQSPRVTWSAAKLKCDTQGGVLAVVSSPLEQAFVTTLLKYISADLWVGLTSDPKGHFQW--AQAGLLSYTNWAPGEPLDNSGPHHNKTPGNCVVMIHGNPEKKVGMWASKACEMENNGFICQKQQDRGLPPAPPLIPSSLSKPVELGGVTYRVVKKRLDWTSSLHICESLNGTLATVKDPYQQAYLTLLMNSLHQPAWIALYNYGGRSFTWL-GNEDVV-YSNWKDGEPNQMAG 1216          
BLAST of Lectin 2b vs. Ensembl Medaka
Match: ENSORLT00000033058.1 (pep primary_assembly:ASM223467v1:21:6426657:6438028:1 gene:ENSORLG00000027148.1 transcript:ENSORLT00000033058.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.6178 bits (148), Expect = 4.828e-11
Identity = 37/114 (32.46%), Postives = 61/114 (53.51%), Query Frame = 3
Query:   96 FVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEP-NGGRSENCINVYRLPSGLWNDITCLARIWAICQKD 434
            F+++   +++EA +SCK+RG  LV +NS ++N     F +K+  +  WI   D   EG +    G+ L    +G+ +P N    E+C+  +    GLWNDI C      IC+K+
Sbjct:   28 FLSEESKSWDEARKSCKARGADLVVINSKDENE----FISKLNTERCWIGLTDRDLEGTWKWVDGSSLNLTFWGSGQPDNYDGDEDCVETHFKSPGLWNDIPCKLSRRLICEKE 137          

HSP 2 Score: 53.5286 bits (127), Expect = 3.994e-8
Identity = 38/115 (33.04%), Postives = 57/115 (49.57%), Query Frame = 3
Query:  861 SYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEG--KWVDSEENDLKHKGFHPGEP-NGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKD 1196
            S +  ++ EA+  CKA+G  +V  N+  EN     F  ++ ++  W+   D  LEG  KWVD    +L   G   G+P N   +E+C+  +    GLWND PC       IC K+
Sbjct:   30 SEESKSWDEARKSCKARGADLVVINSKDENE----FISKLNTERCWIGLTDRDLEGTWKWVDGSSLNLTFWG--SGQPDNYDGDEDCVETHFKSPGLWNDIPCKLSRRL-ICEKE 137          

HSP 3 Score: 46.9802 bits (110), Expect = 5.965e-6
Identity = 28/116 (24.14%), Postives = 52/116 (44.83%), Query Frame = 3
Query:  471 NIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGG-GRVENCAHGYLNYDSLWNDLPCHFNLWVICYR 815
            + + +S+   ++ +A++ C AR   ++ I    +N  +       N++  W+   D   EG W   DG  L    +  G+P      E+C   +     LWND+PC  +  +IC +
Sbjct:   25 SCYFLSEESKSWDEARKSCKARGADLVVINSKDENEFISKL----NTERCWIGLTDRDLEGTWKWVDGSSLNLTFWGSGQPDNYDGDEDCVETHFKSPGLWNDIPCKLSRRLICEK 136          
BLAST of Lectin 2b vs. Planmine SMEST
Match: SMESG000056362.1 (SMESG000056362.1)

HSP 1 Score: 966.837 bits (2498), Expect = 0.000e+0
Identity = 461/495 (93.13%), Postives = 477/495 (96.36%), Query Frame = 3
Query:   27 TVLTIFILITLDSCRSDIDVNTLFVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVSTDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGADPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFEIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENCIF 1511
            TVLTIFILITLDSCRSDIDVNTLFVTKTLVTYNEALQ+CKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDI C +RIWAICQKDSEVSTDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGADPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPC YKNLFA+C+  S ++   EN++ID DN+MVSAE YTYNEALQFCRTRGTQL R+ +  DN ++AAFAKKVVA+ YWIDGNDHTEEGKWVDSNAN++ YKNWAATEPNGNRGENCIF
Sbjct:    7 TVLTIFILITLDSCRSDIDVNTLFVTKTLVTYNEALQTCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDIQCGSRIWAICQKDSEVSTDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGADPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCSYKNLFAVCSYGSFRLPYQENYDIDSDNLMVSAELYTYNEALQFCRTRGTQLVRIKNVADNGLVAAFAKKVVANLYWIDGNDHTEEGKWVDSNANLMQYKNWAATEPNGNRGENCIF 501          

HSP 2 Score: 398.282 bits (1022), Expect = 7.857e-130
Identity = 205/484 (42.36%), Postives = 290/484 (59.92%), Query Frame = 3
Query:   75 DIDVNTLFVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVSTDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHF-NLWVICYRSEIRAP-----GADPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFEIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENCI 1508
            +I+ N   V+K  +T+ +A + C +R ++++R+  A DNA+V+ FA +  +D YW+DGND   EG +V+S G  L YKNF   EP GGR ENC + Y     LWND+ C   +W IC + SE+       + N  + S  ++TF +AQ+YC A+ LKM+R  +A +NA+VH FAR   SDLYW+DGND   EGKWVDS+  DL +K F  GEP GG  ENC +GYL+ D LWND PC + NL+ +C     R P       D + L+ S +  T+ EA  +C+ +G ++VR  N A+N LV  FA+++ ++LYW+DGND   EGKWVDS  N +++K +   EPNG   ENC+      +G W D  C  K L AIC+++ L+     +F      M       T++ A  +C++ G +L RV     N ++     +   D YWIDGND+ EEGKWVDSN  VL Y+N+ A EP+G R +NCI
Sbjct:  151 EIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYR-SEIRAPG--ADPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCSYKNLFAVCSYGSFRLPYQENYDIDSDNLMVSAELYTYNEALQFCRTRGTQLVRIKNVADNGLVAAFAKKVVANLYWIDGNDHTEEGKWVDSNANLMQYKNWAATEPNGNRGENCIFSNYLEEGTWRDIACTNKYL-AICSRNPLEGDQAIDFHFTRSKM-------TFDSATSYCKSIGLRLIRVADAESNRLINLATIRHKLDTYWIDGNDNDEEGKWVDSNKTVLTYQNFNAGEPSGGRVKNCI 623          

HSP 3 Score: 269.626 bits (688), Expect = 9.347e-81
Identity = 144/367 (39.24%), Postives = 213/367 (58.04%), Query Frame = 3
Query:   81 DVNTLFVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLAR-IWAICQKDSEVSTDQ--LEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGADPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCPYKN 1172
            D NTL  +   +T+ EA   CK++G+++VR N+A +NA+V+GFA ++ +D YW+DGND   EG +V+S+ N L +K F   EPNGG +ENC+N Y    GLWND  C  + ++A+C   S     Q   +I+ +  +VS    T+ +A ++C  R  +++RI +  DN +V +FA++  ++LYW+DGND   EGKWVDS+   + YKN+   EP G R ENC       +  W D+ C      IC R+ +    A       S  ++TF  A  YCK+ GL+++R  +A  N L++    R   D YW+DGND   EGKWVDS +  L ++ F+ GEP+GG  +NC+ G  S  G W D  C   N
Sbjct:  278 DPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCSYKNLFAVCSYGSFRLPYQENYDIDSDNLMVSAELYTYNEALQFCRTRGTQLVRIKNVADNGLVAAFAKKVVANLYWIDGNDHTEEGKWVDSNANLMQYKNWAATEPNGNRGENCIFSNYLEEGTWRDIACTNKYLAICSRNPLEGDQAIDFHFTRS--KMTFDSATSYCKSIGLRLIRVADAESNRLINLATIRHKLDTYWIDGNDNDEEGKWVDSNKTVLTYQNFNAGEPSGGRVKNCIQGTNS--GFWFDAQCSSSN 640          

