Multidrug and toxin extrusion protein

Overview
NameMultidrug and toxin extrusion protein
Smed IDSMED30010999
Length (bp)120
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010999

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30010999SMESG000065608.1 dd_Smed_v4_7241_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30010999SMESG000065608.1 dd_Smed_v4_7241_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
tailSMED30010999SMESG000065608.1 dd_Smed_v6_7241_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Human
Match: SLC47A2 (solute carrier family 47 member 2 [Source:HGNC Symbol;Acc:HGNC:26439])

HSP 1 Score: 46.2098 bits (108), Expect = 1.145e-7
Identity = 20/39 (51.28%), Postives = 29/39 (74.36%), Query Frame = 3
Query:    3 FINILGVSIDLGFSTAFDTLFAQIYGSDQKKKMGSLLQR 119
            F+N+ GVS+ +G S+A DTL +Q +GS  KK +G +LQR
Sbjct:   76 FVNVCGVSVGVGLSSACDTLMSQSFGSPNKKHVGVILQR 114          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Human
Match: SLC47A2 (solute carrier family 47 member 2 [Source:HGNC Symbol;Acc:HGNC:26439])

HSP 1 Score: 46.2098 bits (108), Expect = 1.267e-7
Identity = 20/39 (51.28%), Postives = 29/39 (74.36%), Query Frame = 3
Query:    3 FINILGVSIDLGFSTAFDTLFAQIYGSDQKKKMGSLLQR 119
            F+N+ GVS+ +G S+A DTL +Q +GS  KK +G +LQR
Sbjct:   76 FVNVCGVSVGVGLSSACDTLMSQSFGSPNKKHVGVILQR 114          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Human
Match: SLC47A2 (solute carrier family 47 member 2 [Source:HGNC Symbol;Acc:HGNC:26439])

HSP 1 Score: 46.2098 bits (108), Expect = 1.357e-7
Identity = 20/39 (51.28%), Postives = 29/39 (74.36%), Query Frame = 3
Query:    3 FINILGVSIDLGFSTAFDTLFAQIYGSDQKKKMGSLLQR 119
            F+N+ GVS+ +G S+A DTL +Q +GS  KK +G +LQR
Sbjct:   76 FVNVCGVSVGVGLSSACDTLMSQSFGSPNKKHVGVILQR 114          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Human
Match: SLC47A2 (solute carrier family 47 member 2 [Source:HGNC Symbol;Acc:HGNC:26439])

HSP 1 Score: 45.0542 bits (105), Expect = 3.195e-7
Identity = 20/39 (51.28%), Postives = 29/39 (74.36%), Query Frame = 3
Query:    3 FINILGVSIDLGFSTAFDTLFAQIYGSDQKKKMGSLLQR 119
            F+N+ GVS+ +G S+A DTL +Q +GS  KK +G +LQR
Sbjct:   76 FVNVCGVSVGVGLSSACDTLMSQSFGSPNKKHVGVILQR 114          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Human
Match: SLC47A1 (solute carrier family 47 member 1 [Source:HGNC Symbol;Acc:HGNC:25588])

HSP 1 Score: 45.0542 bits (105), Expect = 3.361e-7
Identity = 20/38 (52.63%), Postives = 26/38 (68.42%), Query Frame = 3
Query:    6 INILGVSIDLGFSTAFDTLFAQIYGSDQKKKMGSLLQR 119
            IN+ GVS+  G S+A DTL +Q YGS   K +G +LQR
Sbjct:   81 INVTGVSVGFGLSSACDTLISQTYGSQNLKHVGVILQR 118          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Zebrafish
Match: BX248108.1 (multidrug and toxin extrusion protein 1-like [Source:NCBI gene;Acc:560089])

HSP 1 Score: 41.2022 bits (95), Expect = 5.653e-6
Identity = 18/38 (47.37%), Postives = 28/38 (73.68%), Query Frame = 3
Query:    6 INILGVSIDLGFSTAFDTLFAQIYGSDQKKKMGSLLQR 119
            IN+ G+SI  G ++A DTL +Q +GS+  K++G +LQR
Sbjct:   97 INVTGISIGSGLASACDTLISQTFGSNNLKRVGVILQR 134          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Zebrafish
Match: slc47a2.1 (solute carrier family 47 member 2.1 [Source:NCBI gene;Acc:560024])

