Potassium channel subfamily K member 18

Overview
NamePotassium channel subfamily K member 18
Smed IDSMED30011009
Length (bp)2035
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Potassium channel subfamily K member 18 (SMED30011009) t-SNE clustered cells

Violin plots show distribution of expression levels for Potassium channel subfamily K member 18 (SMED30011009) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Potassium channel subfamily K member 18 (SMED30011009) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Potassium channel subfamily K member 18 (SMED30011009) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Human
Match: KCNK18 (potassium two pore domain channel subfamily K member 18 [Source:HGNC Symbol;Acc:HGNC:19439])

HSP 1 Score: 77.411 bits (189), Expect = 1.713e-14
Identity = 52/182 (28.57%), Postives = 84/182 (46.15%), Query Frame = 2
Query:  236 KTKQCCKRFFTFLFSHIGLSAILVGYVIIGGFMFQSLEISNEINTKKRVKDHRNDFIKATIKNLISLNLTWNNTDIMNNSSDINKSGNQTLLNNYLTMVIINYTNNVIFFMQEEGWNGNDDVTALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLA 781
            + ++CC      LF  +     LV Y ++G  +F ++E     + +  V     +F K  ++ L           I+N S  + +   Q L   +L  V   + N                    +WS+  +L +  TV +T+GYG++ P T+LGK++ MLYAL GIPL FL L++ GD LA
Sbjct:    8 QARRCCPEALGKLFPGLCFLCFLVTYALVGAVVFSAIE-----DGQVLVAADDGEFEK-FLEEL---------CRILNCSETVVEDRKQDL-QGHLQKVKPQWFNRTT-----------------HWSFLSSLFFCCTVFSTVGYGYIYPVTRLGKYLCMLYALFGIPLMFLVLTDTGDILA 156          

HSP 2 Score: 52.7582 bits (125), Expect = 1.308e-6
Identity = 43/142 (30.28%), Postives = 75/142 (52.82%), Query Frame = 2
Query: 1490 RSNSFTPDINFVTESIRQVSYVSVNNIMEIENEVKSNNHKTVKLRNATVPISLSLTVXXXXXXXXXXXFTVW-GDLDFLKWSYFCFITLSTIGFGDIVPGTKVDSKNPKEKLIIVSIYVIIGLSVFAMCFKLMQEEVVAKFK 1912
            RSNS  P++      + ++SY  ++N+ E+  +V+  +          +P+ +   +++ YI   A I   W   LDF    YFCF+TL+TIGFGD    T ++  N     +  SIY+I+G+ +  + FKL+Q  ++  +K
Sbjct:  249 RSNS-CPEL-----VLGRLSYSIISNLDEVGQQVERLD----------IPLPIIALIVFAYISCAAAILPFWETQLDFENAFYFCFVTLTTIGFGD----TVLEHPN---FFLFFSIYIIVGMEIVFIAFKLVQNRLIDIYK 367          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Human
Match: KCNK9 (potassium two pore domain channel subfamily K member 9 [Source:HGNC Symbol;Acc:HGNC:6283])

HSP 1 Score: 75.0998 bits (183), Expect = 7.145e-14
Identity = 31/77 (40.26%), Postives = 48/77 (62.34%), Query Frame = 2
Query:  602 TALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHKVCRKYCKM 832
              + W + G+  + +TVITTIGYGH AP T  GK   M YA+LGIPLT +   ++G+ +  + R++  ++ +K C M
Sbjct:   62 AGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLGERMNTFVRYLLKRI-KKCCGM 137          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Human
Match: KCNK9 (potassium two pore domain channel subfamily K member 9 [Source:HGNC Symbol;Acc:HGNC:6283])

HSP 1 Score: 75.0998 bits (183), Expect = 7.776e-14
Identity = 31/77 (40.26%), Postives = 48/77 (62.34%), Query Frame = 2
Query:  602 TALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHKVCRKYCKM 832
              + W + G+  + +TVITTIGYGH AP T  GK   M YA+LGIPLT +   ++G+ +  + R++  ++ +K C M
Sbjct:   74 AGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLGERMNTFVRYLLKRI-KKCCGM 149          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Human
Match: KCNK9 (potassium two pore domain channel subfamily K member 9 [Source:HGNC Symbol;Acc:HGNC:6283])

HSP 1 Score: 75.0998 bits (183), Expect = 7.776e-14
Identity = 31/77 (40.26%), Postives = 48/77 (62.34%), Query Frame = 2
Query:  602 TALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHKVCRKYCKM 832
              + W + G+  + +TVITTIGYGH AP T  GK   M YA+LGIPLT +   ++G+ +  + R++  ++ +K C M
Sbjct:   74 AGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLGERMNTFVRYLLKRI-KKCCGM 149          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Human
Match: KCNK9 (potassium two pore domain channel subfamily K member 9 [Source:HGNC Symbol;Acc:HGNC:6283])

HSP 1 Score: 75.0998 bits (183), Expect = 7.776e-14
Identity = 31/77 (40.26%), Postives = 48/77 (62.34%), Query Frame = 2
Query:  602 TALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHKVCRKYCKM 832
              + W + G+  + +TVITTIGYGH AP T  GK   M YA+LGIPLT +   ++G+ +  + R++  ++ +K C M
Sbjct:   74 AGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLGERMNTFVRYLLKRI-KKCCGM 149          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Celegans
Match: twk-48 (TWiK family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q7YWY7])

HSP 1 Score: 134.42 bits (337), Expect = 3.867e-34
Identity = 77/228 (33.77%), Postives = 126/228 (55.26%), Query Frame = 2
Query:  218 QKERIEKTKQCCKRFFTFLFSHIGLSAILVGYVIIGGFMFQSLEISNEINTKKRVKDHRNDFIKATIKNLISLNLTWNNTDIMNNSSDINKSGNQTLLNNYLTMVIINYTNNVIFFMQEEGWNGNDDVTALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHKVCR-KYCKMCCQKSRKHHSGLRSKLIKANAF 898
            ++ ++ +     K+   F FSHIGL A++VGY ++G  +F+++E  +E   ++ VK  R            ++++ WN T  +N     +K   +T+L+       +     V      +G++G +      W++ GA LY LTVITTIGYG+ A KT +GK +TMLYA++GIPL  L+L+NIGD +A  FRF+Y +  R K+  +   K RK      +K+ +AN+ 
Sbjct:    6 RRSKVTRVVNLVKKIIAFFFSHIGLCALVVGYALLGAVIFKAVEGPHEAEIQELVKSAREK----------AVDVVWNATFRVNRLD--SKQWKKTVLDE------VKRFKTVCMLSIRKGYDGKEYGKQAQWTFTGAFLYSLTVITTIGYGNTAAKTYIGKTLTMLYAIIGIPLMLLFLTNIGDVMAKIFRFLYAQSIRLKFRLILWHKKRKA-----AKIRRANSL 210          

HSP 2 Score: 87.8113 bits (216), Expect = 2.034e-18
Identity = 49/110 (44.55%), Postives = 72/110 (65.45%), Query Frame = 2
Query: 1571 MEIENEVKSNNHKTVKLRNATVPISLSLTVXXXXXXXXXXXFTVWGDLDFLKWSYFCFITLSTIGFGDIVPGTKV-DSKNPKEKLIIVSIYVIIGLSVFAMCFKLMQEEV 1897
            +E+E +++       +L + TVPISL +  +  Y+ +G  IF VW    FL+  YFCFI+L+TIGFGD  P T V ++   +EKL+I SIY++ G+++ AMCF L QEEV
Sbjct:  245 VEME-QLEVRETAAAQLESMTVPISLVVFTMLGYLGVGTTIFKVWEGWTFLESFYFCFISLTTIGFGDKFPSTSVSNTDEAQEKLVITSIYLLFGMALLAMCFNLAQEEV 353          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Celegans
Match: twk-39 (TWiK family of potassium channels [Source:UniProtKB/TrEMBL;Acc:A1EHR5])

HSP 1 Score: 125.946 bits (315), Expect = 6.992e-30
Identity = 71/215 (33.02%), Postives = 121/215 (56.28%), Query Frame = 2
Query:  233 EKTKQCCKRFFTFL-------FSHIGLSAILVGYVIIGGFMFQSLEISNEINTKKRVKDHRNDFIKATIKNLISLNLTWNNTDIMNNSSDINKSGNQTLLNNYLTMVIINYTNNVIFFMQEEGWNGNDDVT-ALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHKVCRKYCKMCCQKSRK 853
            ++ +  C +F TF+        +H+GL  ++  Y + G FMFQ++E   E+  + +VK+       A++K +  +    N  +++  ++  N+S  Q  L  +  +++          M  EG++ +D+      W++ GALLY +TV TTIGYGH+ PKT  G+ +T+LY++LGIPL  L L+NI + LA  F +IY K+C  YC+   QK+R+
Sbjct:    3 DEVRSFCLKFTTFVKSATIFTITHVGLCFLVALYAVAGAFMFQAVEYPYELGLQGKVKN-------ASLKVVDDIYRFINRKNVIEETAVKNES--QWALKEFEMLLV--------HAMNFEGYDEHDEERPTFQWTFSGALLYSITVFTTIGYGHICPKTDTGRLLTILYSILGIPLMLLCLANIAETLAQVFTYIYFKLCCAYCRW--QKNRR 198          

HSP 2 Score: 94.7449 bits (234), Expect = 5.033e-20
Identity = 45/114 (39.47%), Postives = 79/114 (69.30%), Query Frame = 2
Query: 1583 NEVKSNNHKTVKLRNATVPISLSLTVXXXXXXXXXXXFTVWGDLDFLKWSYFCFITLSTIGFGDIVPGTKVDSKNPKEKLIIVSIYVIIGLSVFAMCFKLMQEEVVAKFKRLGR 1924
            + ++ N H+        +P+S+ + +++ +I  GA +F+ W + +    +Y+CFITLSTIGFGDIVPG  +D +  +EKL++ ++Y++ G+++ AMCFKLMQ++VV K + LG+
Sbjct:  479 HSLRRNGHRN----QEKMPVSVGICIVFAFISGGAWLFSWWENWNGFDGAYYCFITLSTIGFGDIVPGQALD-EGSQEKLVVCALYLLFGMALIAMCFKLMQDDVVQKARWLGQ 587          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Celegans
Match: twk-39 (TWiK family of potassium channels [Source:UniProtKB/TrEMBL;Acc:A1EHR5])

HSP 1 Score: 125.946 bits (315), Expect = 7.991e-30
Identity = 71/215 (33.02%), Postives = 121/215 (56.28%), Query Frame = 2
Query:  233 EKTKQCCKRFFTFL-------FSHIGLSAILVGYVIIGGFMFQSLEISNEINTKKRVKDHRNDFIKATIKNLISLNLTWNNTDIMNNSSDINKSGNQTLLNNYLTMVIINYTNNVIFFMQEEGWNGNDDVT-ALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHKVCRKYCKMCCQKSRK 853
            ++ +  C +F TF+        +H+GL  ++  Y + G FMFQ++E   E+  + +VK+       A++K +  +    N  +++  ++  N+S  Q  L  +  +++          M  EG++ +D+      W++ GALLY +TV TTIGYGH+ PKT  G+ +T+LY++LGIPL  L L+NI + LA  F +IY K+C  YC+   QK+R+
Sbjct:    3 DEVRSFCLKFTTFVKSATIFTITHVGLCFLVALYAVAGAFMFQAVEYPYELGLQGKVKN-------ASLKVVDDIYRFINRKNVIEETAVKNES--QWALKEFEMLLV--------HAMNFEGYDEHDEERPTFQWTFSGALLYSITVFTTIGYGHICPKTDTGRLLTILYSILGIPLMLLCLANIAETLAQVFTYIYFKLCCAYCRW--QKNRR 198          

HSP 2 Score: 94.7449 bits (234), Expect = 5.369e-20
Identity = 45/114 (39.47%), Postives = 79/114 (69.30%), Query Frame = 2
Query: 1583 NEVKSNNHKTVKLRNATVPISLSLTVXXXXXXXXXXXFTVWGDLDFLKWSYFCFITLSTIGFGDIVPGTKVDSKNPKEKLIIVSIYVIIGLSVFAMCFKLMQEEVVAKFKRLGR 1924
            + ++ N H+        +P+S+ + +++ +I  GA +F+ W + +    +Y+CFITLSTIGFGDIVPG  +D +  +EKL++ ++Y++ G+++ AMCFKLMQ++VV K + LG+
Sbjct:  479 HSLRRNGHRN----QEKMPVSVGICIVFAFISGGAWLFSWWENWNGFDGAYYCFITLSTIGFGDIVPGQALD-EGSQEKLVVCALYLLFGMALIAMCFKLMQDDVVQKARWLGQ 587          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Celegans
Match: twk-26 (TWiK family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q21467])

HSP 1 Score: 89.7373 bits (221), Expect = 1.673e-18
Identity = 62/209 (29.67%), Postives = 103/209 (49.28%), Query Frame = 2
Query:  221 KERIEKT-KQCCKRFFTFL--------FSHIGLSAILVGYVIIGGFMFQSLEISNEINTKKRVKDHRNDFIKATIKNLISLNLTWNNTDIMNNSSDINKSGNQTLLNNYLTMVIINYTNNVIFFMQEEG------WNGNDDVTA-LNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFI 799
            KER ++  KQ   RFF +L          H+ L A+LVGYV +GGFMF+ LE   E+   K         I     ++I++ L+ N TD +N  + + K   +T+L                   + EG      W+  +++   L W +  A  Y +T+ +TIGYG ++ +T  G+ ++M+YA +G+P+  + L +IG    +WF+ I
Sbjct:   57 KERKKQIRKQKITRFFAWLAYYHHKFGIRHVTLIALLVGYVFLGGFMFEKLESPRELEDLKETIVLMQGIIDEETTDIINVTLSTNGTDRVNKLAKLIKRYYKTML-------------------EAEGRFHGSVWHKAENLDMHLMWYFSSATFYSMTLFSTIGYGTISCQTVWGRTLSMIYASIGLPIMLVVLGDIG----EWFQKI 242          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Celegans
Match: twk-17 (Putative potassium channel subunit n2P17m2-1; TWiK family of potassium channels [Source:UniProtKB/TrEMBL;Acc:O76794])