HSP 4 Score: 211.075 bits (536), Expect = 3.220e-59
Identity = 109/246 (44.31%), Postives = 143/246 (58.13%), Query Frame = 3
Query:   75 DIDVNTLFVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVSTDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICY 812
            DID + L V+  L TYNEALQ C++RG +LVR+ +  DN +V  FA KV+A+ YWIDGND T EG +V+S  NL+ YKN+   EPNG R ENCI    L  G W DI C  +  AIC ++       ++     F  ++ KMTF  A  YC +  L++IR+  A  N +++        D YW+DGND   EGKWVDS+   L Y+NF  GEP GGRV+NC  G       W D  C  +  V+CY
Sbjct:  407 DIDSDNLMVSAELYTYNEALQFCRTRGTQLVRIKNVADNGLVAAFAKKVVANLYWIDGNDHTEEGKWVDSNANLMQYKNWAATEPNGNRGENCIFSNYLEEGTWRDIACTNKYLAICSRNPLEGDQAID-----FHFTRSKMTFDSATSYCKSIGLRLIRVADAESNRLINLATIRHKLDTYWIDGNDNDEEGKWVDSNKTVLTYQNFNAGEPSGGRVKNCIQG--TNSGFWFDAQCSSSNAVVCY 645          

HSP 5 Score: 205.297 bits (521), Expect = 4.934e-57
Identity = 90/158 (56.96%), Postives = 120/158 (75.95%), Query Frame = 1
Query: 1495 EKIVFSYYLEEGTWRDIACTNKYLAICTLNPNAGAKTADYHFTKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSFATGLWVDSKCDDFNSVVCYGSIKRVSKF 1968
            E  +FS YLEEGTWRDIACTNKYLAIC+ NP  G +  D+HFT+ KMTF++A  YCKS+GL+++RV +  SNRL+  +    KLD+YW+DGNDN EEGKWVD+N + L Y+NF A  P+GGR KNC+Q   +G W D++C   N+VVCYG+++++ KF
Sbjct:  497 ENCIFSNYLEEGTWRDIACTNKYLAICSRNPLEGDQAIDFHFTRSKMTFDSATSYCKSIGLRLIRVADAESNRLINLATIRHKLDTYWIDGNDNDEEGKWVDSNKTVLTYQNFNAGEPSGGRVKNCIQGTNSGFWFDAQCSSSNAVVCYGALRKIVKF 654          

HSP 6 Score: 102.449 bits (254), Expect = 2.443e-22
Identity = 58/166 (34.94%), Postives = 80/166 (48.19%), Query Frame = 1
Query: 1486 GTEEKIVFSYYLEEGTWRDIACTNKYLAICTLNPNAGAKTAD-----YHFTKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSFAT--GLWVDSKCDDFNSVVCYGSIKRVS 1962
            G  E  +  Y L  G W DI C ++  AIC  +        +     +  +K KMTF  A  YC +  LK++R+ +   N ++   A+    D YW+DGND   EGKWVD++   L+YKNF    P GGR +NC   +     LW D  C     V+CY S  R  
Sbjct:  110 GRSENCINVYRLPSGLWNDIQCGSRIWAICQKDSEVSTDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAP 275          

HSP 7 Score: 97.0561 bits (240), Expect = 1.070e-20
Identity = 60/164 (36.59%), Postives = 81/164 (49.39%), Query Frame = 1
Query: 1486 GTEEKIVFSYYLEEGTWRDIACTNKYLAICTLN----PNAGAKTADYHFTKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSFAT--GLWVDSKCDDFN--SVVCYGSIK 1953
            G  E     Y   +  W D+ C      IC  +    P A   T    + +  +TF+ A  YCK+ GLK+VR  N   N L+   A+ +  D YWLDGND   EGKWVD+  + L +K F    PNGG ++NCL  + +  GLW D  C   N  +V  YGS +
Sbjct:  238 GRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGADPNTLIASYDR--LTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCSYKNLFAVCSYGSFR 399          

HSP 8 Score: 96.2857 bits (238), Expect = 1.702e-20
Identity = 55/161 (34.16%), Postives = 84/161 (52.17%), Query Frame = 1
Query: 1486 GTEEKIVFSYYLEEGTWRDIACTNKYL-AICTLNPNAGAKTADYHFTKVKM-------TFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQS--FATGLWVDSKCDDFNSVVC 1938
            G  E  +  Y   +G W D  C+ K L A+C+          +Y      +       T+  A  +C++ G ++VR++N+  N L+A  AK +  + YW+DGND+ EEGKWVD+N + + YKN+AA  PNG R +NC+ S     G W D  C +    +C
Sbjct:  363 GVNENCLNGYLSLDGLWNDFPCSYKNLFAVCSYGSFRLPYQENYDIDSDNLMVSAELYTYNEALQFCRTRGTQLVRIKNVADNGLVAAFAKKVVANLYWIDGNDHTEEGKWVDSNANLMQYKNWAATEPNGNRGENCIFSNYLEEGTWRDIACTNKYLAIC 523          

HSP 9 Score: 83.5741 bits (205), Expect = 1.940e-16
Identity = 41/100 (41.00%), Postives = 60/100 (60.00%), Query Frame = 1
Query: 1621 TKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSF--ATGLWVDSKC 1914
            TK  +T+  A   CKS G+++VRV +   N ++   A  +  DSYW+DGND   EG +V++  + L YKNF    PNGGR +NC+  +   +GLW D +C
Sbjct:   32 TKTLVTYNEALQTCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDIQC 131          
BLAST of Lectin 2b vs. Planmine SMEST
Match: SMESG000056362.1 (SMESG000056362.1)

HSP 1 Score: 858.21 bits (2216), Expect = 0.000e+0
Identity = 407/440 (92.50%), Postives = 422/440 (95.91%), Query Frame = 3
Query:  192 AVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVSTDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGADPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFEIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENCIF 1511
            AVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDI C +RIWAICQKDSEVSTDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGADPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPC YKNLFA+C+  S ++   EN++ID DN+MVSAE YTYNEALQFCRTRGTQL R+ +  DN ++AAFAKKVVA+ YWIDGNDHTEEGKWVDSNAN++ YKNWAATEPNGNRGENCIF
Sbjct:    5 AVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDIQCGSRIWAICQKDSEVSTDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGADPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCSYKNLFAVCSYGSFRLPYQENYDIDSDNLMVSAELYTYNEALQFCRTRGTQLVRIKNVADNGLVAAFAKKVVANLYWIDGNDHTEEGKWVDSNANLMQYKNWAATEPNGNRGENCIF 444          