HSP 1 Score: 40.817 bits (94), Expect = 6.176e-6
Identity = 18/38 (47.37%), Postives = 28/38 (73.68%), Query Frame = 3
Query:    6 INILGVSIDLGFSTAFDTLFAQIYGSDQKKKMGSLLQR 119
            IN+ G+SI  G ++A DTL +Q +GS+  K++G +LQR
Sbjct:   99 INVTGISIGSGLASACDTLISQTFGSNNLKRVGVILQR 136          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Xenopus
Match: tysnd1 (trypsin domain containing 1 [Source:Xenbase;Acc:XB-GENE-972865])

HSP 1 Score: 41.9726 bits (97), Expect = 2.819e-6
Identity = 18/38 (47.37%), Postives = 27/38 (71.05%), Query Frame = 3
Query:    6 INILGVSIDLGFSTAFDTLFAQIYGSDQKKKMGSLLQR 119
            IN+ GVS+  G S+A DTL +Q +G    K++G++LQR
Sbjct:   92 INVTGVSVGSGLSSACDTLISQTFGGRNLKRVGTILQR 129          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Mouse
Match: Slc47a1 (solute carrier family 47, member 1 [Source:MGI Symbol;Acc:MGI:1914723])

HSP 1 Score: 42.3578 bits (98), Expect = 2.011e-6
Identity = 19/38 (50.00%), Postives = 26/38 (68.42%), Query Frame = 3
Query:    6 INILGVSIDLGFSTAFDTLFAQIYGSDQKKKMGSLLQR 119
            IN+ G+S+  G S+A DTL +Q YGS   K +G +LQR
Sbjct:   81 INVTGISVGHGLSSACDTLISQTYGSQNLKHVGVILQR 118          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Mouse
Match: Slc47a1 (solute carrier family 47, member 1 [Source:MGI Symbol;Acc:MGI:1914723])

HSP 1 Score: 41.5874 bits (96), Expect = 3.221e-6
Identity = 19/38 (50.00%), Postives = 26/38 (68.42%), Query Frame = 3
Query:    6 INILGVSIDLGFSTAFDTLFAQIYGSDQKKKMGSLLQR 119
            IN+ G+S+  G S+A DTL +Q YGS   K +G +LQR
Sbjct:   81 INVTGISVGHGLSSACDTLISQTYGSQNLKHVGVILQR 118          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Mouse
Match: Slc47a1 (solute carrier family 47, member 1 [Source:MGI Symbol;Acc:MGI:1914723])

HSP 1 Score: 40.817 bits (94), Expect = 5.815e-6
Identity = 19/38 (50.00%), Postives = 26/38 (68.42%), Query Frame = 3
Query:    6 INILGVSIDLGFSTAFDTLFAQIYGSDQKKKMGSLLQR 119
            IN+ G+S+  G S+A DTL +Q YGS   K +G +LQR
Sbjct:   31 INVTGISVGHGLSSACDTLISQTYGSQNLKHVGVILQR 68          
BLAST of Multidrug and toxin extrusion protein vs. UniProt/SwissProt
Match: sp|Q5R7E4|S47A2_PONAB (Multidrug and toxin extrusion protein 2 OS=Pongo abelii OX=9601 GN=SLC47A2 PE=2 SV=1)

HSP 1 Score: 46.2098 bits (108), Expect = 5.463e-7
Identity = 20/39 (51.28%), Postives = 29/39 (74.36%), Query Frame = 3
Query:    3 FINILGVSIDLGFSTAFDTLFAQIYGSDQKKKMGSLLQR 119
            F+N+ GVS+ +G S+A DTL +Q +GS  KK +G +LQR
Sbjct:   76 FVNVCGVSVGVGLSSACDTLMSQSFGSPNKKHVGVILQR 114          
BLAST of Multidrug and toxin extrusion protein vs. UniProt/SwissProt
Match: sp|Q86VL8|S47A2_HUMAN (Multidrug and toxin extrusion protein 2 OS=Homo sapiens OX=9606 GN=SLC47A2 PE=1 SV=1)

HSP 1 Score: 46.2098 bits (108), Expect = 6.516e-7
Identity = 20/39 (51.28%), Postives = 29/39 (74.36%), Query Frame = 3
Query:    3 FINILGVSIDLGFSTAFDTLFAQIYGSDQKKKMGSLLQR 119
            F+N+ GVS+ +G S+A DTL +Q +GS  KK +G +LQR
Sbjct:   76 FVNVCGVSVGVGLSSACDTLMSQSFGSPNKKHVGVILQR 114          
BLAST of Multidrug and toxin extrusion protein vs. UniProt/SwissProt
Match: sp|A7KAU3|S47A2_RABIT (Multidrug and toxin extrusion protein 2 OS=Oryctolagus cuniculus OX=9986 GN=SLC47A2 PE=1 SV=1)