HSP 1 Score: 89.3521 bits (220), Expect = 2.230e-18
Identity = 54/186 (29.03%), Postives = 88/186 (47.31%), Query Frame = 2
Query:  281 HIGLSAILVGYVIIGGFMFQSLEISNEINTKKRVKDHRNDFIKATIKNLISLNLTWNNTDIMNNSSDINKSGNQTLLNNYLTMVIINYTNNVIFFMQEEGWNGNDDVTALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHKVCRKYCKMCC 838
            H+GL+ +L+ Y+ +G  +F  LE  +E+  +K    H  D     +   I+L          NN SD  ++   + +   L  +   +  +  F    + W G  D     W++  A LY LTVIT+ GY HV P T  G+  T+ + L+GIPL F+  ++IG +L++        V R Y K+  
Sbjct:  143 HVGLNVLLLSYIAMGATVFIWLEADHELEGRKAKVKHVFDIYSQIMNETIALT---------NNQSD--QATIVSRMRPLLESLSRAHEYDDKFTDTNQLWTGEQDGMTTRWTFAAATLYALTVITSTGYDHVTPATDPGRIFTVFFGLIGIPLMFITAADIGKFLSE-------IVIRTYAKLLA 310          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Fly
Match: sand (gene:FBgn0033257 transcript:FBtr0088780)

HSP 1 Score: 125.561 bits (314), Expect = 8.554e-31
Identity = 79/206 (38.35%), Postives = 117/206 (56.80%), Query Frame = 2
Query:  218 QKERIEKTKQCCKRFFTFLFSHIGLSAILVGYVIIGGFMFQSLEISNEINTKKRVKDHRNDFIKATIKNLISLNLTWNNTDIMNNSSDINKSGNQTLLNNYLTMVIINYTNNVIFFMQEEGWNGNDDVTALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHKVCRKYCKMC 835
            +K   E+ K  C+ F  F+FS++G+  ++  Y+I G F+FQS+EI  E    K  K HR  FI         L+  W  T    N S  +    +  +N+    V+++Y   ++    ++   G D      WS+ GA LY LTVITTIGYG++ P ++ GK +T+LYA++G+PL  LYLSNIGD LA  F++IY KVC   C++C
Sbjct:   12 EKPAFERFKDHCRHFTAFMFSNVGIILLVTFYIIGGAFIFQSIEIF-EYERLKSEKPHR--FIARNFSGE-CLSRIWELT--AENISFFDHHAYRRRVND----VLLDYQRAIV----KKQLKGPD---VEQWSFSGAFLYSLTVITTIGYGNITPHSECGKLVTILYAIIGMPLFLLYLSNIGDVLAKSFKWIYSKVC--LCRIC 198          

HSP 2 Score: 88.1965 bits (217), Expect = 2.720e-18
Identity = 48/120 (40.00%), Postives = 78/120 (65.00%), Query Frame = 2
Query: 1574 EIENEVKSNNHKTVKLRNATVPISLSLTVXXXXXXXXXXXFTVWGDLDFLKWSYFCFITLSTIGFGDIVPGTKV---DSKNPKEKLIIVSIYVIIGLSVFAMCFKLMQEEVVAKFKRLGR 1924
            +IE E++ +  +       TVP+++ + V+  YI+ GA++F  W D ++L  SYFC I+LS+IGFGD+VPG +V   D    +   I+ +IY+++G++V AMCF LMQE+VV   + + R
Sbjct:  271 DIEREIRGSTDEI------TVPVTVCVFVMVGYILWGALLFGRWEDWNYLDGSYFCLISLSSIGFGDLVPGDRVITADRDKVEVSFILCAIYLLLGMAVIAMCFNLMQEQVVHNIRAIKR 384          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Fly
Match: CG9194 (gene:FBgn0035192 transcript:FBtr0072651)

HSP 1 Score: 127.487 bits (319), Expect = 3.715e-30
Identity = 67/213 (31.46%), Postives = 120/213 (56.34%), Query Frame = 2
Query:  257 RFFTFLFSHIGLSAILVGYVIIGGFMFQSLEISNEINTKKRVKDHRNDFIKATIKNLISLNLTWNNTDIMNNSSDINKSGNQTLLNNYLTMVIINYTNNVIFFMQEEGWNGNDDVTALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHKVCRKYCKMCCQKSRKHHSGLRSKLIKANA 895
            +  T + SH+ L  ++V Y + G ++FQ LE  +E+  K+ +++ R             +NLT N   + +++  + +S     ++ +L     N+   ++  ++ +GW+G++D+    W++ G+L Y + VITTIGYGH++P+T  GK  T+ YA++GIPL  + LSNIGD +A  FRF+Y ++C   C    ++ R   S  RS   + +A
Sbjct:   33 KVLTCIVSHVLLVLLVVSYCVGGAYLFQHLERPHELEVKRDIQNLR-------------VNLTENIWLLSDDAVVLRESDWMANVSKHLA----NFEKQILTAIKADGWDGDEDLRKSQWTFAGSLFYSIIVITTIGYGHISPRTDWGKVTTIFYAIVGIPLMLICLSNIGDVMATSFRFLYWRICCYVCTRTAKRPRNARSRQRSMRSQRHA 228          

HSP 2 Score: 78.1814 bits (191), Expect = 1.398e-14
Identity = 41/101 (40.59%), Postives = 66/101 (65.35%), Query Frame = 2
Query: 1622 RNATVPISLSLTVXXXXXXXXXXXFTVWGDLDFLKWSYFCFITLSTIGFGDIVPGTKVDSKNPKEKLIIVSIYVIIGLSVFAMCFKLMQEEVVAKFKRLGR 1924
            ++  VPI L + ++  YI+ GA++F  W +  FL  +YFCFITL+TIGFGD VP   V  ++ ++ +   S+Y++ G+++ AM F L+QEE +A  K + R
Sbjct:  615 KDRPVPIWLCVFLVVSYILGGAVLFAYWENWSFLDSAYFCFITLTTIGFGDFVPAKGVKDES-EQSIAYCSLYLLFGIALLAMSFNLVQEEFIANVKEVAR 714          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Fly
Match: CG1688 (gene:FBgn0027589 transcript:FBtr0088495)

HSP 1 Score: 110.538 bits (275), Expect = 1.048e-24
Identity = 66/235 (28.09%), Postives = 105/235 (44.68%), Query Frame = 2
Query:  242 KQCCKRFFTFLFSHIGLSAILVGYVIIGGFMFQSLEISNEINTKKRVKDHRNDFIKATIKNLISLNLTWNNTDIMNNSSDINKSGNQTLLNNYLTMVIINYTNNVIFFMQEE----GWNGNDDVTALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHKVCRKYCKMCCQKSRKHHSGLRSKLIKANAFPGMSKKVIKRDR 934
            ++CC      LFS  GL  +++GY ++GG +F  LE   +I+    +   R D ++        LN+ +     M     + +     +          +       F +      G  G D   + +WS+  ALLY +TVITTIG+G + P+T  GK  T+ YAL+G+PL  + LS++G  LAD  +         Y ++CCQ  R  H   R K     + P  S     R++
Sbjct:   63 RRCCGHLLKLLFSTPGLVLLVIGYSVLGGLLFPLLEAPQDISKSAAIAKSREDCLRELWIITEKLNVLYERNWTMLVHEQLRRFEGSIVAATRQGSAGSSGGGGAGLFHEGSASALGHFGYDAGDSQSWSFSEALLYSVTVITTIGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSLGALLADGLQCT-------YVRLCCQLQR--HQEHRRKSTPGTSTPSASSAANSREK 288          

HSP 2 Score: 70.4774 bits (171), Expect = 3.385e-12
Identity = 37/95 (38.95%), Postives = 61/95 (64.21%), Query Frame = 2
Query: 1634 VPISLSLTVXXXXXXXXXXXFTVWGDLDFLKWSYFCFITLSTIGFGDIVPGTKVDSKNPKEKLIIVSIYVIIGLSVFAMCFKLMQEEVVAKFKRL 1918
            VPISL L ++  YI +G +IF +W +   +  +YFCF+TLSTIG+GD VP    +   P+ +L     Y+++GL + AM F +++ +++ K KR+
Sbjct:  815 VPISLVLLILASYICVGTVIFALWENWSLVDGAYFCFVTLSTIGYGDFVPARSFN--GPELQLYACCAYLLLGLVLVAMSFSILETQLMWKCKRI 907          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Fly
Match: CG10864 (gene:FBgn0038621 transcript:FBtr0083654)

HSP 1 Score: 95.5153 bits (236), Expect = 1.107e-20
Identity = 58/195 (29.74%), Postives = 97/195 (49.74%), Query Frame = 2
Query:  233 EKTKQCCKRFFTFLFSHIGLSAILVGYVIIGGFMFQSLEISNEINTKKRVKDHRNDFIKATIKNLISL--NLTWNNTDIMNNSSDINKSGNQTLLNNYLTMVIINYTNNVIFFMQEEGWNGNDDVTALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHKV 811
            ++ K+CC+ F TF+ + +G+ A++V Y I G F F  +E                 F+  T  +++ L  N +     I    + I++       N+    V+  Y + +   ++  G+ G        WS+  AL++ L+VIT IGYG++ P+T  GK  T++YA  GIPL  LY  N+G  LA  F+F+Y  +
Sbjct:   34 KRVKRCCRNFVTFMCTQVGVGALIVIYAICGAFAFMHIE---------------RQFVDETAGHVMELRQNCSQQLWSITEQHNIIDRRRWTEATND----VLREYQSQIAGVVK-HGYVGRSPEQI--WSFPAALMFCLSVITMIGYGNMVPRTPWGKGFTVIYATFGIPLYILYFLNMGRVLARSFKFLYRSL 206          

HSP 2 Score: 52.373 bits (124), Expect = 9.104e-7
Identity = 39/128 (30.47%), Postives = 58/128 (45.31%), Query Frame = 2
Query: 1622 RNATVPISLSLTVXXXXXXXXXXXFTVWGDLDFLKWSYFCFITLSTIGFGDIVPGTKVD----------------SKNPKE-------------KLIIVSIYVIIGLSVFAMCFKLMQEEVVAKFKRL 1918
            +   VP +  L VI+ Y++ G ++F  W     L   YFC  +L  IGFGD VPG  +                 S +P E             KL I  +Y+++G+ + AMC  LM+EEV  K + +
Sbjct:  231 KKVIVPSTACLWVIFFYVLTGTVMFANWEKWSLLNSFYFCMTSLCKIGFGDFVPGASLTTSADVNAATQKLQEDISADPAELAQLQSVAADQHSKLAINFVYMLLGMGLVAMCRNLMREEVRLKAREM 358          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Fly
Match: CG34396 (gene:FBgn0085425 transcript:FBtr0112644)

HSP 1 Score: 92.0485 bits (227), Expect = 4.618e-19
Identity = 67/237 (28.27%), Postives = 110/237 (46.41%), Query Frame = 2
Query:  275 FSHIGLSAILVGYVIIGGFMFQSLEISNEINTKKRVKDHRNDFIKATIKNLISLNLTWNNTDIMNNSSDINKSGNQTLLNNYLTMVIINYTNNVIFFMQEEGWNGNDDVTALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHKVCRKYCKMCCQKSRKHHSGLRSKLIKANAFPGMSKKVIKRDRPKQMIKPNNFFDKSIKQ 985
            F+HI L  IL  Y I G  +F+++E+ +    K  V+D +  F                  ++   S D+  SG   L      + I+N    V+  +   G   N D     WS+  A++Y  T+ TTIGYGH+ PKT +G+ +T++YA++GIP+  + L+++G       +F++  V R Y    C++ RK    +RS +   N    M    I+R        P+ FF  S  +
Sbjct:  112 FTHIFLILILALYNIGGAVVFRTIEVRHANQEKLVVQDQQKSFFN----------------EMRQVSGDL--SGLSKLEFEGQVLRIMNTYPTVVQSLLRSGMVDNTD----PWSFWDAMVYSATIYTTIGYGHITPKTGMGRSLTIVYAIIGIPMFLIVLADLGKLFTRCVKFLWVYVRRMYYTRSCRRIRKQQQ-IRSAMTGFNT---MYDMAIRR--------PSMFFSNSAPE 314          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Zebrafish
Match: kcnk18 (potassium channel, subfamily K, member 18 [Source:ZFIN;Acc:ZDB-GENE-100405-2])

HSP 1 Score: 77.0258 bits (188), Expect = 1.378e-14
Identity = 51/177 (28.81%), Postives = 87/177 (49.15%), Query Frame = 2
Query:  251 CKRFFTFLFSHIGLSAILVGYVIIGGFMFQSLEISNEINTKKRVKDHRNDFIKATIKNLISLNLTWNNTDIMNNSSDINKSGNQTLLNNYLTMVIINYTNNVIFFMQEEGWNGNDDVTALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLA 781
            C   F  LF H+ L   LV Y ++G  +F+++E +N  N  +         I + ++ +  + +  N+TD       INK+  + +L++Y                ++E  +G        W++  +L +  TV TT+GYG + P T  GK   +LYA++GIPL  L +S++GD LA
Sbjct:   13 CSTLFWRLFPHVFLILSLVLYAVLGALVFRAIEYTNPRNESEE--------ILSIVQKV--MEIVQNHTDASEQKHLINKA--KYILDDYC--------------YEKERDHG--------WTFFASLFFCCTVFTTVGYGRIYPLTSKGKVACVLYAMVGIPLMLLVISDVGDLLA 155          

HSP 2 Score: 54.299 bits (129), Expect = 2.583e-7
Identity = 26/61 (42.62%), Postives = 42/61 (68.85%), Query Frame = 2
Query: 1733 YFCFITLSTIGFGDIVPGTKVDSKNPKEKLIIVSIYVIIGLSVFAMCFKLMQEEVVAKFKR 1915
            YF FITL+TIGFGDIVP      ++PK   ++  +++I G+++ +M FKL Q ++V  ++R
Sbjct:  319 YFTFITLTTIGFGDIVP------EHPK-FFMVTFLFIITGMAIMSMAFKLGQSQIVCFYRR 372          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Zebrafish
Match: kcnk18 (potassium channel, subfamily K, member 18 [Source:ZFIN;Acc:ZDB-GENE-100405-2])

HSP 1 Score: 77.0258 bits (188), Expect = 1.398e-14
Identity = 51/177 (28.81%), Postives = 87/177 (49.15%), Query Frame = 2
Query:  251 CKRFFTFLFSHIGLSAILVGYVIIGGFMFQSLEISNEINTKKRVKDHRNDFIKATIKNLISLNLTWNNTDIMNNSSDINKSGNQTLLNNYLTMVIINYTNNVIFFMQEEGWNGNDDVTALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLA 781
            C   F  LF H+ L   LV Y ++G  +F+++E +N  N  +         I + ++ +  + +  N+TD       INK+  + +L++Y                ++E  +G        W++  +L +  TV TT+GYG + P T  GK   +LYA++GIPL  L +S++GD LA
Sbjct:   13 CSTLFWRLFPHVFLILSLVLYAVLGALVFRAIEYTNPRNESEE--------ILSIVQKV--MEIVQNHTDASEQKHLINKA--KYILDDYC--------------YEKERDHG--------WTFFASLFFCCTVFTTVGYGRIYPLTSKGKVACVLYAMVGIPLMLLVISDVGDLLA 155          