HSP 2 Score: 396.741 bits (1018), Expect = 6.331e-130
Identity = 205/484 (42.36%), Postives = 290/484 (59.92%), Query Frame = 3
Query:   75 DIDVNTLFVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVSTDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHF-NLWVICYRSEIRAP-----GADPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFEIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENCI 1508
            +I+ N   V+K  +T+ +A + C +R ++++R+  A DNA+V+ FA +  +D YW+DGND   EG +V+S G  L YKNF   EP GGR ENC + Y     LWND+ C   +W IC + SE+       + N  + S  ++TF +AQ+YC A+ LKM+R  +A +NA+VH FAR   SDLYW+DGND   EGKWVDS+  DL +K F  GEP GG  ENC +GYL+ D LWND PC + NL+ +C     R P       D + L+ S +  T+ EA  +C+ +G ++VR  N A+N LV  FA+++ ++LYW+DGND   EGKWVDS  N +++K +   EPNG   ENC+      +G W D  C  K L AIC+++ L+     +F      M       T++ A  +C++ G +L RV     N ++     +   D YWIDGND+ EEGKWVDSN  VL Y+N+ A EP+G R +NCI
Sbjct:   94 EIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYR-SEIRAPG--ADPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCSYKNLFAVCSYGSFRLPYQENYDIDSDNLMVSAELYTYNEALQFCRTRGTQLVRIKNVADNGLVAAFAKKVVANLYWIDGNDHTEEGKWVDSNANLMQYKNWAATEPNGNRGENCIFSNYLEEGTWRDIACTNKYL-AICSRNPLEGDQAIDFHFTRSKM-------TFDSATSYCKSIGLRLIRVADAESNRLINLATIRHKLDTYWIDGNDNDEEGKWVDSNKTVLTYQNFNAGEPSGGRVKNCI 566          

HSP 3 Score: 268.47 bits (685), Expect = 6.687e-81
Identity = 143/367 (38.96%), Postives = 213/367 (58.04%), Query Frame = 3
Query:   81 DVNTLFVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLAR-IWAICQKDS--EVSTDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGADPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCPYKN 1172
            D NTL  +   +T+ EA   CK++G+++VR N+A +NA+V+GFA ++ +D YW+DGND   EG +V+S+ N L +K F   EPNGG +ENC+N Y    GLWND  C  + ++A+C   S      +  +I+ +  +VS    T+ +A ++C  R  +++RI +  DN +V +FA++  ++LYW+DGND   EGKWVDS+   + YKN+   EP G R ENC       +  W D+ C      IC R+ +    A       S  ++TF  A  YCK+ GL+++R  +A  N L++    R   D YW+DGND   EGKWVDS +  L ++ F+ GEP+GG  +NC+ G  S  G W D  C   N
Sbjct:  221 DPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCSYKNLFAVCSYGSFRLPYQENYDIDSDNLMVSAELYTYNEALQFCRTRGTQLVRIKNVADNGLVAAFAKKVVANLYWIDGNDHTEEGKWVDSNANLMQYKNWAATEPNGNRGENCIFSNYLEEGTWRDIACTNKYLAICSRNPLEGDQAIDFHFTRS--KMTFDSATSYCKSIGLRLIRVADAESNRLINLATIRHKLDTYWIDGNDNDEEGKWVDSNKTVLTYQNFNAGEPSGGRVKNCIQGTNS--GFWFDAQCSSSN 583          

HSP 4 Score: 211.075 bits (536), Expect = 1.543e-59
Identity = 113/265 (42.64%), Postives = 148/265 (55.85%), Query Frame = 3
Query:   18 NLFTVLTIFILITLDSCRSDIDVNTLFVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVSTDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICY 812
            NLF V +            DID + L V+  L TYNEALQ C++RG +LVR+ +  DN +V  FA KV+A+ YWIDGND T EG +V+S  NL+ YKN+   EPNG R ENCI    L  G W DI C  +  AIC ++       ++     F  ++ KMTF  A  YC +  L++IR+  A  N +++        D YW+DGND   EGKWVDS+   L Y+NF  GEP GGRV+NC  G       W D  C  +  V+CY
Sbjct:  331 NLFAVCSYGSFRLPYQENYDIDSDNLMVSAELYTYNEALQFCRTRGTQLVRIKNVADNGLVAAFAKKVVANLYWIDGNDHTEEGKWVDSNANLMQYKNWAATEPNGNRGENCIFSNYLEEGTWRDIACTNKYLAICSRNPLEGDQAID-----FHFTRSKMTFDSATSYCKSIGLRLIRVADAESNRLINLATIRHKLDTYWIDGNDNDEEGKWVDSNKTVLTYQNFNAGEPSGGRVKNCIQG--TNSGFWFDAQCSSSNAVVCY 588          

HSP 5 Score: 204.912 bits (520), Expect = 2.534e-57
Identity = 90/158 (56.96%), Postives = 120/158 (75.95%), Query Frame = 1
Query: 1495 EKIVFSYYLEEGTWRDIACTNKYLAICTLNPNAGAKTADYHFTKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSFATGLWVDSKCDDFNSVVCYGSIKRVSKF 1968
            E  +FS YLEEGTWRDIACTNKYLAIC+ NP  G +  D+HFT+ KMTF++A  YCKS+GL+++RV +  SNRL+  +    KLD+YW+DGNDN EEGKWVD+N + L Y+NF A  P+GGR KNC+Q   +G W D++C   N+VVCYG+++++ KF
Sbjct:  440 ENCIFSNYLEEGTWRDIACTNKYLAICSRNPLEGDQAIDFHFTRSKMTFDSATSYCKSIGLRLIRVADAESNRLINLATIRHKLDTYWIDGNDNDEEGKWVDSNKTVLTYQNFNAGEPSGGRVKNCIQGTNSGFWFDAQCSSSNAVVCYGALRKIVKF 597          

HSP 6 Score: 102.064 bits (253), Expect = 2.344e-22
Identity = 58/166 (34.94%), Postives = 80/166 (48.19%), Query Frame = 1
Query: 1486 GTEEKIVFSYYLEEGTWRDIACTNKYLAICTLNPNAGAKTAD-----YHFTKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSFAT--GLWVDSKCDDFNSVVCYGSIKRVS 1962
            G  E  +  Y L  G W DI C ++  AIC  +        +     +  +K KMTF  A  YC +  LK++R+ +   N ++   A+    D YW+DGND   EGKWVD++   L+YKNF    P GGR +NC   +     LW D  C     V+CY S  R  
Sbjct:   53 GRSENCINVYRLPSGLWNDIQCGSRIWAICQKDSEVSTDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAP 218          

HSP 7 Score: 97.0561 bits (240), Expect = 9.860e-21
Identity = 60/164 (36.59%), Postives = 81/164 (49.39%), Query Frame = 1
Query: 1486 GTEEKIVFSYYLEEGTWRDIACTNKYLAICTLN----PNAGAKTADYHFTKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSFAT--GLWVDSKCDDFN--SVVCYGSIK 1953
            G  E     Y   +  W D+ C      IC  +    P A   T    + +  +TF+ A  YCK+ GLK+VR  N   N L+   A+ +  D YWLDGND   EGKWVD+  + L +K F    PNGG ++NCL  + +  GLW D  C   N  +V  YGS +
Sbjct:  181 GRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGADPNTLIASYDR--LTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCSYKNLFAVCSYGSFR 342          

HSP 8 Score: 96.2857 bits (238), Expect = 1.778e-20
Identity = 55/161 (34.16%), Postives = 84/161 (52.17%), Query Frame = 1
Query: 1486 GTEEKIVFSYYLEEGTWRDIACTNKYL-AICTLNPNAGAKTADYHFTKVKM-------TFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQS--FATGLWVDSKCDDFNSVVC 1938
            G  E  +  Y   +G W D  C+ K L A+C+          +Y      +       T+  A  +C++ G ++VR++N+  N L+A  AK +  + YW+DGND+ EEGKWVD+N + + YKN+AA  PNG R +NC+ S     G W D  C +    +C
Sbjct:  306 GVNENCLNGYLSLDGLWNDFPCSYKNLFAVCSYGSFRLPYQENYDIDSDNLMVSAELYTYNEALQFCRTRGTQLVRIKNVADNGLVAAFAKKVVANLYWIDGNDHTEEGKWVDSNANLMQYKNWAATEPNGNRGENCIFSNYLEEGTWRDIACTNKYLAIC 466          

HSP 9 Score: 63.929 bits (154), Expect = 2.533e-10
Identity = 34/90 (37.78%), Postives = 50/90 (55.56%), Query Frame = 1
Query: 1675 LKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSF--ATGLWVDSKCDDFNSVVC 1938
            + +  V N  +N++LADS        YW+DGND   EG +V++  + L YKNF    PNGGR +NC+  +   +GLW D +C      +C
Sbjct:    1 MSIQAVVNGFANKVLADS--------YWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDIQCGSRIWAIC 82          
BLAST of Lectin 2b vs. Planmine SMEST
Match: SMESG000056368.1 (SMESG000056368.1)

HSP 1 Score: 635.18 bits (1637), Expect = 0.000e+0
Identity = 298/454 (65.64%), Postives = 361/454 (79.52%), Query Frame = 3
Query:  156 MRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVS--TDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGADPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFEIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENCIF 1511
            M+LV++NSAEDN VVNGFAN+V+ADSYWIDGND++ EG ++NSKG  L YKNF  N P+GG  ENCIN++RLPSGLWND  C  RIWAICQKD E    +D LEIEGN  +VS  K+TF+D+QEYCSAR LK+I++  A+DNAIVHSFARET SDLYW++ NDI  EG WVD+DG+ L +KNF  G P G R +NCA GYL+ D +W D+PC   LW ICY+  ++     PNTLI S++RLTF EA++YCKAQ + M++AN+AAENAL+HGFARRI +DLYWLDG+DAK EGKWV+S++  L HKGFHPGEPNGG  ENCLNGYL+LDGLWND+PC YKNLF  C+ + L++   EN+EI    +MVS+ERYTYNEALQFCRTRG QL R+NS+ DN ++AAFAKKVVA+YYWID NDHTEEG WVDSN   + YKN+A  EPNG R ENCIF
Sbjct:    1 MKLVQINSAEDNDVVNGFANQVIADSYWIDGNDQSREGQWMNSKGQELVYKNFAPNLPDGGIGENCINIFRLPSGLWNDYNCAVRIWAICQKDIESQGFSDHLEIEGNELIVSNTKLTFSDSQEYCSARGLKLIQVNSAMDNAIVHSFARETVSDLYWINANDIDKEGNWVDNDGRPLAHKNFAPGYPNGVRTKNCAEGYLHADGVWYDIPCDNKLWAICYKENLQPKSTYPNTLITSFERLTFNEAREYCKAQDMFMIQANSAAENALIHGFARRIVADLYWLDGSDAKTEGKWVNSDDVPLVHKGFHPGEPNGGRLENCLNGYLNLDGLWNDYPCNYKNLFGFCSTNPLQMPFLENYEIHKRFLMVSSERYTYNEALQFCRTRGAQLIRINSEEDNKVVAAFAKKVVANYYWIDANDHTEEGSWVDSNTQPVVYKNFAVHEPNGGRNENCIF 454          

HSP 2 Score: 320.087 bits (819), Expect = 7.812e-102
Identity = 157/378 (41.53%), Postives = 238/378 (62.96%), Query Frame = 3
Query:   75 DIDVNTLFVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVSTDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHF-NLWVICYRSEIRAPGAD-----PNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICA 1190
            +I+ N L V+ T +T++++ + C +RG++L++VNSA DNA+V+ FA + ++D YWI+ ND   EG +V++ G  L +KNF    PNG R++NC   Y    G+W DI C  ++WAIC K++           N  + S  ++TF +A+EYC A+ + MI+   A +NA++H FAR   +DLYW+DG+D  TEGKWV+SD   L++K F  GEP GGR+ENC +GYLN D LWND PC++ NL+  C  + ++ P  +        L+ S +R T+ EA  +C+ +G +++R N+  +N +V  FA+++ ++ YW+D ND   EG WVDS    + +K F   EPNGG NENC+  Y   +G W D  C  K+L AIC+
Sbjct:  104 EIEGNELIVSNTKLTFSDSQEYCSARGLKLIQVNSAMDNAIVHSFARETVSDLYWINANDIDKEGNWVDNDGRPLAHKNFAPGYPNGVRTKNCAEGYLHADGVWYDIPCDNKLWAICYKENLQPKSTYP---NTLITSFERLTFNEAREYCKAQDMFMIQANSAAENALIHGFARRIVADLYWLDGSDAKTEGKWVNSDDVPLVHKGFHPGEPNGGRLENCLNGYLNLDGLWNDYPCNYKNLFGFCSTNPLQMPFLENYEIHKRFLMVSSERYTYNEALQFCRTRGAQLIRINSEEDNKVVAAFAKKVVANYYWIDANDHTEEGSWVDSNTQPVVYKNFAVHEPNGGRNENCIFSYYMEEGTWRDVGCSTKHL-AICS 477          

HSP 3 Score: 99.3673 bits (246), Expect = 8.777e-22
Identity = 53/161 (32.92%), Postives = 83/161 (51.55%), Query Frame = 1
Query: 1486 GTEEKIVFSYYLEEGTWRDIACTNKYL-AICTLNPNAGAKTADYHFTKV-------KMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSF--ATGLWVDSKCDDFNSVVC 1938
            G  E  +  Y   +G W D  C  K L   C+ NP       +Y   K        + T+  A  +C++ G +++R+ +   N+++A  AK +  + YW+D ND+ EEG WVD+N   ++YKNFA   PNGGR++NC+ S+    G W D  C   +  +C
Sbjct:  316 GRLENCLNGYLNLDGLWNDYPCNYKNLFGFCSTNPLQMPFLENYEIHKRFLMVSSERYTYNEALQFCRTRGAQLIRINSEEDNKVVAAFAKKVVANYYWIDANDHTEEGSWVDSNTQPVVYKNFAVHEPNGGRNENCIFSYYMEEGTWRDVGCSTKHLAIC 476          

HSP 4 Score: 92.0485 bits (227), Expect = 2.235e-19
Identity = 53/176 (30.11%), Postives = 80/176 (45.45%), Query Frame = 1
Query: 1441 QMFYLTKIGQQLNQTGTEEKIVFSYYLEEGTWRDIACTNKYLAICTLNPNAGAKTADYHF-------TKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSF--ATGLWVDSKCDDFNSVVCY 1941
            Q          L   G  E  +  + L  G W D  C  +  AIC  +  +   +            +  K+TF  +  YC + GLK+++V +   N ++   A+    D YW++ ND  +EG WVD +   L +KNFA   PNG R KNC + +  A G+W D  CD+    +CY
Sbjct:   46 QELVYKNFAPNLPDGGIGENCINIFRLPSGLWNDYNCAVRIWAICQKDIESQGFSDHLEIEGNELIVSNTKLTFSDSQEYCSARGLKLIQVNSAMDNAIVHSFARETVSDLYWINANDIDKEGNWVDNDGRPLAHKNFAPGYPNGVRTKNCAEGYLHADGVWYDIPCDNKLWAICY 221          

HSP 5 Score: 91.2781 bits (225), Expect = 3.957e-19
Identity = 52/141 (36.88%), Postives = 75/141 (53.19%), Query Frame = 1
Query: 1513 YYLEEGTWRDIACTNKYLAIC---TLNPNAG-AKTADYHFTKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSFAT--GLWVDSKCD 1917
            Y   +G W DI C NK  AIC    L P +    T    F +  +TF  A  YCK+  + +++  +   N L+   A+ +  D YWLDG+D   EGKWV++++  L++K F    PNGGR +NCL  +    GLW D  C+
Sbjct:  200 YLHADGVWYDIPCDNKLWAICYKENLQPKSTYPNTLITSFER--LTFNEAREYCKAQDMFMIQANSAAENALIHGFARRIVADLYWLDGSDAKTEGKWVNSDDVPLVHKGFHPGEPNGGRLENCLNGYLNLDGLWNDYPCN 338          

HSP 6 Score: 74.3294 bits (181), Expect = 1.036e-13
Identity = 34/69 (49.28%), Postives = 47/69 (68.12%), Query Frame = 3
Query: 1311 QLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENCIFIL 1517
            +L ++NS  DN ++  FA +V+AD YWIDGND + EG+W++S    L YKN+A   P+G  GENCI I 
Sbjct:    2 KLVQINSAEDNDVVNGFANQVIADSYWIDGNDQSREGQWMNSKGQELVYKNFAPNLPDGGIGENCINIF 70          

HSP 7 Score: 71.633 bits (174), Expect = 7.423e-13
Identity = 32/82 (39.02%), Postives = 51/82 (62.20%), Query Frame = 1
Query: 1675 LKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSF--ATGLWVDSKC 1914
            +K+V++ +   N ++   A  +  DSYW+DGND + EG+W+++    L+YKNFA   P+GG  +NC+  F   +GLW D  C
Sbjct:    1 MKLVQINSAEDNDVVNGFANQVIADSYWIDGNDQSREGQWMNSKGQELVYKNFAPNLPDGGIGENCINIFRLPSGLWNDYNC 82          

HSP 8 Score: 54.299 bits (129), Expect = 1.900e-7
Identity = 20/34 (58.82%), Postives = 26/34 (76.47%), Query Frame = 1
Query: 1486 GTEEKIVFSYYLEEGTWRDIACTNKYLAICTLNP 1587
            G  E  +FSYY+EEGTWRD+ C+ K+LAIC+  P
Sbjct:  447 GRNENCIFSYYMEEGTWRDVGCSTKHLAICSTKP 480          
BLAST of Lectin 2b vs. Planmine SMEST
Match: SMESG000056365.1 (SMESG000056365.1)

HSP 1 Score: 414.075 bits (1063), Expect = 0.000e+0
Identity = 196/197 (99.49%), Postives = 197/197 (100.00%), Query Frame = 3
Query:  921 MVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFEIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENCIF 1511
            MVRANNAAENAL+HGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFEIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENCIF
Sbjct:    1 MVRANNAAENALIHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFEIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENCIF 197          

HSP 2 Score: 323.168 bits (827), Expect = 0.000e+0
Identity = 155/158 (98.10%), Postives = 156/158 (98.73%), Query Frame = 1
Query: 1495 EKIVFSYYLEEGTWRDIACTNKYLAICTLNPNAGAKTADYHFTKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSFATGLWVDSKCDDFNSVVCYGSIKRVSKF 1968
            E  +FSYYLEEGTWRDIACTNKYLAICTLNPNAGAKTADYHFTKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSFATGLWVDSKCDDFNSVVCYGSIKRVSKF
Sbjct:  193 ENCIFSYYLEEGTWRDIACTNKYLAICTLNPNAGAKTADYHFTKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSFATGLWVDSKCDDFNSVVCYGSIKRVSKF 350          

HSP 3 Score: 272.322 bits (695), Expect = 3.169e-85
Identity = 139/327 (42.51%), Postives = 196/327 (59.94%), Query Frame = 3
Query:  546 MIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHF-NLWVICYRSEIRAPG-----ADPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFEIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENCI 1508
            M+R  +A +NA++H FAR   SDLYW+DGND   EGKWVDS+  DL +K F  GEP GG  ENC +GYL+ D LWND PC + NL+ IC +  ++         D + ++ S +R T+ EA  +C+ +G ++ R N+  +NA++  FA+++ +D YW+DGND   EGKWVDS  N L +K +   EPNG   ENC+  Y   +G W D  C  K L AIC         N N      +   +  + T+  A  +C++ G ++ RV +   N +LA  AK +  D YW+DGND+ EEGKWVD+N + L YKN+AA  PNG R +NC+
Sbjct:    1 MVRANNAAENALIHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFEIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENCIFSYYLEEGTWRDIACTNKYL-AICTL-------NPNAGAKTADYHFTKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCL 319          

HSP 4 Score: 257.299 bits (656), Expect = 1.477e-79
Identity = 139/338 (41.12%), Postives = 198/338 (58.58%), Query Frame = 3
Query:  162 LVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLAR-IWAICQKDSEVSTD--QLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIRAPGADPNTLIASYD--RLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPC 1160
            +VR N+A +NA+++GFA ++ +D YW+DGND   EG +V+S+ N L +K F   EPNGG +ENC+N Y    GLWND  C  + ++AIC KDS    D    EI+ +  +VS  + T+ +A ++C  R  ++ R+   +DNA++ +FA++  +D YW+DGND   EGKWVDS+   L YKN+   EP G R ENC   Y   +  W D+ C      IC  +    P A   T    +   ++TF+ A  YCK+ GLK+VR  N   N L+   A+ +  D YWLDGND   EGKWVD+  + L +K F    PNGG ++NCL  + +  GLW D  C
Sbjct:    1 MVRANNAAENALIHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFEIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENCIFSYYLEEGTWRDIACTNKYLAICTLN----PNAGAKTADYHFTKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSFAT--GLWVDSKC 332          

HSP 5 Score: 208.764 bits (530), Expect = 3.569e-61
Identity = 114/270 (42.22%), Postives = 151/270 (55.93%), Query Frame = 3
Query:   18 NLFTVLTIFILITLDSCRSDIDVNTLFVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVSTDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYRSEIR 827
            NLF +     L   D+   +ID++ + V+    TYNEALQ C++RG +L RVNS  DNA++  FA KV+AD YWIDGND T EG +V+S  N+L YKN+   EPNG R ENCI  Y L  G W DI C  +  AIC  +        +     +  +K KMTF  A  YC +  LK++R+ +   N ++   A+    D YW+DGND   EGKWVD++   L+YKNF    P GGR +NC   +     LW D  C     V+CY S  R
Sbjct:   84 NLFAICAKDSLKIKDNENFEIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENCIFSYYLEEGTWRDIACTNKYLAICTLNPNAGAKTAD-----YHFTKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSFAT--GLWVDSKCDDFNSVVCYGSIKR 346          