HSP 2 Score: 54.6842 bits (130), Expect = 2.422e-7
Identity = 26/61 (42.62%), Postives = 42/61 (68.85%), Query Frame = 2
Query: 1733 YFCFITLSTIGFGDIVPGTKVDSKNPKEKLIIVSIYVIIGLSVFAMCFKLMQEEVVAKFKR 1915
            YF FITL+TIGFGDIVP      ++PK   ++  +++I G+++ +M FKL Q ++V  ++R
Sbjct:  319 YFTFITLTTIGFGDIVP------EHPK-FFMVTFLFIITGMAIMSMAFKLGQSQIVCFYRR 372          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Zebrafish
Match: kcnk18 (potassium channel, subfamily K, member 18 [Source:ZFIN;Acc:ZDB-GENE-100405-2])

HSP 1 Score: 77.0258 bits (188), Expect = 1.643e-14
Identity = 51/177 (28.81%), Postives = 86/177 (48.59%), Query Frame = 2
Query:  251 CKRFFTFLFSHIGLSAILVGYVIIGGFMFQSLEISNEINTKKRVKDHRNDFIKATIKNLISLNLTWNNTDIMNNSSDINKSGNQTLLNNYLTMVIINYTNNVIFFMQEEGWNGNDDVTALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLA 781
            C   F  LF H+ L   LV Y ++G  +F+++E  N  N  +         I + ++ +  + +  N+TD       INK+ +  +L++Y                ++E  +G        W++  +L +  TV TT+GYG + P T  GK   +LYA++GIPL  L +S++GD LA
Sbjct:   13 CSTLFWRLFPHVFLILSLVLYAVLGALVFRAIEYKNPRNESEE--------ILSIVQKV--MEIVQNHTDTSEQKHLINKAKD--ILDDYC--------------YEKERDHG--------WTFFASLFFCCTVFTTVGYGRIYPLTSKGKVACVLYAMVGIPLMLLVISDVGDLLA 155          

HSP 2 Score: 54.6842 bits (130), Expect = 2.380e-7
Identity = 26/61 (42.62%), Postives = 42/61 (68.85%), Query Frame = 2
Query: 1733 YFCFITLSTIGFGDIVPGTKVDSKNPKEKLIIVSIYVIIGLSVFAMCFKLMQEEVVAKFKR 1915
            YF FITL+TIGFGDIVP      ++PK   ++  +++I G+++ +M FKL Q ++V  ++R
Sbjct:  319 YFTFITLTTIGFGDIVP------EHPK-FFMVTFLFIITGMAIMSMAFKLGQSQIVCFYRR 372          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Zebrafish
Match: kcnk3b (potassium channel, subfamily K, member 3b [Source:ZFIN;Acc:ZDB-GENE-120709-43])

HSP 1 Score: 76.6406 bits (187), Expect = 2.146e-14
Identity = 32/70 (45.71%), Postives = 44/70 (62.86%), Query Frame = 2
Query:  602 TALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHKV 811
              + W + G+  + +TVITTIGYGH AP T  GK   M YALLGIPLT +   ++G+ +  + RF+ HK 
Sbjct:   74 AGVQWKFSGSFYFAITVITTIGYGHAAPSTDAGKAFCMGYALLGIPLTLVMFQSLGERINTFVRFLLHKA 143          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Zebrafish
Match: kcnk3a (potassium channel, subfamily K, member 3a [Source:ZFIN;Acc:ZDB-GENE-040724-171])

HSP 1 Score: 74.3294 bits (181), Expect = 1.242e-13
Identity = 29/70 (41.43%), Postives = 45/70 (64.29%), Query Frame = 2
Query:  602 TALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHKV 811
              + W + G+  + +TVITTIGYGH AP T  GK   M YALLGIPLT +   ++G+ +  + +++ H++
Sbjct:   74 AGVQWRFAGSFYFAITVITTIGYGHAAPSTDGGKVFCMFYALLGIPLTLVMFQSLGERINTFVKYLLHRL 143          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Xenopus
Match: pole4 (polymerase (DNA-directed), epsilon 4, accessory subunit [Source:Xenbase;Acc:XB-GENE-5722002])

HSP 1 Score: 75.485 bits (184), Expect = 8.668e-14
Identity = 31/71 (43.66%), Postives = 45/71 (63.38%), Query Frame = 2
Query:  611 NWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHKVCRKY 823
             W + G+  + +TVITTIGYGH AP T  GK   M YA+LGIPLT +   ++G+ +  + RF+  K+ R +
Sbjct:   89 QWKFAGSFYFAITVITTIGYGHAAPGTDAGKVFCMFYAVLGIPLTLVMFQSLGERMNTFVRFLLKKLKRCF 159          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Xenopus
Match: pole4 (polymerase (DNA-directed), epsilon 4, accessory subunit [Source:Xenbase;Acc:XB-GENE-5722002])

HSP 1 Score: 74.3294 bits (181), Expect = 1.519e-13
Identity = 31/71 (43.66%), Postives = 45/71 (63.38%), Query Frame = 2
Query:  611 NWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHKVCRKY 823
             W + G+  + +TVITTIGYGH AP T  GK   M YA+LGIPLT +   ++G+ +  + RF+  K+ R +
Sbjct:   78 QWKFTGSFYFAITVITTIGYGHAAPGTDAGKVFCMFYAVLGIPLTLVMFQSLGERMNTFVRFLLKKLKRCF 148          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Xenopus
Match: pole4 (polymerase (DNA-directed), epsilon 4, accessory subunit [Source:Xenbase;Acc:XB-GENE-5722002])

HSP 1 Score: 74.3294 bits (181), Expect = 1.907e-13
Identity = 31/71 (43.66%), Postives = 45/71 (63.38%), Query Frame = 2
Query:  611 NWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHKVCRKY 823
             W + G+  + +TVITTIGYGH AP T  GK   M YA+LGIPLT +   ++G+ +  + RF+  K+ R +
Sbjct:   98 QWKFAGSFYFAITVITTIGYGHAAPGTDAGKVFCMFYAVLGIPLTLVMFQSLGERMNTFVRFLLKKLKRCF 168          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Xenopus
Match: tbc1d1 (TBC1 domain family member 1 [Source:Xenbase;Acc:XB-GENE-5959648])

HSP 1 Score: 73.9442 bits (180), Expect = 2.877e-13
Identity = 30/77 (38.96%), Postives = 48/77 (62.34%), Query Frame = 2
Query:  602 TALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHKVCRKYCKM 832
              + W + G+  + +TVITTIGYGH AP T  GK   M YA+LGIPLT +   ++G+ +  + +++  ++ +K C M
Sbjct:  173 AGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLGERMNTFVKYLLKRI-KKCCGM 248          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Xenopus
Match: bcdin3d (BCDIN3 domain containing RNA methyltransfease [Source:Xenbase;Acc:XB-GENE-5859380])

HSP 1 Score: 67.0106 bits (162), Expect = 1.978e-11
Identity = 47/170 (27.65%), Postives = 75/170 (44.12%), Query Frame = 2
Query:  272 LFSHIGLSAILVGYVIIGGFMFQSLEISNEINTKKRVKDHRNDFIKATIKNLISLNLTWNNTDIMNNSSDINKSGNQTLLNNYLTMVIINYTNNVIFFMQEEGWNGNDDVTALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLA 781
            +   I L+   + Y+++G  +FQ LE   E   K   + HR DF+K                    N + + K     L+N     VI +     I  ++ +  N +      NW    +  +  TV+TTIGYG ++P+T  G+   +LYAL GIPL  + L  +G  L+
Sbjct:    6 ILKSILLAMAFMVYLLVGALVFQVLEKEAEDTAKTDTERHRLDFLK--------------------NYTCLTKEALDHLVNQ----VITDAVKQGIHPLENQTKNSHS-----NWDMSSSFFFAGTVVTTIGYGTLSPRTPGGQIFCVLYALFGIPLNVIVLGRVGKILS 146          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Mouse
Match: Kcnk18 (potassium channel, subfamily K, member 18 [Source:MGI Symbol;Acc:MGI:2685627])

HSP 1 Score: 85.8853 bits (211), Expect = 1.963e-17
Identity = 57/201 (28.36%), Postives = 83/201 (41.29%), Query Frame = 2
Query:  185 ESRSNLRSKYLQKERIEKTKQCCKRFFTFLFSHIGLSAILVGYVIIGGFMFQSLE--ISNEINTKKRVKDHRNDFIKATIKNLISLNLTWNNTDIMNNSSDINKSGNQTLLNNYLTMVIINYTNNVIFFMQEEGWNGNDDVTALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLA 781
            E+     ++    E + K + CC      L   +     LV Y ++G  +F ++E     E      +K   +D     + N++  NLT       N    +     Q L                             D     WS+  AL +  TV +T+GYGH+ P T+LGKF+ MLYAL GIPL FL L++IGD LA
Sbjct:    2 EAEEPPEARRCCPEALGKARGCCPEALGKLLPGLCFLCCLVTYALVGAALFSAVEGRPDPEAEENPELKKFLDD-----LCNILKCNLTVVEGSRKNLCEHLQHLKPQWL-------------------------KAPQD-----WSFLSALFFCCTVFSTVGYGHMYPVTRLGKFLCMLYALFGIPLMFLVLTDIGDILA 167          

HSP 2 Score: 52.373 bits (124), Expect = 1.149e-6
Identity = 29/70 (41.43%), Postives = 42/70 (60.00%), Query Frame = 2
Query: 1709 DLDFLKWSYFCFITLSTIGFGDIVPGTKVDSKNPKEKLIIVSIYVIIGLSVFAMCFKLMQEEVVAKFKRL 1918
            +L F    YFCF+TL+TIGFGDIV        +P    +  SIY+I+G+ +  + FKLMQ  ++  +K L
Sbjct:  319 ELGFEDAFYFCFVTLTTIGFGDIV------LVHP-HFFLFFSIYIIVGMEILFIAFKLMQNRLLHTYKTL 381          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Mouse
Match: Kcnk3 (potassium channel, subfamily K, member 3 [Source:MGI Symbol;Acc:MGI:1100509])

HSP 1 Score: 75.0998 bits (183), Expect = 7.420e-14
Identity = 31/72 (43.06%), Postives = 45/72 (62.50%), Query Frame = 2
Query:  602 TALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHKVCR 817
              + W + G+  + +TVITTIGYGH AP T  GK   M YALLGIPLT +   ++G+ +  + R++ H+  R
Sbjct:   74 AGVQWRFAGSFYFAITVITTIGYGHAAPSTDGGKVFCMFYALLGIPLTLVMFQSLGERINTFVRYLLHRAKR 145          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Mouse
Match: Kcnk9 (potassium channel, subfamily K, member 9 [Source:MGI Symbol;Acc:MGI:3521816])

HSP 1 Score: 73.559 bits (179), Expect = 2.196e-13
Identity = 31/77 (40.26%), Postives = 48/77 (62.34%), Query Frame = 2
Query:  602 TALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHKVCRKYCKM 832
              + W + G+  + +TVITTIGYGH AP T  GK   M YA+LGIPLT +   ++G+ +  + R++  ++ +K C M
Sbjct:   74 AGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLGERMNTFVRYLLKRI-KKCCGM 149          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Mouse
Match: Kcnk15 (potassium channel, subfamily K, member 15 [Source:MGI Symbol;Acc:MGI:2675209])

HSP 1 Score: 69.707 bits (169), Expect = 3.129e-12
Identity = 29/56 (51.79%), Postives = 37/56 (66.07%), Query Frame = 2
Query:  611 NWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYL 778
             W + G+  + +TVITTIGYGH AP T  GK   M YALLGIPLT +   ++G+ L
Sbjct:   96 QWRFAGSFYFAITVITTIGYGHAAPGTDSGKVFCMFYALLGIPLTLVTFQSLGERL 151          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Mouse
Match: Kcnk15 (potassium channel, subfamily K, member 15 [Source:MGI Symbol;Acc:MGI:2675209])

HSP 1 Score: 69.3218 bits (168), Expect = 3.285e-12
Identity = 29/56 (51.79%), Postives = 37/56 (66.07%), Query Frame = 2
Query:  611 NWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYL 778
             W + G+  + +TVITTIGYGH AP T  GK   M YALLGIPLT +   ++G+ L
Sbjct:   77 QWRFAGSFYFAITVITTIGYGHAAPGTDSGKVFCMFYALLGIPLTLVTFQSLGERL 132          
BLAST of Potassium channel subfamily K member 18 vs. UniProt/SwissProt
Match: sp|Q6Q1P3|KCNKI_RAT (Potassium channel subfamily K member 18 OS=Rattus norvegicus OX=10116 GN=Kcnk18 PE=2 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 8.599e-17
Identity = 53/182 (29.12%), Postives = 84/182 (46.15%), Query Frame = 2
Query:  236 KTKQCCKRFFTFLFSHIGLSAILVGYVIIGGFMFQSLEISNEINTKKRVKDHRNDFIKATIKNLISLNLTWNNTDIMNNSSDINKSGNQTLLNNYLTMVIINYTNNVIFFMQEEGWNGNDDVTALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLA 781
            K + CC      L   +     LV Y ++G  +F ++E       +   +   N  +K  +  L ++ L  N T +  +  D+ +   Q                     ++ + +   +D     WS+  AL +  TV +T+GYGH+ P T+LGKF+ MLYAL GIPL FL L++IGD LA
Sbjct:   30 KARGCCPEALGKLLPGLCFLCCLVTYALVGAALFSAVE------GRPDPEAEENPELKKFLDKLCNI-LKCNLTVVEGSRKDLCEHLQQ---------------------LKPQWFKAPED-----WSFLSALFFCCTVFSTVGYGHMYPVTRLGKFLCMLYALFGIPLMFLVLTDIGDILA 178          