HSP 6 Score: 96.2857 bits (238), Expect = 2.725e-21
Identity = 58/161 (36.02%), Postives = 82/161 (50.93%), Query Frame = 1
Query: 1486 GTEEKIVFSYYLEEGTWRDIACTNKYL-AICTL-------NPNAGAKTADYHFTKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSF--ATGLWVDSKCDDFNSVVC 1938
            G  E  +  Y   +G W D  C  K L AIC         N N      +   +  + T+  A  +C++ G ++ RV +   N +LA  AK +  D YW+DGND+ EEGKWVD+N + L YKN+AA  PNG R +NC+ S+    G W D  C +    +C
Sbjct:   59 GVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFEIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENCIFSYYLEEGTWRDIACTNKYLAIC 219          

HSP 7 Score: 68.9366 bits (167), Expect = 3.098e-12
Identity = 35/80 (43.75%), Postives = 46/80 (57.50%), Query Frame = 1
Query: 1681 VVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSFAT--GLWVDSKC 1914
            +VR  N   N L+   A+ +  D YWLDGND   EGKWVD+  + L +K F    PNGG ++NCL  + +  GLW D  C
Sbjct:    1 MVRANNAAENALIHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPC 80          
BLAST of Lectin 2b vs. Planmine SMEST
Match: SMESG000056364.1 (SMESG000056364.1)

HSP 1 Score: 402.519 bits (1033), Expect = 1.415e-137
Identity = 196/241 (81.33%), Postives = 210/241 (87.14%), Query Frame = 3
Query:   27 TVLTIFILITLDSCRSDIDVNTLFVTKTLVTYNEALQSCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVSTDQLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGY 749
            TVLTIFILITLDSCRSDIDVNTLFVTKTLVTYNEALQ+CKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNG                     CLARIWAICQKDSEVSTDQLEIEG++F+ SK KMTFA+AQEYC  R L+MIR+ HALDNA+VHSFARETNSDLYWVDGNDIVTEGKW+D+DG+DL+YKNF  GEP GGR+ENCA G+
Sbjct:    7 TVLTIFILITLDSCRSDIDVNTLFVTKTLVTYNEALQTCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNG--------------------VCLARIWAICQKDSEVSTDQLEIEGSMFLASKSKMTFAEAQEYCINRGLRMIRVNHALDNAVVHSFARETNSDLYWVDGNDIVTEGKWIDADGRDLVYKNFAPGEPNGGRIENCASGF 227          

HSP 2 Score: 187.193 bits (474), Expect = 9.896e-55
Identity = 93/225 (41.33%), Postives = 135/225 (60.00%), Query Frame = 3
Query:  459 EIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARETNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVICYR-SEIRAPG--ADPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGY 1124
            +I+ N   V+K  +T+ +A + C +R ++++R+  A DNA+V+ FA +  +D YW+DGND   EG +V+S G  L YKNF   EP G                     C   +W IC + SE+       + +  +AS  ++TF EAQ+YC  +GL+M+R N+A +NA+VH FAR   SDLYW+DGND   EGKW+D++  DL +K F PGEPNGG  ENC +G+
Sbjct:   23 DIDVNTLFVTKTLVTYNEALQTCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNG--------------------VCLARIWAICQKDSEVSTDQLEIEGSMFLASKSKMTFAEAQEYCINRGLRMIRVNHALDNAVVHSFARETNSDLYWVDGNDIVTEGKWIDADGRDLVYKNFAPGEPNGGRIENCASGF 227          

HSP 3 Score: 172.555 bits (436), Expect = 2.768e-49
Identity = 90/222 (40.54%), Postives = 132/222 (59.46%), Query Frame = 3
Query:  840 DPNTLIASYDRLTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKDNENFEIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENC 1505
            D NTL  +   +T+ EA   CK++G+++VR N+A +NA+V+GFA ++ +D YW+DGND   EG +V+S+ N L +K F   EPNG          + L  +W           AIC KDS    D    EI+    + S  + T+ EA ++C  RG ++ RVN  +DNA++ +FA++  +D YW+DGND   EGKW+D++   L YKN+A  EPNG R ENC
Sbjct:   25 DVNTLFVTKTLVTYNEALQTCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNG----------VCLARIW-----------AICQKDSEVSTDQ--LEIEGSMFLASKSKMTFAEAQEYCINRGLRMIRVNHALDNAVVHSFARETNSDLYWVDGNDIVTEGKWIDADGRDLVYKNFAPGEPNGGRIENC 223          

HSP 4 Score: 103.605 bits (257), Expect = 8.368e-25
Identity = 48/87 (55.17%), Postives = 63/87 (72.41%), Query Frame = 3
Query: 1227 EIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNG 1487
            +ID++ + V+    TYNEALQ C++RG +L RVNS  DNA++  FA KV+AD YWIDGND T EG +V+S  N+L YKN+   EPNG
Sbjct:   23 DIDVNTLFVTKTLVTYNEALQTCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNG 109          

HSP 5 Score: 86.2705 bits (212), Expect = 9.546e-19
Identity = 40/88 (45.45%), Postives = 54/88 (61.36%), Query Frame = 1
Query: 1621 TKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSF 1884
            +K KMTF  A  YC + GL+++RV +   N ++   A+    D YW+DGND   EGKW+D +   L+YKNFA   PNGGR +NC   F
Sbjct:  140 SKSKMTFAEAQEYCINRGLRMIRVNHALDNAVVHSFARETNSDLYWVDGNDIVTEGKWIDADGRDLVYKNFAPGEPNGGRIENCASGF 227          