HSP 2 Score: 53.9138 bits (128), Expect = 2.843e-6
Identity = 30/70 (42.86%), Postives = 42/70 (60.00%), Query Frame = 2
Query: 1709 DLDFLKWSYFCFITLSTIGFGDIVPGTKVDSKNPKEKLIIVSIYVIIGLSVFAMCFKLMQEEVVAKFKRL 1918
            DL F    YFCF+TL+TIGFGDIV        +P    +  SIY+I+G+ +  + FKLMQ  ++  +K L
Sbjct:  330 DLGFEDAFYFCFVTLTTIGFGDIV------LVHP-HFFLFFSIYIIVGMEILFIAFKLMQNRLLHTYKTL 392          
BLAST of Potassium channel subfamily K member 18 vs. UniProt/SwissProt
Match: sp|Q6VV64|KCNKI_MOUSE (Potassium channel subfamily K member 18 OS=Mus musculus OX=10090 GN=Kcnk18 PE=1 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 1.373e-16
Identity = 57/201 (28.36%), Postives = 83/201 (41.29%), Query Frame = 2
Query:  185 ESRSNLRSKYLQKERIEKTKQCCKRFFTFLFSHIGLSAILVGYVIIGGFMFQSLE--ISNEINTKKRVKDHRNDFIKATIKNLISLNLTWNNTDIMNNSSDINKSGNQTLLNNYLTMVIINYTNNVIFFMQEEGWNGNDDVTALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLA 781
            E+     ++    E + K + CC      L   +     LV Y ++G  +F ++E     E      +K   +D     + N++  NLT       N    +     Q L                             D     WS+  AL +  TV +T+GYGH+ P T+LGKF+ MLYAL GIPL FL L++IGD LA
Sbjct:    2 EAEEPPEARRCCPEALGKARGCCPEALGKLLPGLCFLCCLVTYALVGAALFSAVEGRPDPEAEENPELKKFLDD-----LCNILKCNLTVVEGSRKNLCEHLQHLKPQWL-------------------------KAPQD-----WSFLSALFFCCTVFSTVGYGHMYPVTRLGKFLCMLYALFGIPLMFLVLTDIGDILA 167          

HSP 2 Score: 52.373 bits (124), Expect = 8.039e-6
Identity = 29/70 (41.43%), Postives = 42/70 (60.00%), Query Frame = 2
Query: 1709 DLDFLKWSYFCFITLSTIGFGDIVPGTKVDSKNPKEKLIIVSIYVIIGLSVFAMCFKLMQEEVVAKFKRL 1918
            +L F    YFCF+TL+TIGFGDIV        +P    +  SIY+I+G+ +  + FKLMQ  ++  +K L
Sbjct:  319 ELGFEDAFYFCFVTLTTIGFGDIV------LVHP-HFFLFFSIYIIVGMEILFIAFKLMQNRLLHTYKTL 381          
BLAST of Potassium channel subfamily K member 18 vs. UniProt/SwissProt
Match: sp|Q22271|UNC58_CAEEL (Uncoordinated protein 58 OS=Caenorhabditis elegans OX=6239 GN=unc-58 PE=1 SV=2)

HSP 1 Score: 80.8777 bits (198), Expect = 1.426e-14
Identity = 56/188 (29.79%), Postives = 105/188 (55.85%), Query Frame = 2
Query:  245 QCCKRFFTFLFSHIGLSAILVGYVIIGGFMFQSLEISNEI--NTKKRVKDHRNDFIKATIKNLISLNLTWNNTDIMNNS----SDINKSGNQTLLNNYLTMVIINYTNNVIFFMQEEGWNGNDDVTALN--WSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLAD 784
            Q   ++   L  H+ L ++L+GY+ +G ++   LE   E+   +KK V+          + NL+S N T  +  ++NN+    S++++         +  MV ++ T +    ++ E  N  DD++ ++  W++  A+LYVLTV+TT GYG V+  T +GK  ++ +AL+GIPL F+  ++IG +L++
Sbjct:  171 QQTVKYIKILTPHVILVSVLIGYLCLGAWILMLLETRTELLARSKKLVR----------LTNLMS-NFTAESWKMLNNAQHGVSNMDEGEWAATFREW--MVRVSETVDDRRPIRRE-LNRPDDLSNMHNKWTFPTAILYVLTVLTTCGYGEVSVDTDVGKVFSVAFALVGIPLMFITAADIGKFLSE 344          
BLAST of Potassium channel subfamily K member 18 vs. UniProt/SwissProt
Match: sp|Q18120|TWK18_CAEEL (TWiK family of potassium channels protein 18 OS=Caenorhabditis elegans OX=6239 GN=twk-18 PE=1 SV=2)

HSP 1 Score: 78.5666 bits (192), Expect = 5.852e-14
Identity = 54/197 (27.41%), Postives = 91/197 (46.19%), Query Frame = 2
Query:  299 ILVGYVIIGGFMFQSLEISNEINTKKRVKDHRNDFIKATIKNLISLNLTWNNTDIMNNSSDINKSGNQTLLNNYLTMVIINYTNNVIFFMQEEGWNGNDDVTALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHKVCRKYCKMCCQKSRKHHSGLRSKLIKA 889
            ILV Y ++G ++F  +E  NE       +  R++ I+ T+  +  L +      +M    + N++         LT            F +  G    D    ++W++ G++ Y +TV TTIGYG++ P T  G+F T+LYA +GIPLT L L  +G   A        K C+   +   + +R     L +K+ +A
Sbjct:   27 ILVAYTLLGAWIFWMIEGENEREMLIEQQKERDELIRRTVYKINQLQIK-RQRRLMTAEEEYNRTAK------VLTT-----------FQETLGIVPADMDKDIHWTFLGSIFYCMTVYTTIGYGNIVPGTGWGRFATILYAFIGIPLTVLSLYCLGSLFA--------KGCKMLWRFFLKSTRVVSKDLSNKISEA 197          
BLAST of Potassium channel subfamily K member 18 vs. UniProt/SwissProt
Match: sp|Q622X0|UNC58_CAEBR (Uncoordinated protein 58 OS=Caenorhabditis briggsae OX=6238 GN=unc-58 PE=3 SV=2)

HSP 1 Score: 78.5666 bits (192), Expect = 7.113e-14
Identity = 57/188 (30.32%), Postives = 102/188 (54.26%), Query Frame = 2
Query:  245 QCCKRFFTFLFSHIGLSAILVGYVIIGGFMFQSLEISNEI--NTKKRVKDHRNDFIKATIKNLISLNLT---WNN-TDIMNNSSDINKSGNQTLLNNYLTMVIINYTNNVIFFMQEEGWNGNDDVTALN--WSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLAD 784
            Q   ++   L  H+ L ++L+GY+ +G ++   LE   E+   +KK V+          + NL+S N T   W   +D  + S  +++         +  MV ++ T +    ++ E  N  DD++ ++  W++  ALLYVLTV+TT GYG V+  T +GK  ++ +AL+GIPL F+  ++IG +L++
Sbjct:  173 QQTVKYIKILLPHVILVSVLIGYLCLGAWILMLLETRTELLSRSKKLVR----------LTNLMS-NFTAESWRMLSDAQHGSITMDEGEWAATFREW--MVRVSETVDDRRPIRRE-LNRPDDLSNMHNKWTFPTALLYVLTVLTTCGYGEVSVDTDVGKVFSVAFALVGIPLMFITAADIGKFLSE 346          
BLAST of Potassium channel subfamily K member 18 vs. TrEMBL
Match: A0A0L7RCD9 (Potassium channel subfamily K member 9 OS=Habropoda laboriosa OX=597456 GN=WH47_10705 PE=3 SV=1)

HSP 1 Score: 213.001 bits (541), Expect = 2.509e-56
Identity = 174/628 (27.71%), Postives = 297/628 (47.29%), Query Frame = 2
Query:  233 EKTKQCCK------RFFTFLFSHIGLSAILVGYVIIGGFMFQSLEISNEINTKKRVKDHRNDF------IKATIKNLISLNLTWNNTDIMNNSSDINKSGNQTLLNNYLTMVIINYTNNVIFFMQEEGWNGNDDVTALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHKVCRKYCKMCCQKSRKHHSGLRSKLIKANAFPGMSKKVIKRDRPKQMIKPNNFFDKSIKQLREKLMR------FPLKTKKSDD-ENPSRSQHDPSDCVSTINSQNDKYIFKSYGVARF--LPSVKTIKQREALMMNCVSTHVPLINWRDIDKDLEIGSLDNIPHVTDHSDCIRNPYLSTSDFYENQESF---------NNKPPDELSELHISTSFSQKKESSLYKSLP--------------------------YLTDQPDTSAKNSSSTPYRSN--------SFTPDINFVTESIRQVSYVSVNNIMEIENEVKSNNHKTVKLRNATVPISLSLTVXXXXXXXXXXXFTVWGDLDFLKWSYFCFITLSTIGFGDIVPGTKVDSKNPKEKLIIVSIYVIIGLSVFAMCFKLMQEEVVAKFKRLGR 1924
            EK  +C +      +FF  +FSH+ L +++V Y +IG + F++LE ++E   KK +KD R +       I   ++ LI  N  W +  +                       + ++ NN+++ M++EGW+G +    + W++ GAL Y + VITTIGYGH+APKTK GK +T+ YA++GIPL  L LSNIGD +A  FRF+Y +VC   C +C +  +K     R+ L+++ +     +    +   ++ I+ +     S   L E L R      +   T++ +D E   RS   PS       S N  + FKS  V+R+  LP  K  +    +M             + +D+ L + S    P+ TD S  + N Y +  D  +  E +         +++ P +++E+       +K+   + +SLP                          YL  +    ++ S +  YRSN          T  ++ ++ +   V      +  + E +  +N+ +  +     VPI L + ++  YI  GA +F+ W    FL  +YFCFITL+TIGFGD VP  K+D+    + + + S+Y++ G+++ AM F L+QEEV+   K + +
Sbjct:   16 EKPSKCIRFLRFLWKFFRCVFSHVSLVSLVVLYCLIGAYAFEALEATHEKEIKKSIKDIRGNVSEQLWKITKEVEVLIREN--WTDKALRE---------------------LKSFENNLVWMMEKEGWDGREGEDDIQWTFAGALFYSIVVITTIGYGHIAPKTKNGKVVTIFYAIVGIPLMLLCLSNIGDIMASSFRFLYWRVC---CYVCTKPPKKRRP--RAHLVRSYSMRQPGRYGGGKGGFRRSIRVSQRSADSALGLSESLARSYSDVDYKYNTRRYEDGEQRRRSPSYPS-------SANPNFGFKSATVSRYSDLPMAKFTRASPKMMT------------QSLDRKLMLRS----PNDTDRSPVLCNKY-ALEDLDDELERWKASAGNKMDDSRKPRQVAEVVEGAENGEKQPPLVTRSLPRRCLSMEGATSNYRTNLPPPLRPSSIYLEMENSRRSQASRTKRYRSNYPVARSYRRETLPMDIMSPAGLSVPRQVYVDDFDSEYDYYTNDDQE-RQPIKPVPIWLCVFLVVSYIFGGAFLFSAWEHWPFLDSAYFCFITLTTIGFGDFVPAYKLDA---HKGIAVCSLYLLFGIALLAMSFNLVQEEVINNVKNVAK 587          
BLAST of Potassium channel subfamily K member 18 vs. TrEMBL
Match: A0A2A3E4T7 (Potassium channel subfamily K member OS=Apis cerana cerana OX=94128 GN=APICC_08379 PE=3 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 3.806e-55
Identity = 179/611 (29.30%), Postives = 291/611 (47.63%), Query Frame = 2
Query:  233 EKTKQCCK---------RFFTFLFSHIGLSAILVGYVIIGGFMFQSLEISNEINTKKRVKDHRNDFIKATIKNLISLNLTWNNTDIMNNSSDINKSGNQTLLNNYLTMVII---NYTNNVIFFMQEEGWNGNDDVTALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHKVCRKYCKMCCQKSRKHHSGLRSKLIKANAFPGMSKKVIKRD-RPKQMIKPNNFFDKSIKQLREKLMR---FPLKTKKSDDENPSRSQHDPSDCVSTIN--SQNDKYIFKSYGVARF--LPSVKTIKQREALMMNCVSTHVPLINWRDIDKDLEIG---SLDNIP-----------HVTDHSDCIRNPYLS-TSDFYENQESFNNK--PPDELSELHISTSFSQKKESSLYKSLPYLTDQPDTSAKNSSSTPYRSN-----SFTPDINFVTESIRQVSYVSVNNIMEIEN-----EVKSNNHKTVKLRNATVPISLSLTVXXXXXXXXXXXFTVWGDLDFLKWSYFCFITLSTIGFGDIVPGTKVDSKNPKEKLIIVSIYVIIGLSVFAMCFKLMQEEVVAKFKRLGR 1924
            EK  +C +         +FF  +FSH+ L +++V Y +IG + F++LE ++E   KK +KD R +  +   K                    I K     +  N+    +    ++ NN+++ M++EGW+G++    + W++ GAL Y + VITTIGYGH+APKTK GK +T+ YA++GIPL  L LSNIGD +A  FRF+Y +VC   C    +K R     +RS  ++     G SK   +R  R  QM         +   L E L R   F +  K     NP R +       S+    S N  +  KS  V+R+  LP  K+ K    +    +   + + +  DID+   +    +LDN+            + +D S     P  + T +  E QE    +  P   LS    ++++     +SL  S  YL  +     + S    YR+N     S+  D   +   I   +   V+  + +++     E  +N+ +  + +   VPI L + ++  YI  GA +F+ W    FL  +YFCFITL+TIGFGD VP  K+D+    + + + S+Y++ G+++ AM F L+QEEV+   K + +
Sbjct:    5 EKPSKCIRFLRFLRFLWKFFRCVFSHVSLISLVVLYCLIGAYAFEALEAAHEKEIKKSIKDVRGNVAEQLWK--------------------ITKEVEVLIRENWTDRALRELKSFENNLVWMMEKEGWDGSEGEDDIQWTFAGALFYSIVVITTIGYGHIAPKTKNGKVVTIFYAIVGIPLMLLCLSNIGDIMASSFRFLYWRVCCYICTKPPKKRRPRSHFVRSYSMRQPGRYGGSKGGFRRSIRVSQM--------SADSVLSENLARSSYFDMDYKY----NPRRYEAGEERRTSSSYQLSGNPNFGLKSATVSRYSDLPIAKSSKVSSKMTTQSLDRKLLMRSPHDIDRSSVLCNKYALDNLENELRRWQTSAGNTSDTSKSKEEPEATETRENSEKQEPLMTRSLPRRCLSMEGATSNYRMSLPTSLRPSSIYLDLENSKKTQVSKIRRYRNNYPIARSYRRDT--LPSDIMSSAGFPVHRQVYVDDFDSDYEYYTNDDQE-RQQIKPVPIWLCVFLVVSYIFGGAFLFSAWEHWPFLDSAYFCFITLTTIGFGDFVPAYKLDA---HKGIAVCSLYLLFGIALLAMSFNLVQEEVINNVKNVAK 577          
BLAST of Potassium channel subfamily K member 18 vs. TrEMBL
Match: A0A1W4WHW8 (uncharacterized protein LOC108735848 isoform X1 OS=Agrilus planipennis OX=224129 GN=LOC108735848 PE=3 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 4.912e-55
Identity = 174/609 (28.57%), Postives = 290/609 (47.62%), Query Frame = 2
Query:  206 SKYLQKERIEKTK-QCCKRFF-------TFLFSHIGLSAILVGYVIIGGFMFQSLEISNEINTKKRVKDHRNDFIKATIKNLISLNLTWNNTDIMNNSSDINKSGNQTLLNNYLTMVIINYTNNVIFFMQEEGWNGNDDVTALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHKVCRKYCKMCCQKSRK-HHSGLRSKLIKANAFPGMSK---KVIKRDRPKQMIKPNNFFD--------KSIKQLREKLMRFPLKTKKSDDENPSRSQHDPSDCVSTINSQNDKYIFKSYGVARFLPSVKTIKQREALMMNCVSTHVPLINWRDIDKDLEIGSLDNIPHVTDHSDCIRNPYLSTSDFYENQESFNNKPPDELSELHISTSFSQ---KKESSLYKSLPYLTDQPDTSAKNSSS--TPYRSNSF---TPDINFVTESIRQ-VSYVSVNNIMEIENEVKS-------NNHKTVKLRNATVPISLSLTVXXXXXXXXXXXFTVWGDLDFLKWSYFCFITLSTIGFGDIVPGTKVDSKNPKEKLIIVSIYVIIGLSVFAMCFKLMQEEVVAKFKRLGR 1924
            S+YL  E +E +K   C RF        T +FSHI L +++V Y I G   F++LE  +E+  KK +       I+  I + +  NLT         S    +  N T L   +   +  +   ++  M ++GW+G +D+  + W++ GAL Y + VITTIGYGH+APKT LGK +T+ YA+LGIPL  L LSNIGD +A  FRF+Y +VC   C +C +K +K      R   I+     G  +   + ++R         ++ FD         S  ++R      P+K + +        Q+     +ST+N + ++     YG  R      ++ +R A  +           W   D  L++ +  + P V  +   +  P + +               + +    I  SF +   ++  S+ ++  YL      S   S+    P +S S    +P  +  +  I   + Y S +  +E E++ +         + +T ++R   VPI L + ++  YI  GA +FT W + D+L  +YFCFITL+TIGFGD VP  +V ++N +  + + S+Y++ G+S+ AM F L+QEEV+A  K + +
Sbjct:    2 SRYLDPEGLEPSKPSACSRFLRYTWKTITCIFSHIFLVSLVVSYCIFGAKTFETLEKDHEMEVKKNISS-----IRGRIIDKLWFNLT---------SEPYLREENFTFL---IVKHLKEFEGELLKAMNKDGWDGEEDINKVQWTFAGALFYSIIVITTIGYGHIAPKTTLGKVVTIFYAILGIPLMLLCLSNIGDVMATSFRFLYWRVC---CYICTKKPKKPRRVRQRGGTIRREGGRGSYRSKTQSLRRSVRTSTRSADSGFDYGDVNPLSHSDTEIRVHEELPPMKVRGASLPRMKPGQNSRFREMSTVNQRPNQ-----YGAGRVQQRGGSLDRRRAPKV-----------W---DPSLDLNTFPDAP-VLCNKYALEGPEIES---------------NHIQRGGIRRSFERSRGRRAVSMPRTHNYLELPVPVSPARSTEDLRPRQSESLKRPSPSRHHASPRIMSPLGYGSKSLYIEEESDTEYFDDGMSFESSRTTRIR--PVPIWLCVFLVVSYIFAGAFLFTAWENWDYLDSAYFCFITLTTIGFGDFVPAKRV-TENAEMSIALCSLYLLFGISLLAMSFNLVQEEVIANVKSVAK 552          
BLAST of Potassium channel subfamily K member 18 vs. TrEMBL
Match: A0A087ZY41 (Uncharacterized protein OS=Apis mellifera OX=7460 GN=LOC413106 PE=3 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 1.552e-54
Identity = 171/608 (28.12%), Postives = 279/608 (45.89%), Query Frame = 2
Query:  233 EKTKQCCK---------RFFTFLFSHIGLSAILVGYVIIGGFMFQSLEISNEINTKKRVKDHRNDF------IKATIKNLISLNLTWNNTDIMNNSSDINKSGNQTLLNNYLTMVIINYTNNVIFFMQEEGWNGNDDVTALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHKVCRKYCKMCCQKSRKHHSGLRSKLIKANAFPGMSKKVIKRD-RPKQMIKPNNFFDKSIKQLREKLMRFPLKTKKSDDENPSRSQHDPSDCVSTINSQNDKYIFKSYGVARF--LPSVKTIKQREALMMNCVSTHVPLINWRDIDKDLEIG---SLDNIPHVTDHSDCIRNPYLSTSDFYENQESFNNKPPDELSELHISTS-----FSQKKESSLYK-SLPYLTDQP---DTSAKNSSSTP--------------YRSNSFTPDINFVTESIRQVSYVSVNNIMEIENEVKSNNHKTVKLRNATVPISLSLTVXXXXXXXXXXXFTVWGDLDFLKWSYFCFITLSTIGFGDIVPGTKVDSKNPKEKLIIVSIYVIIGLSVFAMCFKLMQEEVVAKFKRLGR 1924
            EK  +C +         +FF  +FSH+ L +++V Y +IG + F++LE ++E   KK +KD R +       I   ++ LI  N  W +  +                       + ++ NN+++ M++EGW+G++    + W++ GAL Y + VITTIGYGH+APKTK GK +T+ YA++GIPL  L LSNIGD +A  FRF+Y +VC   C    +K R     +RS  ++     G SK   +R  R  QM   +    +S+ +     M +    ++ +     R+        S   S N  +  KS  V+R+  LP  ++ K    +    +   + + +  DID+   +    +LDN+ +              TS   E  E+   +   E  E  ++ S      S +  +S Y+ SLP L       D      +  P              YR ++   DI     S     +  V       +     N    + +   VPI L + ++  YI  GA +F+ W    FL  +YFCFITL+TIGFGD VP  K+D+    + + + S+Y++ G+++ AM F L+QEEV+   K + +
Sbjct:   16 EKPSKCIRFLRFLRFLWKFFRCVFSHVSLISLVVLYCLIGAYAFEALEAAHEKEIKKSIKDVRGNVAEQLWKITKEVEVLIREN--WTDRALRE---------------------LKSFENNLVWMMEKEGWDGSEGEDDIQWTFAGALFYSIVVITTIGYGHIAPKTKNGKVVTIFYAIVGIPLMLLCLSNIGDIMASSFRFLYWRVCCYICTKPPKKRRPRSHFVRSYSMRQPGRYGGSKGGFRRPIRVSQMSADSVLSSESLARSSYFDMDYKYNPRRYEAGEERRTSS------SYQLSGNPNFGLKSATVSRYSDLPIARSSKASSKMTTQSLDRKLLMRSPHDIDRSSVLCNKYALDNLENELRRWQTSAGNTNDTSKSKEEPEATETRENSEKQEPLMTRSLPRRCLSMEGATSNYRMSLPSLRPSSIYLDLENSKKTQVPKIRRYRNNYPIARSYRRDTLPSDI---MSSAGFPVHRQVYVDDFDSDYDYYTNDDQERQQIKPVPIWLCVFLVVSYIFGGAFLFSAWEHWPFLDSAYFCFITLTTIGFGDFVPAYKLDA---HKGIAVCSLYLLFGIALLAMSFNLVQEEVINNVKNVAK 588          
BLAST of Potassium channel subfamily K member 18 vs. TrEMBL
Match: A0A3L8DT76 (Uncharacterized protein OS=Ooceraea biroi OX=2015173 GN=DMN91_005246 PE=3 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 8.313e-53
Identity = 174/626 (27.80%), Postives = 289/626 (46.17%), Query Frame = 2
Query:  203 RSKYLQKERIEKTKQCCK------RFFTFLFSHIGLSAILVGYVIIGGFMFQSLEISNEINTKKRVKDHRNDFIKATIKNLISLNLTWNNTDIMNNSSDINKSGNQTLLNNYLTMVIINYTNNVIFFMQE--EGWNGNDDVTALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHKVCRKYCKMCCQKSRKHHSGLRSKLIKANAFPGMSKKVIKR---------------DRPKQMIKPNNFFDKSIKQLREKLMRFPLKTKKSDDENPSRSQHDPSDCVSTINSQNDKYIFKSYGVARFLPS----VKTIKQREALMMNCVSTHVPLINWRDIDKDLEIGSLDNIPHVTDHSDCIRNPYLSTS----DFYENQESFNNKP-PDELSELHISTSFSQK-------KESSLYKSLPYLTDQPDTSAKNSSST----------PYRSNSFTPDINFVTESIRQVSYVSVNNIMEIENEVKSNNHKTVKLRNATVPISLSLTVXXXXXXXXXXXFTVWGDLDFLKWSYFCFITLSTIGFGDIVPGTKVDSKNPKEKLIIVSIYVIIGLSVFAMCFKLMQEEVV----AKFKRLG 1921
            RS+      +EK  +C K      +F  F+FSH+ L +++V Y +IG + F+SLE ++E   K+ +K+ R +         +S  L W           I K  +  +  N+    +    +     M++  +GW+G+++   + W++ GAL Y + VITTIGYGH+APKTK GK +T+ YA+LGIPL  L LSNIGD +A  FRF+Y KVC   C    +K R   + +RS  ++ +     SK   +R                 P  M K +++ D   + L  +     +KT  +     + ++       ST+   +D+ +       R + +     +++ ++  L  N V     L N   +D DLE   L   P   +  + +  P  + +    D  E Q SF  +P P     +  +T+ + +       + SS+Y  + ++     T  + + S           P  S      + F     RQV    ++   E          +  K     VPI L + ++  YI  GA +F+ W +  FL  +YFCFITL+TIGFGD VP  K+D+   ++ + + S+Y++ G+++ AM F L+QEEV+    +  KRLG
Sbjct:    5 RSEVFDPMEVEKPSRCIKFLRLLWKFSRFVFSHVTLISLVVAYCLIGAYAFESLEATHEKEVKRSIKNIRGN---------VSEKL-WQ----------ITKDFDVLIRENWTKQALSELKDFEDSLMEKMKQGWDGSEEENNIQWTFAGALFYSIIVITTIGYGHIAPKTKNGKVVTIFYAILGIPLMLLCLSNIGDVMASSFRFLYWKVCCYVCTKPPKKRRGRSTFVRSYSVRQSGRYASSKGPFRRSIRVSQRSADSALGLSIPSSMTK-SSYSDTDCRYLPRRFEGSEIKTSSAYAPPVNLTESK----ASTMPRYSDRLLDAPVATPRNVRASPRMTQSLDRKLLLGPNEVDRSPVLCNKYALD-DLEDEMLRWQPPPRNREENLEKPQGNGTAEELDSTEKQTSFGPRPLPRRCLSVEGATTNNHRVSLTPAPRPSSVYLEMEHMRRSQSTKTRRTRSNYPVARSYKRGPPPSPRIMSPMGFAVH--RQVYADDIDFDYEYHAATDDQERQPTK----PVPIWLCVFLVISYIFGGAFLFSEWEEWQFLDSAYFCFITLTTIGFGDFVPAYKLDA---QKGIALCSLYLLFGIALLAMSFNLVQEEVINNVKSVAKRLG 595          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Cavefish
Match: kcnk15 (potassium channel subfamily K member 15-like [Source:NCBI gene;Acc:103042097])

HSP 1 Score: 76.2554 bits (186), Expect = 2.799e-14
Identity = 30/66 (45.45%), Postives = 43/66 (65.15%), Query Frame = 2
Query:  611 NWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHK 808
             W + G+  + +TVITTIGYGH AP T  GK   M YA+LGIPLT +   ++G+ +  + RF+ H+
Sbjct:   77 QWKFAGSFYFAITVITTIGYGHAAPGTDAGKVFCMFYAVLGIPLTLVMFQSLGERMNTFVRFLLHR 142          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Cavefish
Match: ENSAMXT00000047723.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:15897283:15919205:1 gene:ENSAMXG00000033807.1 transcript:ENSAMXT00000047723.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.0998 bits (183), Expect = 8.551e-14
Identity = 47/186 (25.27%), Postives = 82/186 (44.09%), Query Frame = 2
Query:  272 LFSHIGLSAILVGYVIIGGFMFQSLEISNEINTKKRVKDHRNDFIKATIKNLISLNLTWNNTDIMNNSSDINKSGNQTLLNNYLTMVIINYTNNVIFFMQEEGWNGNDDVTALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIY---HKVCRK 820
            L  H  L   L+ Y ++G  +F ++E +   +    + +    F+   +      N   N +   N S ++ ++  + +L  +  +                 W  + D     W + G+L +  TV TT+GYG + P TK G+   +LYA +GIPL  L ++++GD LA  F   Y   H  CR+
Sbjct:  136 LLPHAALILSLIVYALLGAALFHAIEGTQSNDGTLEIHEGFRKFVHEVV------NEARNKSTSANVSEEVLEAVGEKILREFKAV-----------------WMQSSD----RWHFYGSLFFCCTVFTTVGYGEIYPVTKAGRVACILYATVGIPLMLLVITDVGDILAVLFSNSYRRLHSSCRR 294          

HSP 2 Score: 54.299 bits (129), Expect = 3.110e-7
Identity = 38/85 (44.71%), Postives = 57/85 (67.06%), Query Frame = 2
Query: 1634 VPISLSLTVXXXXXXXXXXXFTVWGDLDFLKWS--YFCFITLSTIGFGDIVPGTKVDSKNPKEKLIIVSIYVIIGLSVFAMCFKL 1882
            VP  + L V++ YI+I A+I  +W D D  K+   YFCFITL+TIGFGDIVP      K+PK   ++  +++I+G+++ +M FKL
Sbjct:  408 VPFLVILLVVFAYILIWALILPIWED-DLGKFDAFYFCFITLTTIGFGDIVP------KHPK-FFMLTFLFIIMGMAIMSMAFKL 484          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Cavefish
Match: ENSAMXT00000032793.1 (pep primary_assembly:Astyanax_mexicanus-2.0:22:28595722:28598505:1 gene:ENSAMXG00000030049.1 transcript:ENSAMXT00000032793.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.7886 bits (177), Expect = 1.364e-13
Identity = 33/69 (47.83%), Postives = 44/69 (63.77%), Query Frame = 2
Query:  611 NWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHKVCR 817
             WS+ G+  + LTVITTIGYGH  P+T+ GK   MLYALLGIPLT +   + G+ +   FR +  +  R
Sbjct:   67 QWSFPGSFYFSLTVITTIGYGHSYPRTEAGKVFCMLYALLGIPLTLVMFQSTGERMNMLFRSVMDRTGR 135          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Cavefish
Match: kcnk9 (potassium two pore domain channel subfamily K member 9 [Source:NCBI gene;Acc:103047047])