HSP 6 Score: 65.4698 bits (158), Expect = 1.019e-11
Identity = 32/78 (41.03%), Postives = 46/78 (58.97%), Query Frame = 1
Query: 1621 TKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNG 1854
            TK  +T+  A   CKS G+++VRV +   N ++   A  +  DSYW+DGND   EG +V++  + L YKNF    PNG
Sbjct:   32 TKTLVTYNEALQTCKSRGMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNG 109          
The following BLAST results are available for this feature:
BLAST of Lectin 2b vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MRC18.619e-2120.33mannose receptor C-type 1 [Source:HGNC Symbol;Acc:... [more]
MRC22.609e-1520.76mannose receptor C type 2 [Source:HGNC Symbol;Acc:... [more]
CLEC3B1.661e-931.19C-type lectin domain family 3 member B [Source:HGN... [more]
CLEC3B2.948e-931.19C-type lectin domain family 3 member B [Source:HGN... [more]
CLEC3A6.873e-927.43C-type lectin domain family 3 member A [Source:HGN... [more]
back to top
BLAST of Lectin 2b vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
clec-515.681e-622.75C-type LECtin [Source:UniProtKB/TrEMBL;Acc:W6RTE8... [more]
clec-527.687e-622.90C-type LECtin [Source:UniProtKB/TrEMBL;Acc:Q17452... [more]
back to top
BLAST of Lectin 2b vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tfc6.189e-730.63gene:FBgn0035199 transcript:FBtr0072661[more]
tfc6.189e-730.63gene:FBgn0035199 transcript:FBtr0072660[more]
tfc3.506e-630.63gene:FBgn0035199 transcript:FBtr0072659[more]
back to top
BLAST of Lectin 2b vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-88n24.71.312e-1821.94si:dkey-88n24.7 [Source:ZFIN;Acc:ZDB-GENE-041014-9... [more]
si:dkey-88n24.71.128e-1721.37si:dkey-88n24.7 [Source:ZFIN;Acc:ZDB-GENE-041014-9... [more]
mrc1a1.344e-1721.56mannose receptor, C type 1a [Source:ZFIN;Acc:ZDB-G... [more]
si:ch73-335d12.22.486e-1622.79si:ch73-335d12.2 [Source:ZFIN;Acc:ZDB-GENE-060503-... [more]
si:ch73-335d12.22.486e-1622.79si:ch73-335d12.2 [Source:ZFIN;Acc:ZDB-GENE-060503-... [more]
back to top
BLAST of Lectin 2b vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
orc32.775e-2322.93origin recognition complex subunit 3 [Source:Xenba... [more]
orc31.914e-2222.45origin recognition complex subunit 3 [Source:Xenba... [more]
orc32.130e-2222.45origin recognition complex subunit 3 [Source:Xenba... [more]
orc35.086e-2222.33origin recognition complex subunit 3 [Source:Xenba... [more]
orc31.530e-1921.92origin recognition complex subunit 3 [Source:Xenba... [more]
back to top
BLAST of Lectin 2b vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mrc13.177e-1720.67mannose receptor, C type 1 [Source:MGI Symbol;Acc:... [more]
Mrc22.533e-1619.51mannose receptor, C type 2 [Source:MGI Symbol;Acc:... [more]
Mrc24.464e-1619.51mannose receptor, C type 2 [Source:MGI Symbol;Acc:... [more]
Clec3b1.508e-1030.65C-type lectin domain family 3, member b [Source:MG... [more]
Clec3a5.555e-926.55C-type lectin domain family 3, member a [Source:MG... [more]
back to top
BLAST of Lectin 2b vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P22897|MRC1_HUMAN3.787e-2020.33Macrophage mannose receptor 1 OS=Homo sapiens OX=9... [more]
sp|Q61830|MRC1_MOUSE1.928e-1620.67Macrophage mannose receptor 1 OS=Mus musculus OX=1... [more]
sp|Q4TU93|MRC2_RAT4.704e-1621.46C-type mannose receptor 2 OS=Rattus norvegicus OX=... [more]
sp|Q64449|MRC2_MOUSE3.122e-1519.51C-type mannose receptor 2 OS=Mus musculus OX=10090... [more]
sp|Q9UBG0|MRC2_HUMAN1.253e-1420.76C-type mannose receptor 2 OS=Homo sapiens OX=9606 ... [more]
back to top
BLAST of Lectin 2b vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q8WSX01.688e-11866.35Lectin 2b OS=Girardia tigrina OX=6162 GN=lec2b PE=... [more]
Q8WSW91.168e-11965.38Lectin 2c OS=Girardia tigrina OX=6162 GN=lec2c PE=... [more]
Q8WSX14.364e-11565.36Lectin 2a OS=Girardia tigrina OX=6162 GN=lec2a PE=... [more]
Q8WSX25.124e-7231.44Lectin 1 (Fragment) OS=Girardia tigrina OX=6162 GN... [more]
Q8WSW71.194e-5432.37Scarf3b OS=Girardia tigrina OX=6162 GN=scarf3b PE=... [more]
back to top
BLAST of Lectin 2b vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mrc1a2.677e-2322.58mannose receptor C-type 1 [Source:NCBI gene;Acc:10... [more]
mrc1a1.467e-1819.62mannose receptor C-type 1 [Source:NCBI gene;Acc:10... [more]
ENSAMXT00000053854.11.943e-1825.91pep primary_assembly:Astyanax_mexicanus-2.0:16:249... [more]
mrc22.002e-1819.71mannose receptor, C type 2 [Source:ZFIN;Acc:ZDB-GE... [more]
mrc22.507e-1819.71mannose receptor, C type 2 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Lectin 2b vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mrc28.978e-1220.39mannose receptor, C type 2 [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000005222.11.499e-1139.05pep scaffold:Pmarinus_7.0:GL492592:1201:2726:-1 ge... [more]
ENSPMAT00000003237.11.656e-829.91pep scaffold:Pmarinus_7.0:GL486820:4307:11265:1 ge... [more]
ENSPMAT00000009130.15.059e-629.59pep scaffold:Pmarinus_7.0:GL477920:28989:31537:1 g... [more]
ENSPMAT00000004475.18.788e-632.14pep scaffold:Pmarinus_7.0:GL476717:437869:441498:1... [more]
back to top
BLAST of Lectin 2b vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lectin 2b vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO495091.746e-2223.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495122.005e-1622.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384322.271e-1127.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317786.715e-925.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO264202.349e-825.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Lectin 2b vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mrc1a7.809e-1823.33mannose receptor C-type 1 [Source:NCBI gene;Acc:10... [more]
mrc1b4.184e-1722.33macrophage mannose receptor 1 [Source:NCBI gene;Ac... [more]
mrc1b5.248e-1721.95macrophage mannose receptor 1 [Source:NCBI gene;Ac... [more]
mrc28.133e-1619.74mannose receptor C type 2 [Source:NCBI gene;Acc:10... [more]
ENSORLT00000033058.14.828e-1132.46pep primary_assembly:ASM223467v1:21:6426657:643802... [more]
back to top
BLAST of Lectin 2b vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000056362.17.857e-13093.13SMESG000056362.1[more]
SMESG000056362.16.331e-13092.50SMESG000056362.1[more]
SMESG000056368.17.812e-10265.64SMESG000056368.1[more]
SMESG000056365.13.169e-8599.49SMESG000056365.1[more]
SMESG000056364.11.415e-13781.33SMESG000056364.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011012 ID=SMED30011012|Name=Lectin 2b|organism=Schmidtea mediterranea sexual|type=transcript|length=2023bp
ATTTATCGTTCGCAATGAATCTATTTACGGTGCTGACGATTTTTATATTG
ATTACATTGGACAGTTGCAGAAGTGACATTGATGTCAATACATTGTTCGT
TACAAAAACTTTAGTGACTTATAATGAAGCTTTACAAAGTTGTAAATCTC
GAGGAATGAGATTGGTTCGTGTGAACAGTGCTGAAGACAATGCTGTTGTT
AATGGATTTGCGAACAAAGTACTGGCAGATTCTTACTGGATTGATGGAAA
CGATGAGACTGCAGAAGGAATATTTGTCAACTCAAAAGGAAATTTATTAA
CTTACAAAAATTTCGGTACAAACGAGCCAAATGGGGGTCGGTCCGAGAAT
TGCATAAATGTTTACCGTCTACCAAGTGGATTGTGGAATGATATAACTTG
TCTCGCTCGAATTTGGGCAATTTGTCAAAAGGATTCGGAAGTTTCAACAG
ATCAGCTAGAAATTGAAGGAAATATTTTTGTTGTTTCGAAAGGAAAAATG
ACATTTGCCGATGCTCAAGAATATTGTAGCGCTCGAAGTTTAAAAATGAT
TCGAATAGGCCATGCTTTAGATAATGCAATTGTACACAGTTTCGCCCGAG
AGACCAACTCTGACCTTTACTGGGTCGATGGAAATGATATCGTTACGGAA
GGCAAATGGGTAGATTCTGATGGAAAAGATCTAATTTACAAAAATTTTCC
TGTTGGAGAACCTGGGGGTGGAAGAGTTGAAAATTGTGCTCATGGTTATT
TAAATTATGATAGTTTATGGAATGATTTACCATGTCATTTTAATCTATGG
GTGATTTGTTATAGAAGTGAAATAAGAGCACCCGGTGCAGACCCAAATAC
TCTCATTGCTTCATACGACCGATTAACTTTCCAGGAAGCCCAGGATTACT
GCAAAGCACAAGGTCTTAAAATGGTCAGAGCAAATAATGCCGCTGAAAAT
GCACTTGTTCATGGATTCGCAAGAAGAATAACAAGTGATCTTTATTGGCT
TGATGGAAATGATGCAAAGTTAGAAGGCAAATGGGTCGATTCGGAGGAAA
ATGATTTGAAACATAAAGGTTTTCATCCAGGAGAACCAAATGGAGGAGTA
AATGAAAACTGTTTAAATGGATATTTATCTTTGGATGGTTTATGGAACGA
CTTTCCATGTCCATATAAAAATCTTTTTGCAATTTGTGCGAAAGATTCAT
TAAAAATAAAAGATAACGAAAACTTTGAGATAGACATGGACAACATGATG
GTGTCAGCAGAAAGATACACTTATAATGAAGCCTTACAGTTCTGTCGAAC
CCGTGGTACCCAACTTGCACGGGTTAACAGTCAAGTAGATAATGCAATGC
TTGCAGCTTTTGCAAAGAAAGTTGTCGCAGATTATTATTGGATTGACGGT
AATGATCATACAGAAGAAGGTAAATGGGTTGATTCAAATGCAAATGTTTT
ACCTTACAAAAATTGGGCAGCAACTGAACCAAACGGGAACCGAGGAGAAA
ATTGTATTTTCATATTACTTAGAAGAAGGGACATGGAGGGATATTGCATG
CACCAATAAATACCTTGCTATTTGTACCTTAAACCCAAATGCCGGAGCCA
AAACAGCTGATTATCATTTCACAAAAGTAAAAATGACATTTGAAGCCGCT
GCTCTTTACTGCAAAAGCGTCGGATTGAAAGTCGTTCGAGTTAGAAATTT
AAATTCCAACAGATTATTGGCTGATTCAGCGAAATATTTGAAACTAGACT
CCTATTGGTTGGATGGAAATGATAATGCGGAAGAAGGAAAATGGGTTGAC
ACCAATAACAGTACACTCCTTTATAAAAATTTTGCAGCTGAGGCACCAAA
CGGAGGTCGTGATAAAAACTGTCTTCAATCTTTCGCAACTGGATTGTGGG
TTGATAGCAAATGTGACGACTTCAATTCGGTGGTATGCTATGGATCCATC
AAGAGAGTTTCAAAATTCTAAGGAATTAATTAATAGTCAACAATATTGAT
ATAAAATGAAATATTTGCGCTAT
back to top