HSP 1 Score: 73.1738 bits (178), Expect = 2.910e-13
Identity = 30/77 (38.96%), Postives = 48/77 (62.34%), Query Frame = 2
Query:  602 TALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHKVCRKYCKM 832
              + W + G+  + +TVITTIGYGH AP T  GK   M YA+LGIPLT +   ++G+ +  + +++  ++ +K C M
Sbjct:  129 AGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLGERMNTFVKYLLKRI-KKCCGM 204          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Cavefish
Match: KCNK4 (potassium channel subfamily K member 4-like [Source:NCBI gene;Acc:103026898])

HSP 1 Score: 67.3958 bits (163), Expect = 2.302e-11
Identity = 47/174 (27.01%), Postives = 80/174 (45.98%), Query Frame = 2
Query:  290 LSAILVGYVIIGGFMFQSLEISNEINTKKRVKDHRNDFIKATIKNLISLNLTWNNTDIMNNSSDINKSGNQTLLNNYLTMVIINYTNNVIFFMQEEGWNGNDDVTALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHKV 811
             +A+L+ Y+++G  +F +LE   E      + D+        ++N  S+         + + S I+      LL N    +             E G N  ++  + +W    A  +  T+ITTIGYG+++P+TK GK   + YAL+GIPL    L+ +GD+L    R    K+
Sbjct:   73 FAAVLL-YLVMGALVFNALEAPAEEKQYNELYDN--------LRNTCSI--------FLESYSCISSENLHELLENITEAI-------------EAGVNAKNNTFSSSWDLASAFFFSGTIITTIGYGNISPQTKWGKLFCICYALVGIPLFGFLLAGVGDHLGTGLRKAIAKI 216          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003416.1 (pep scaffold:Pmarinus_7.0:GL476517:78247:80718:1 gene:ENSPMAG00000003129.1 transcript:ENSPMAT00000003416.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.0922 bits (170), Expect = 8.038e-14
Identity = 34/84 (40.48%), Postives = 48/84 (57.14%), Query Frame = 2
Query:  614 WSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHKVCRKYCKMCCQKSRKHHSG 865
            W++ G+L +  T+ TTIGYGH+AP T  GK + M+YA  GIP+  L L+++GD LA     IY    R       +  R+H  G
Sbjct:    2 WNFLGSLFFCCTIFTTIGYGHIAPSTDGGKIMCMVYATFGIPIMLLVLADVGDLLARTLTTIYTSF-RHRLLPGARCGRQHPPG 84          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Sea Lamprey
Match: KCNK16 (potassium two pore domain channel subfamily K member 16 [Source:HGNC Symbol;Acc:HGNC:14464])

HSP 1 Score: 65.855 bits (159), Expect = 5.422e-12
Identity = 45/157 (28.66%), Postives = 72/157 (45.86%), Query Frame = 2
Query:  290 LSAILVGYVIIGGFMFQSLEISNEINTKKRVKDHRNDFIKATIKNLISLNLTWNNTDIMNNSSDINKSGNQTLLNNYLTMVIINYTNNVIFFMQEEGWNGNDDVTALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLS 760
            L+   V Y++ G  +FQ LE+  E N ++R+ D    FI+             N++ + + + D+           +L  V+   ++ V     +         +  NW +  ALL+ +TV+TTIGYG  AP +  G+     YALLGIPL    LS
Sbjct:    8 LATAYVAYLLAGAAVFQVLELPAEQNIRQRLTDSWAAFIQ-------------NHSCVDDGTLDL-----------FLQEVLDARSHGVRVAAGQAS-------SPSNWDFSSALLFTVTVVTTIGYGSTAPGSTWGRASCAFYALLGIPLNLQLLS 133          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Sea Lamprey
Match: KCNK16 (potassium two pore domain channel subfamily K member 16 [Source:HGNC Symbol;Acc:HGNC:14464])

HSP 1 Score: 65.0846 bits (157), Expect = 5.478e-12
Identity = 45/157 (28.66%), Postives = 72/157 (45.86%), Query Frame = 2
Query:  290 LSAILVGYVIIGGFMFQSLEISNEINTKKRVKDHRNDFIKATIKNLISLNLTWNNTDIMNNSSDINKSGNQTLLNNYLTMVIINYTNNVIFFMQEEGWNGNDDVTALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLS 760
            L+   V Y++ G  +FQ LE+  E N ++R+ D    FI+             N++ + + + D+           +L  V+   ++ V     +         +  NW +  ALL+ +TV+TTIGYG  AP +  G+     YALLGIPL    LS
Sbjct:   18 LATAYVAYLLAGAAVFQVLELPAEQNIRQRLTDSWAAFIQ-------------NHSCVDDGTLDL-----------FLQEVLDARSHGVRVAAGQAS-------SPSNWDFSSALLFTVTVVTTIGYGSTAPGSTWGRASCAFYALLGIPLNLQLLS 143          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Sea Lamprey
Match: kcnk7 (potassium channel, subfamily K, member 7 [Source:ZFIN;Acc:ZDB-GENE-110304-2])

HSP 1 Score: 61.2326 bits (147), Expect = 1.771e-10
Identity = 41/162 (25.31%), Postives = 71/162 (43.83%), Query Frame = 2
Query:  284 IGLSAILVGYVIIGGFMFQSLEISNEINTKKRVKDHRNDFIKATIKNLISLNLTWNNTDIMNNSSDINKSGNQTLLNNYLTMVIINYTNNVIFFMQEEGWNGNDDVTA-LNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNI 766
            + L A    Y+++G  +F +LE   E   +  V+  R+ F++                      + ++    +  L + L               +  G +   + TA  +W +  AL +  TV+TT+GYGH  P +  GK + +LYA+LGIP T L L++I
Sbjct:   10 LALLATYALYLVLGAIVFSTLERPYEERLRMDVRRLRDAFVR--------------------QHACLSDEALEGFLRDALEA-------------RTHGVSALRNATAGPHWDFVSALFFASTVLTTVGYGHTVPLSDAGKALCILYAVLGIPFTLLLLTSI 138          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Sea Lamprey
Match: KCNK10 (potassium two pore domain channel subfamily K member 10 [Source:HGNC Symbol;Acc:HGNC:6273])

HSP 1 Score: 54.6842 bits (130), Expect = 2.772e-8
Identity = 27/72 (37.50%), Postives = 39/72 (54.17%), Query Frame = 2
Query:  614 WSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHKVCRKYCK 829
            W    A  +  TV+TTIGYG+V+P T  G+     YAL+GIP+    L+ +GD L   F     +V + + K
Sbjct:  102 WDLGSAFFFAGTVLTTIGYGNVSPSTDWGRIFCTAYALVGIPIFGFLLAGVGDQLGTIFGKAIGRVEKVFMK 173          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Yeast
Match: TOK1 (Outward-rectifier potassium channel of the plasma membrane; has two pore domains in tandem, each of which forms a functional channel permeable to potassium; carboxy tail functions to prevent inner gate closures; target of K1 toxin [Source:SGD;Acc:S000003629])

HSP 1 Score: 51.6026 bits (122), Expect = 3.556e-7
Identity = 24/60 (40.00%), Postives = 34/60 (56.67%), Query Frame = 2
Query:  605 ALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLAD 784
            A NWSY   + +    + TIGYG  AP+T  G+   +++AL  +PL    LS +GD L D
Sbjct:  403 AENWSYFNCIYFCFLCLLTIGYGDYAPRTGAGRAFFVIWALGAVPLMGAILSTVGDLLFD 462          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Nematostella
Match: EDO47668 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLC5])

HSP 1 Score: 72.4034 bits (176), Expect = 6.062e-14
Identity = 30/57 (52.63%), Postives = 43/57 (75.44%), Query Frame = 2
Query:  614 WSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLAD 784
            WSY G+L +  TVITTIGYGH++P+T  G+   MLYAL GIP+T+L L+++G  + +
Sbjct:   86 WSYTGSLFFSGTVITTIGYGHLSPETFFGRIFCMLYALFGIPITWLMLTSLGKKIVE 142          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Nematostella
Match: EDO46328 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQB1])

HSP 1 Score: 67.0106 bits (162), Expect = 1.738e-12
Identity = 29/72 (40.28%), Postives = 45/72 (62.50%), Query Frame = 2
Query:  614 WSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHKVCRKYCK 829
            WSY  +L +  +V+TTIGYGH+AP T  G+   M++AL GIPL  + L N+GD + D   +++  +  +  K
Sbjct:  102 WSYYASLYFTWSVVTTIGYGHLAPSTLGGRIFCMIFALFGIPLNLMILKNLGDRIKDVIHYVHFLLATRVMK 173          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Nematostella
Match: EDO35923 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK42])

HSP 1 Score: 65.855 bits (159), Expect = 4.573e-12
Identity = 49/167 (29.34%), Postives = 80/167 (47.90%), Query Frame = 2
Query:  311 YVIIGGFMFQSLEISNEINTKKRVKDHRNDFIKATIKNLISLNLTWNNTDIMNNSSDINKSGNQTLLNNYLTMVIINYTNNVIFFMQEEGWNGNDDVTALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDY----LADWFRFI 799
            Y++ G  +FQ++E   E     R + H  +F++   +NLI      +  D+ N   +I+K+ ++                            G  DV    WS+ G+L +  TV+TTIGYG +AP T  G+   + YA+ GIP+T L L +IG+     +AD++R I
Sbjct:    3 YLLFGAAVFQTIESGEE-----RRERHHFEFVR---QNLIE-KYNISEKDMRNLFKEISKAIDE----------------------------GYFDVNYDRWSFAGSLFFTGTVVTTIGYGQMAPATVWGRVFCIFYAIFGIPITGLMLKSIGERITEGIADFWRII 132          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Nematostella
Match: EDO33193 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSX6])

HSP 1 Score: 65.0846 bits (157), Expect = 1.249e-11
Identity = 32/74 (43.24%), Postives = 44/74 (59.46%), Query Frame = 2
Query:  611 NWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGD----YLADWFRFIYHKVCRK 820
             WS+ G++ +  TVITTIGYGH  P+T  GK   M+YA +GIPL      +IG+    +LA  FR +  K+  K
Sbjct:   78 QWSFAGSVYFATTVITTIGYGHTVPRTPRGKIFCMIYAAVGIPLALTMFQSIGERFNTFLACMFRRLKRKLGMK 151          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Nematostella
Match: EDO48564 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIT3])

HSP 1 Score: 65.4698 bits (158), Expect = 1.526e-11
Identity = 61/204 (29.90%), Postives = 88/204 (43.14%), Query Frame = 2
Query:  290 LSAILVGYVIIGGFMFQSLEISN------EINTKKRVKDHRNDFIKATIKNLISLNLTW--NNTDIMNNSSDINKSGNQTLLNNYLTMVIINYTNNVIFFMQEEGWNGNDDVTALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHKVCRKYCKMCCQKSRKHHSGLRSK 877
            L AIL+ Y + GGF+F+S E S+         T K+   +R DF          L L W  NN +      +  K  N+ L           Y   +    Q E     D V  +NWS   + L+  TV TT+GYG++AP T  G+   MLY  +GIPL     S +   LA +   I H + ++Y      + ++H S    K
Sbjct:   35 LVAILILYGVFGGFVFKSFEASSIEAAKESQVTAKQTFLNREDF----------LQLIWQDNNHNDALTYEEWAKQANEKL---------DEYEAGIRKSEQSE----PDPV--VNWSLADSWLFACTVFTTVGYGNIAPLTIKGRVFCMLYGAVGIPL----FSVVAGSLASFVTEIIHALHKEY-----HRRKRHESAAMHK 204          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Medaka
Match: kcnk18 (potassium two pore domain channel subfamily K member 18 [Source:NCBI gene;Acc:101159039])

HSP 1 Score: 82.8037 bits (203), Expect = 1.614e-16
Identity = 49/170 (28.82%), Postives = 88/170 (51.76%), Query Frame = 2
Query:  272 LFSHIGLSAILVGYVIIGGFMFQSLEISNEINTKKRVKDHRNDFIKATIKNLISLNLTWNNTDIMNNSSDINKSGNQTLLNNYLTMVIINYTNNVIFFMQEEGWNGNDDVTALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLA 781
            +F H+ L   LV Y ++G  +FQ +E  N+     ++++   +F+   +             DI+ N S  N S +Q+ + + +   +  + N++        W  N D    NW++ G++ +  TV TT+GYG + P T  GK + +LYA++GIPL  L + ++GD+LA
Sbjct:   17 VFPHLALCGTLVAYAVLGALIFQRIEGGNK---PSKIQEDYREFLGEIV-------------DIVRNHSQ-NTSCSQSCMVDQVEKKMKTF-NSI--------WFQNPD----NWTFFGSMFFCCTVFTTVGYGEIYPVTLSGKVVCVLYAMVGIPLMLLVILDVGDFLA 156          

HSP 2 Score: 59.6918 bits (143), Expect = 5.331e-9
Identity = 26/61 (42.62%), Postives = 44/61 (72.13%), Query Frame = 2
Query: 1733 YFCFITLSTIGFGDIVPGTKVDSKNPKEKLIIVSIYVIIGLSVFAMCFKLMQEEVVAKFKR 1915
            YFCFITL+TIGFGDI+P      K+P    +++S+++I+G+++ +M FKL Q  +V  +++
Sbjct:  323 YFCFITLTTIGFGDIIP------KHP-NYFMLISLFIIVGMAIMSMAFKLSQTRIVTCYRK 376          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Medaka
Match: kcnk15 (potassium channel subfamily K member 15 [Source:NCBI gene;Acc:101160319])

HSP 1 Score: 78.5666 bits (192), Expect = 5.615e-15
Identity = 34/75 (45.33%), Postives = 46/75 (61.33%), Query Frame = 2
Query:  611 NWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHKVCRKYCKMC 835
             W + G+  + +TVITTIGYGH AP T  GK   M YA+LGIPLT +   ++G+ +  +  F+ HKV  K C  C
Sbjct:   82 QWKFAGSFYFAITVITTIGYGHAAPGTDAGKVFCMFYAVLGIPLTLVMFQSLGERMNTFVHFLLHKV--KQCLGC 154          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Medaka
Match: kcnk3a (potassium two pore domain channel subfamily K member 3 [Source:NCBI gene;Acc:101167669])

HSP 1 Score: 77.0258 bits (188), Expect = 1.170e-14
Identity = 32/70 (45.71%), Postives = 46/70 (65.71%), Query Frame = 2
Query:  602 TALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHKV 811
              L W++ G+  + +TVITTIGYGH AP T  GK   MLYALLGIPLT +   ++G+ +  + R++ H +
Sbjct:   74 AGLQWNFAGSFYFAITVITTIGYGHAAPSTDGGKVFCMLYALLGIPLTLVMFQSLGERINTFVRYLLHHL 143          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Medaka
Match: kcnk9 (potassium two pore domain channel subfamily K member 9 [Source:NCBI gene;Acc:101171424])

HSP 1 Score: 74.3294 bits (181), Expect = 1.005e-13
Identity = 31/82 (37.80%), Postives = 48/82 (58.54%), Query Frame = 2
Query:  602 TALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHKVCRKYCKMCCQKS 847
              + W + G+  + +TVITTIGYGH AP T  GK   M YA+LGIPLT +   ++G+ +  + +++  ++     K CC  S
Sbjct:   74 AGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLGERMNTFVKYLLKRI-----KKCCGMS 150          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Medaka
Match: kcnk3b (potassium channel subfamily K member 3 [Source:NCBI gene;Acc:101165434])

HSP 1 Score: 73.9442 bits (180), Expect = 1.088e-13
Identity = 30/69 (43.48%), Postives = 43/69 (62.32%), Query Frame = 2
Query:  602 TALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHK 808
              + W + G+  + +TVITTIGYGH AP T  GK   M YALLGIPLT +   ++G+ +    R++ H+
Sbjct:   74 AGVQWKFAGSFYFAITVITTIGYGHAAPSTDSGKVFCMFYALLGIPLTLVMFQSLGERINTLVRYLLHQ 142          
BLAST of Potassium channel subfamily K member 18 vs. Planmine SMEST
Match: SMESG000068804.1 (SMESG000068804.1)

HSP 1 Score: 1245.34 bits (3221), Expect = 0.000e+0
Identity = 651/652 (99.85%), Postives = 651/652 (99.85%), Query Frame = 2
Query:   53 MNTNTNLSFLQSHSFPFFNRQISNKDLHXXXXXXXXXXXXLFYTESRSNLRSKYLQKERIEKTKQCCKRFFTFLFSHIGLSAILVGYVIIGGFMFQSLEISNEINTKKRVKDHRNDFIKATIKNLISLNLTWNNTDIMNNSSDINKSGNQTLLNNYLTMVIINYTNNVIFFMQEEGWNGNDDVTALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHKVCRKYCKMCCQKSRKHHSGLRSKLIKANAFPGMSKKVIKRDRPKQMIKPNNFFDKSIKQLREKLMRFPLKTKKSDDENPSRSQHDPSDCVSTINSQNDKYIFKSYGVARFLPSVKTIKQREALMMNCVSTHVPLINWRDIDKDLEIGSLDNIPHVTDHSDCIRNPYLSTSDFYENQESFNNKPPDELSELHISTSFSQKKESSLYKSLPYLTDQPDTSAKNSSSTPYRSNSFTPDINFVTESIRQVSYVSVNNIMEIENEVKSNNHKTVKLRNATVPISLSLTVXXXXXXXXXXXFTVWGDLDFLKWSYFCFITLSTIGFGDIVPGTKVDSKNPKEKLIIVSIYVIIGLSVFAMCFKLMQEEVVAKFKRLGRXXXXXXXXXXXXXXXXXTSELILLPRSK 2008
            MNTNTNLSFLQSHSFPFFNRQISNKDLHSDSFADSSFKKSLFYTESRSNLRSKYLQKERIEKTKQCCKRFFTFLFSHIGLSAILVGYVIIGGFMFQSLEISNEINTKKRVKDHRNDFIKATIKNLISLNLTWNNTDIMNNSSDINK GNQTLLNNYLTMVIINYTNNVIFFMQEEGWNGNDDVTALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHKVCRKYCKMCCQKSRKHHSGLRSKLIKANAFPGMSKKVIKRDRPKQMIKPNNFFDKSIKQLREKLMRFPLKTKKSDDENPSRSQHDPSDCVSTINSQNDKYIFKSYGVARFLPSVKTIKQREALMMNCVSTHVPLINWRDIDKDLEIGSLDNIPHVTDHSDCIRNPYLSTSDFYENQESFNNKPPDELSELHISTSFSQKKESSLYKSLPYLTDQPDTSAKNSSSTPYRSNSFTPDINFVTESIRQVSYVSVNNIMEIENEVKSNNHKTVKLRNATVPISLSLTVIWIYIIIGAIIFTVWGDLDFLKWSYFCFITLSTIGFGDIVPGTKVDSKNPKEKLIIVSIYVIIGLSVFAMCFKLMQEEVVAKFKRLGRKLGVWKSKVKKHKNHDKTSELILLPRSK
Sbjct:    1 MNTNTNLSFLQSHSFPFFNRQISNKDLHSDSFADSSFKKSLFYTESRSNLRSKYLQKERIEKTKQCCKRFFTFLFSHIGLSAILVGYVIIGGFMFQSLEISNEINTKKRVKDHRNDFIKATIKNLISLNLTWNNTDIMNNSSDINKPGNQTLLNNYLTMVIINYTNNVIFFMQEEGWNGNDDVTALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHKVCRKYCKMCCQKSRKHHSGLRSKLIKANAFPGMSKKVIKRDRPKQMIKPNNFFDKSIKQLREKLMRFPLKTKKSDDENPSRSQHDPSDCVSTINSQNDKYIFKSYGVARFLPSVKTIKQREALMMNCVSTHVPLINWRDIDKDLEIGSLDNIPHVTDHSDCIRNPYLSTSDFYENQESFNNKPPDELSELHISTSFSQKKESSLYKSLPYLTDQPDTSAKNSSSTPYRSNSFTPDINFVTESIRQVSYVSVNNIMEIENEVKSNNHKTVKLRNATVPISLSLTVIWIYIIIGAIIFTVWGDLDFLKWSYFCFITLSTIGFGDIVPGTKVDSKNPKEKLIIVSIYVIIGLSVFAMCFKLMQEEVVAKFKRLGRKLGVWKSKVKKHKNHDKTSELILLPRSK 652          
BLAST of Potassium channel subfamily K member 18 vs. Planmine SMEST
Match: SMESG000019203.1 (SMESG000019203.1)

HSP 1 Score: 172.94 bits (437), Expect = 3.089e-47
Identity = 98/248 (39.52%), Postives = 148/248 (59.68%), Query Frame = 2
Query:  233 EKTKQCCKRFFTFLFSHIGLSAILVGYVIIGGFMFQSLEISNEINTKKRVKDHRNDFIKATIKNLIS--LNLTWNNTDIMNNSSDINKSGNQTLLNNYLTMVIINYTNNVIFFMQEEGWNGNDDVTALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHKVCRKYCKMCCQKSRKHHSGLRSKLIKANAFPGMSKKVIKRDRPKQMIKPNNFFD 970
            EK     K F + LFSHIGLS ++V Y I+GGF+F ++EIS EIN K ++K  RN+  +  ++ ++S  +   +N+++I+ N         + +LN +  +    +  N+     E GWNG  ++T  NWSYEG++LY +TVITTIGYGHV PKTKLG+  T+ YA+ GIPLT LYL+NIGDYLA+ FR +Y ++C   C     K ++  + L    I+ +    +    IK D  + ++  N  F+
Sbjct:   11 EKCVNYSKNFCSCLFSHIGLSGLVVAYTILGGFLFYNIEISGEINVKNQMKIVRNE-TENKLEQILSSEMKADFNSSEILTNI--------RAILNEHERI----FKENIF----ENGWNGRYEITENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLVYSQLCHPLCMKLFTKKKRLTNQLVGHHIRVSDESSIQ---IKSDFNENLLDTNTDFE 238          

HSP 2 Score: 126.331 bits (316), Expect = 7.602e-31
Identity = 65/99 (65.66%), Postives = 80/99 (80.81%), Query Frame = 2
Query: 1631 TVPISLSLTVXXXXXXXXXXXFTVWG-DLDFLKWSYFCFITLSTIGFGDIVPGTKVDSKNPKEKLIIVSIYVIIGLSVFAMCFKLMQEEVVAKFKRLGR 1924
            TVP++L+L ++ +YII+GA +FT WG D D+LKWSYFCFITLSTIGFGDIVPG  V   NPKEKLI+  +YV IGL VFAMCFKLM++E+V K K L +
Sbjct:  324 TVPLTLTLCIMVVYIIMGAFLFTFWGSDNDYLKWSYFCFITLSTIGFGDIVPGISVSDLNPKEKLIVSVLYVAIGLPVFAMCFKLMEDEIVNKVKSLAK 422          
BLAST of Potassium channel subfamily K member 18 vs. Planmine SMEST
Match: SMESG000019992.1 (SMESG000019992.1)

HSP 1 Score: 132.109 bits (331), Expect = 2.028e-33
Identity = 67/123 (54.47%), Postives = 92/123 (74.80%), Query Frame = 2
Query: 1544 VSYVSVNNIMEIENEVKSNNHKTVKLRNATVPISLSLTVXXXXXXXXXXXFTVWGDLDFLKWSYFCFITLSTIGFGDIVPGTKVDSKNPKEKLIIVSIYVIIGLSVFAMCFKLMQEEVVAKFK 1912
            VSY++ +   EI  + ++     +      +PI+++  ++  YI+IGA+ FT+W D D+LKW+YFCFITLSTIGFGDIVPGTK+DS NPKEKLI V  YV++GLSVF+MCFKLM+EE+  K+K
Sbjct:  223 VSYLTYDR--EIPEQSETVEQVNLSYSQIRIPIAITFAIMICYILIGALFFTIWEDNDYLKWAYFCFITLSTIGFGDIVPGTKIDSDNPKEKLIFVVFYVVVGLSVFSMCFKLMEEEIRYKWK 343          

HSP 2 Score: 93.5893 bits (231), Expect = 2.346e-20
Identity = 62/158 (39.24%), Postives = 85/158 (53.80%), Query Frame = 2
Query:  470 NSSDINKSGNQTLLNNYLTMVIINYTNNVIFFMQEEGWNGNDDVTALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHKVCRKYCKMCCQKSRKHHSGLRSKLIKANAFPGMSKKVIKRDRPKQ 943
            NS   N S + + LNN+L    + YT   +  ++ EGWNG       +W+ EG++L+ LTVITTIGYG   PKT+ GKF+T++YA++GIP TFL LSNIG + +  F       C  Y  +   K  K      ++LI            IKR  PKQ
Sbjct:   18 NSLKENISLDPSNLNNFL----LKYTEE-LSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKAF-------CGFYLFLRKSKFLKKQKENFTRLIH-----------IKRSLPKQ 152          
BLAST of Potassium channel subfamily K member 18 vs. Planmine SMEST
Match: SMESG000019992.1 (SMESG000019992.1)

HSP 1 Score: 132.109 bits (331), Expect = 2.897e-33
Identity = 67/123 (54.47%), Postives = 92/123 (74.80%), Query Frame = 2
Query: 1544 VSYVSVNNIMEIENEVKSNNHKTVKLRNATVPISLSLTVXXXXXXXXXXXFTVWGDLDFLKWSYFCFITLSTIGFGDIVPGTKVDSKNPKEKLIIVSIYVIIGLSVFAMCFKLMQEEVVAKFK 1912
            VSY++ +   EI  + ++     +      +PI+++  ++  YI+IGA+ FT+W D D+LKW+YFCFITLSTIGFGDIVPGTK+DS NPKEKLI V  YV++GLSVF+MCFKLM+EE+  K+K
Sbjct:  243 VSYLTYDR--EIPEQSETVEQVNLSYSQIRIPIAITFAIMICYILIGALFFTIWEDNDYLKWAYFCFITLSTIGFGDIVPGTKIDSDNPKEKLIFVVFYVVVGLSVFSMCFKLMEEEIRYKWK 363          

HSP 2 Score: 98.9821 bits (245), Expect = 4.517e-22
Identity = 71/208 (34.13%), Postives = 104/208 (50.00%), Query Frame = 2
Query:  320 IGGFMFQSLEISNEINTKKRVKDHRNDFIKATIKNLISLNLTWNNTDIMNNSSDINKSGNQTLLNNYLTMVIINYTNNVIFFMQEEGWNGNDDVTALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHKVCRKYCKMCCQKSRKHHSGLRSKLIKANAFPGMSKKVIKRDRPKQ 943
            +GGFMF+ +E   E   K ++K      ++               ++ + NS   N S + + LNN+L    + YT  +   ++ EGWNG       +W+ EG++L+ LTVITTIGYG   PKT+ GKF+T++YA++GIP TFL LSNIG + +  F       C  Y  +   K  K      ++LI            IKR  PKQ
Sbjct:    1 MGGFMFKLIENQQERRIKLKMKKTSQRIVEKL-------------SNYILNSLKENISLDPSNLNNFL----LKYTEELSK-LKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKAF-------CGFYLFLRKSKFLKKQKENFTRLIH-----------IKRSLPKQ 172          
BLAST of Potassium channel subfamily K member 18 vs. Planmine SMEST
Match: SMESG000019992.1 (SMESG000019992.1)

HSP 1 Score: 132.109 bits (331), Expect = 2.968e-33
Identity = 67/123 (54.47%), Postives = 92/123 (74.80%), Query Frame = 2
Query: 1544 VSYVSVNNIMEIENEVKSNNHKTVKLRNATVPISLSLTVXXXXXXXXXXXFTVWGDLDFLKWSYFCFITLSTIGFGDIVPGTKVDSKNPKEKLIIVSIYVIIGLSVFAMCFKLMQEEVVAKFK 1912
            VSY++ +   EI  + ++     +      +PI+++  ++  YI+IGA+ FT+W D D+LKW+YFCFITLSTIGFGDIVPGTK+DS NPKEKLI V  YV++GLSVF+MCFKLM+EE+  K+K
Sbjct:  250 VSYLTYDR--EIPEQSETVEQVNLSYSQIRIPIAITFAIMICYILIGALFFTIWEDNDYLKWAYFCFITLSTIGFGDIVPGTKIDSDNPKEKLIFVVFYVVVGLSVFSMCFKLMEEEIRYKWK 370          