protein sequence of SMED30011012-orf-1

>SMED30011012-orf-1 ID=SMED30011012-orf-1|Name=SMED30011012-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=519bp
LSFAMNLFTVLTIFILITLDSCRSDIDVNTLFVTKTLVTYNEALQSCKSR
GMRLVRVNSAEDNAVVNGFANKVLADSYWIDGNDETAEGIFVNSKGNLLT
YKNFGTNEPNGGRSENCINVYRLPSGLWNDITCLARIWAICQKDSEVSTD
QLEIEGNIFVVSKGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARE
TNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYL
NYDSLWNDLPCHFNLWVICYRSEIRAPGADPNTLIASYDRLTFQEAQDYC
KAQGLKMVRANNAAENALVHGFARRITSDLYWLDGNDAKLEGKWVDSEEN
DLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSL
KIKDNENFEIDMDNMMVSAERYTYNEALQFCRTRGTQLARVNSQVDNAML
AAFAKKVVADYYWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGEN
CIFILLRRRDMEGYCMHQ*
back to top

protein sequence of SMED30011012-orf-2

>SMED30011012-orf-2 ID=SMED30011012-orf-2|Name=SMED30011012-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=210bp
MQCLQLLQRKLSQIIIGLTVMIIQKKVNGLIQMQMFYLTKIGQQLNQTGT
EEKIVFSYYLEEGTWRDIACTNKYLAICTLNPNAGAKTADYHFTKVKMTF
EAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLDSYWLDGNDNAEEGK
WVDTNNSTLLYKNFAAEAPNGGRDKNCLQSFATGLWVDSKCDDFNSVVCY
GSIKRVSKF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR033991Selectin_CTLD
IPR001304C-type_lectin-like
IPR016186C-type_lectin-like/link_sf
IPR018378C-type_lectin_CS
IPR016187CTDL_fold
Vocabulary: molecular function
TermDefinition
GO:0030246carbohydrate binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001304C-type lectin-likeSMARTSM00034CLECT_2coord: 147..270
e-value: 6.9E-10
score: 48.8
coord: 22..142
e-value: 1.1E-16
score: 71.5
IPR001304C-type lectin-likePFAMPF00059Lectin_Ccoord: 38..143
e-value: 1.5E-12
score: 48.2
coord: 165..271
e-value: 7.8E-8
score: 33.0
IPR001304C-type lectin-likePROSITEPS50041C_TYPE_LECTIN_2coord: 154..270
score: 13.837
IPR001304C-type lectin-likePROSITEPS50041C_TYPE_LECTIN_2coord: 26..142
score: 15.719
IPR016186C-type lectin-like/link domain superfamilyGENE3DG3DSA:3.10.100.10coord: 145..271
e-value: 3.1E-22
score: 80.7
coord: 16..144
e-value: 1.6E-26
score: 94.6
NoneNo IPR availablePANTHERPTHR22802C-TYPE LECTIN SUPERFAMILY MEMBERcoord: 158..273
NoneNo IPR availablePANTHERPTHR22802:SF358coord: 38..146
NoneNo IPR availablePANTHERPTHR22802C-TYPE LECTIN SUPERFAMILY MEMBERcoord: 38..146
NoneNo IPR availablePANTHERPTHR22802:SF358coord: 158..273
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..24
score: 0.744
IPR018378C-type lectin, conserved sitePROSITEPS00615C_TYPE_LECTIN_1coord: 117..141
IPR018378C-type lectin, conserved sitePROSITEPS00615C_TYPE_LECTIN_1coord: 245..269
IPR033991Selectin, C-type lectin-like domainCDDcd03592CLECT_selectins_likecoord: 29..143
e-value: 3.98204E-49
score: 156.767
IPR016187C-type lectin foldSUPERFAMILYSSF56436C-type lectin-likecoord: 150..271
IPR016187C-type lectin foldSUPERFAMILYSSF56436C-type lectin-likecoord: 32..143