HSP 2 Score: 103.605 bits (257), Expect = 1.315e-23
Identity = 73/215 (33.95%), Postives = 109/215 (50.70%), Query Frame = 2
Query:  299 ILVGYVIIGGFMFQSLEISNEINTKKRVKDHRNDFIKATIKNLISLNLTWNNTDIMNNSSDINKSGNQTLLNNYLTMVIINYTNNVIFFMQEEGWNGNDDVTALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHKVCRKYCKMCCQKSRKHHSGLRSKLIKANAFPGMSKKVIKRDRPKQ 943
            ++V Y ++GGFMF+ +E   E   K ++K      ++               ++ + NS   N S + + LNN+L    + YT   +  ++ EGWNG       +W+ EG++L+ LTVITTIGYG   PKT+ GKF+T++YA++GIP TFL LSNIG + +  F       C  Y  +   K  K      ++LI            IKR  PKQ
Sbjct:    1 MIVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKL-------------SNYILNSLKENISLDPSNLNNFL----LKYTEE-LSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKAF-------CGFYLFLRKSKFLKKQKENFTRLIH-----------IKRSLPKQ 179          
The following BLAST results are available for this feature:
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNK181.713e-1428.57potassium two pore domain channel subfamily K memb... [more]
KCNK97.145e-1440.26potassium two pore domain channel subfamily K memb... [more]
KCNK97.776e-1440.26potassium two pore domain channel subfamily K memb... [more]
KCNK97.776e-1440.26potassium two pore domain channel subfamily K memb... [more]
KCNK97.776e-1440.26potassium two pore domain channel subfamily K memb... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
twk-483.867e-3433.77TWiK family of potassium channels [Source:UniProt... [more]
twk-396.992e-3033.02TWiK family of potassium channels [Source:UniProt... [more]
twk-397.991e-3033.02TWiK family of potassium channels [Source:UniProt... [more]
twk-261.673e-1829.67TWiK family of potassium channels [Source:UniProt... [more]
twk-172.230e-1829.03Putative potassium channel subunit n2P17m2-1; TWiK... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sand8.554e-3138.35gene:FBgn0033257 transcript:FBtr0088780[more]
CG91943.715e-3031.46gene:FBgn0035192 transcript:FBtr0072651[more]
CG16881.048e-2428.09gene:FBgn0027589 transcript:FBtr0088495[more]
CG108641.107e-2029.74gene:FBgn0038621 transcript:FBtr0083654[more]
CG343964.618e-1928.27gene:FBgn0085425 transcript:FBtr0112644[more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnk181.378e-1428.81potassium channel, subfamily K, member 18 [Source:... [more]
kcnk181.398e-1428.81potassium channel, subfamily K, member 18 [Source:... [more]
kcnk181.643e-1428.81potassium channel, subfamily K, member 18 [Source:... [more]
kcnk3b2.146e-1445.71potassium channel, subfamily K, member 3b [Source:... [more]
kcnk3a1.242e-1341.43potassium channel, subfamily K, member 3a [Source:... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pole48.668e-1443.66polymerase (DNA-directed), epsilon 4, accessory su... [more]
pole41.519e-1343.66polymerase (DNA-directed), epsilon 4, accessory su... [more]
pole41.907e-1343.66polymerase (DNA-directed), epsilon 4, accessory su... [more]
tbc1d12.877e-1338.96TBC1 domain family member 1 [Source:Xenbase;Acc:XB... [more]
bcdin3d1.978e-1127.65BCDIN3 domain containing RNA methyltransfease [Sou... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kcnk181.963e-1728.36potassium channel, subfamily K, member 18 [Source:... [more]
Kcnk37.420e-1443.06potassium channel, subfamily K, member 3 [Source:M... [more]
Kcnk92.196e-1340.26potassium channel, subfamily K, member 9 [Source:M... [more]
Kcnk153.129e-1251.79potassium channel, subfamily K, member 15 [Source:... [more]
Kcnk153.285e-1251.79potassium channel, subfamily K, member 15 [Source:... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6Q1P3|KCNKI_RAT8.599e-1729.12Potassium channel subfamily K member 18 OS=Rattus ... [more]
sp|Q6VV64|KCNKI_MOUSE1.373e-1628.36Potassium channel subfamily K member 18 OS=Mus mus... [more]
sp|Q22271|UNC58_CAEEL1.426e-1429.79Uncoordinated protein 58 OS=Caenorhabditis elegans... [more]
sp|Q18120|TWK18_CAEEL5.852e-1427.41TWiK family of potassium channels protein 18 OS=Ca... [more]
sp|Q622X0|UNC58_CAEBR7.113e-1430.32Uncoordinated protein 58 OS=Caenorhabditis briggsa... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0L7RCD92.509e-5627.71Potassium channel subfamily K member 9 OS=Habropod... [more]
A0A2A3E4T73.806e-5529.30Potassium channel subfamily K member OS=Apis ceran... [more]
A0A1W4WHW84.912e-5528.57uncharacterized protein LOC108735848 isoform X1 OS... [more]
A0A087ZY411.552e-5428.13Uncharacterized protein OS=Apis mellifera OX=7460 ... [more]
A0A3L8DT768.313e-5327.80Uncharacterized protein OS=Ooceraea biroi OX=20151... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnk152.799e-1445.45potassium channel subfamily K member 15-like [Sour... [more]
ENSAMXT00000047723.18.551e-1425.27pep primary_assembly:Astyanax_mexicanus-2.0:9:1589... [more]
ENSAMXT00000032793.11.364e-1347.83pep primary_assembly:Astyanax_mexicanus-2.0:22:285... [more]
kcnk92.910e-1338.96potassium two pore domain channel subfamily K memb... [more]
KCNK42.302e-1127.01potassium channel subfamily K member 4-like [Sourc... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003416.18.038e-1440.48pep scaffold:Pmarinus_7.0:GL476517:78247:80718:1 g... [more]
KCNK165.422e-1228.66potassium two pore domain channel subfamily K memb... [more]
KCNK165.478e-1228.66potassium two pore domain channel subfamily K memb... [more]
kcnk71.771e-1025.31potassium channel, subfamily K, member 7 [Source:Z... [more]
KCNK102.772e-837.50potassium two pore domain channel subfamily K memb... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
TOK13.556e-740.00Outward-rectifier potassium channel of the plasma ... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO476686.062e-1452.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO463281.738e-1240.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO359234.573e-1229.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO331931.249e-1143.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO485641.526e-1129.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnk181.614e-1628.82potassium two pore domain channel subfamily K memb... [more]
kcnk155.615e-1545.33potassium channel subfamily K member 15 [Source:NC... [more]
kcnk3a1.170e-1445.71potassium two pore domain channel subfamily K memb... [more]
kcnk91.005e-1337.80potassium two pore domain channel subfamily K memb... [more]
kcnk3b1.088e-1343.48potassium channel subfamily K member 3 [Source:NCB... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000068804.10.000e+099.85SMESG000068804.1[more]
SMESG000019203.13.089e-4739.52SMESG000019203.1[more]
SMESG000019992.12.028e-3354.47SMESG000019992.1[more]
SMESG000019992.12.897e-3354.47SMESG000019992.1[more]
SMESG000019992.12.968e-3354.47SMESG000019992.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011009 ID=SMED30011009|Name=Potassium channel subfamily K member 18|organism=Schmidtea mediterranea sexual|type=transcript|length=2035bp
GAGAGATTCTCATTTAAAATTTTTCCCCATTTATTACTAGTTTTGTCTTA
ACATGAATACAAACACAAATTTATCATTTTTACAGTCACACTCGTTTCCA
TTTTTCAACCGCCAAATATCCAACAAAGATCTCCATTCTGATTCATTTGC
AGACTCGTCATTTAAAAAATCACTTTTTTATACCGAAAGCCGTAGCAATC
TCAGAAGTAAGTATTTACAGAAAGAAAGAATCGAAAAAACCAAACAATGC
TGCAAGAGGTTCTTCACGTTTCTATTCTCTCACATTGGGCTGTCAGCGAT
ATTGGTGGGGTATGTGATCATCGGAGGATTTATGTTCCAAAGCTTGGAAA
TATCAAATGAGATAAATACTAAAAAAAGAGTGAAAGATCATCGAAATGAC
TTCATTAAAGCCACCATTAAAAATTTGATATCTTTAAATCTTACGTGGAA
TAATACGGATATCATGAACAATTCTTCCGATATAAATAAATCTGGAAATC
AGACTCTACTAAATAATTATTTGACCATGGTGATAATAAATTACACAAAT
AATGTTATTTTTTTCATGCAAGAAGAAGGATGGAATGGAAATGATGATGT
GACTGCTTTGAATTGGTCTTACGAGGGTGCTCTTTTGTATGTATTAACCG
TCATCACAACAATCGGTTACGGGCATGTGGCACCAAAAACAAAATTAGGA
AAATTCATAACGATGCTATATGCTCTTCTAGGAATTCCTTTGACATTTCT
TTACCTTTCAAACATTGGCGATTATCTCGCAGACTGGTTTCGTTTCATTT
ACCATAAAGTCTGTAGGAAATATTGTAAAATGTGTTGTCAGAAATCTCGC
AAACACCATTCCGGTTTGCGAAGCAAACTCATCAAAGCCAACGCGTTTCC
TGGAATGTCTAAGAAAGTCATCAAACGAGACCGGCCGAAACAAATGATCA
AACCAAATAATTTCTTTGATAAATCTATCAAGCAGCTCAGAGAAAAATTA
ATGAGATTTCCATTGAAAACGAAAAAATCTGACGACGAAAATCCCTCGAG
GTCTCAACATGACCCATCGGATTGCGTGTCGACCATCAATTCTCAAAATG
ACAAATATATTTTCAAATCTTACGGAGTTGCGAGGTTTCTTCCATCTGTC
AAAACTATTAAACAAAGAGAAGCTTTGATGATGAATTGCGTTTCCACTCA
CGTCCCTTTAATTAATTGGAGGGACATTGATAAAGATTTGGAAATCGGCT
CACTAGACAATATTCCCCATGTAACAGACCATTCAGACTGCATCCGAAAT
CCTTATTTATCAACTTCGGACTTCTATGAAAACCAAGAATCATTCAATAA
TAAGCCTCCAGACGAGCTTTCAGAGCTCCATATTTCCACTTCATTTTCAC
AAAAAAAAGAAAGTTCTCTCTATAAATCTCTTCCATATTTAACTGATCAG
CCTGATACCTCAGCAAAGAATTCCTCTTCGACTCCATATCGAAGCAACTC
ATTTACTCCCGACATAAATTTCGTTACAGAAAGCATCCGCCAAGTCAGCT
ACGTTTCCGTTAATAATATTATGGAAATTGAAAATGAAGTTAAATCTAAC
AATCACAAAACAGTGAAATTACGAAACGCAACGGTTCCGATCAGTCTTTC
TTTGACTGTAATTTGGATTTACATTATTATCGGTGCAATTATCTTTACGG
TATGGGGGGATCTTGATTTTCTCAAATGGTCCTACTTTTGCTTTATTACA
TTATCCACGATTGGTTTCGGAGATATTGTCCCAGGAACTAAAGTTGATTC
AAAAAATCCAAAAGAAAAGTTGATAATAGTGTCAATTTATGTTATTATTG
GTCTGTCAGTATTTGCCATGTGCTTTAAGCTGATGCAAGAAGAGGTTGTA
GCTAAATTTAAAAGACTCGGAAGAAAACTAGGAGTCTGGAAGAGTAAGGT
CAAAAAACACAAGAACCACGATAAAACATCTGAATTGATATTGTTACCAA
GAAGTAAATAGATAATTGCAACAATGTTTACTACA
back to top

protein sequence of SMED30011009-orf-1

>SMED30011009-orf-1 ID=SMED30011009-orf-1|Name=SMED30011009-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=653bp
MNTNTNLSFLQSHSFPFFNRQISNKDLHSDSFADSSFKKSLFYTESRSNL
RSKYLQKERIEKTKQCCKRFFTFLFSHIGLSAILVGYVIIGGFMFQSLEI
SNEINTKKRVKDHRNDFIKATIKNLISLNLTWNNTDIMNNSSDINKSGNQ
TLLNNYLTMVIINYTNNVIFFMQEEGWNGNDDVTALNWSYEGALLYVLTV
ITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIY
HKVCRKYCKMCCQKSRKHHSGLRSKLIKANAFPGMSKKVIKRDRPKQMIK
PNNFFDKSIKQLREKLMRFPLKTKKSDDENPSRSQHDPSDCVSTINSQND
KYIFKSYGVARFLPSVKTIKQREALMMNCVSTHVPLINWRDIDKDLEIGS
LDNIPHVTDHSDCIRNPYLSTSDFYENQESFNNKPPDELSELHISTSFSQ
KKESSLYKSLPYLTDQPDTSAKNSSSTPYRSNSFTPDINFVTESIRQVSY
VSVNNIMEIENEVKSNNHKTVKLRNATVPISLSLTVIWIYIIIGAIIFTV
WGDLDFLKWSYFCFITLSTIGFGDIVPGTKVDSKNPKEKLIIVSIYVIIG
LSVFAMCFKLMQEEVVAKFKRLGRKLGVWKSKVKKHKNHDKTSELILLPR
SK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR0032802pore_dom_K_chnl
IPR013099K_chnl_dom
Vocabulary: biological process
TermDefinition
GO:0071805potassium ion transmembrane transport
GO:0006810transport
GO:0006811ion transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005267potassium channel activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003280Two pore domain potassium channelPRINTSPR013332POREKCHANELcoord: 199..227
score: 54.13
coord: 568..577
score: 75.16
IPR013099Potassium channel domainPFAMPF07885Ion_trans_2coord: 172..242
e-value: 1.4E-16
score: 60.2
coord: 536..614
e-value: 1.1E-15
score: 57.4
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 73..286
e-value: 1.1E-45
score: 157.9
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 487..629
e-value: 7.3E-28
score: 99.4
NoneNo IPR availablePANTHERPTHR11003POTASSIUM CHANNEL, SUBFAMILY Kcoord: 66..629
NoneNo IPR availablePANTHERPTHR11003:SF276TWIK FAMILY OF POTASSIUM CHANNELScoord: 66..629
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 65..264
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 519..640
NoneNo IPR availableTMHMMTMhelixcoord: 73..95
NoneNo IPR availableTMHMMTMhelixcoord: 590..612
NoneNo IPR availableTMHMMTMhelixcoord: 219..238
NoneNo IPR availableTMHMMTMhelixcoord: 530..552
NoneNo IPR availableTMHMMTMhelixcoord: 192..209
NoneNo IPR availableTMHMMTMhelixcoord: 152..171