HSP 1 Score: 45.0542 bits (105), Expect = 1.428e-6
Identity = 20/39 (51.28%), Postives = 28/39 (71.79%), Query Frame = 3
Query:    3 FINILGVSIDLGFSTAFDTLFAQIYGSDQKKKMGSLLQR 119
            F+N+ GVS+  G S+A DTL +Q +GS  KK +G +LQR
Sbjct:  105 FVNVCGVSVGAGLSSACDTLMSQSFGSPNKKHVGVILQR 143          
BLAST of Multidrug and toxin extrusion protein vs. UniProt/SwissProt
Match: sp|A7KAU2|S47A1_RABIT (Multidrug and toxin extrusion protein 1 OS=Oryctolagus cuniculus OX=9986 GN=SLC47A1 PE=2 SV=1)

HSP 1 Score: 45.0542 bits (105), Expect = 1.486e-6
Identity = 20/38 (52.63%), Postives = 27/38 (71.05%), Query Frame = 3
Query:    6 INILGVSIDLGFSTAFDTLFAQIYGSDQKKKMGSLLQR 119
            IN++GVS+  G S+A DTL +Q YGS   K +G +LQR
Sbjct:   80 INVMGVSVGFGLSSACDTLISQTYGSRNLKHVGVILQR 117          
BLAST of Multidrug and toxin extrusion protein vs. UniProt/SwissProt
Match: sp|Q96FL8|S47A1_HUMAN (Multidrug and toxin extrusion protein 1 OS=Homo sapiens OX=9606 GN=SLC47A1 PE=1 SV=1)

HSP 1 Score: 44.2838 bits (103), Expect = 3.071e-6
Identity = 20/38 (52.63%), Postives = 26/38 (68.42%), Query Frame = 3
Query:    6 INILGVSIDLGFSTAFDTLFAQIYGSDQKKKMGSLLQR 119
            IN+ GVS+  G S+A DTL +Q YGS   K +G +LQR
Sbjct:   81 INVTGVSVGFGLSSACDTLISQTYGSQNLKHVGVILQR 118          
BLAST of Multidrug and toxin extrusion protein vs. TrEMBL
Match: A0A0H3YKK1 (Multidrug and toxin extrusion protein OS=Schmidtea mediterranea OX=79327 GN=slc47a-1 PE=2 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 3.899e-11
Identity = 30/38 (78.95%), Postives = 35/38 (92.11%), Query Frame = 3
Query:    6 INILGVSIDLGFSTAFDTLFAQIYGSDQKKKMGSLLQR 119
            INI G SIDLGFST+F+TLFAQI+GS+QKKKMG +LQR
Sbjct:   88 INIFGYSIDLGFSTSFNTLFAQIFGSEQKKKMGIILQR 125          
BLAST of Multidrug and toxin extrusion protein vs. TrEMBL
Match: A0A2H1CJS6 (Uncharacterized protein (Fragment) OS=Fasciola hepatica OX=6192 GN=D915_04920 PE=4 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 1.094e-10
Identity = 27/39 (69.23%), Postives = 33/39 (84.62%), Query Frame = 3
Query:    3 FINILGVSIDLGFSTAFDTLFAQIYGSDQKKKMGSLLQR 119
             IN+LG+S+D GF+TAFDTLF+Q YGS QKK +G LLQR
Sbjct:   63 LINVLGLSVDTGFATAFDTLFSQAYGSKQKKVLGLLLQR 101          
BLAST of Multidrug and toxin extrusion protein vs. TrEMBL
Match: A0A4E0S2H5 (Multidrug and toxin extrusion protein OS=Fasciola hepatica OX=6192 GN=D915_003314 PE=3 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 1.978e-9
Identity = 27/39 (69.23%), Postives = 33/39 (84.62%), Query Frame = 3
Query:    3 FINILGVSIDLGFSTAFDTLFAQIYGSDQKKKMGSLLQR 119
             IN+LG+S+D GF+TAFDTLF+Q YGS QKK +G LLQR
Sbjct:   67 LINVLGLSVDTGFATAFDTLFSQAYGSKQKKVLGLLLQR 105          
BLAST of Multidrug and toxin extrusion protein vs. TrEMBL
Match: A0A183T464 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS11262 PE=4 SV=1)

HSP 1 Score: 57.3806 bits (137), Expect = 3.436e-9
Identity = 26/38 (68.42%), Postives = 32/38 (84.21%), Query Frame = 3
Query:    6 INILGVSIDLGFSTAFDTLFAQIYGSDQKKKMGSLLQR 119
            IN+LG+SID+GFSTA +TLF Q YGS ++K MG LLQR
Sbjct:   36 INVLGLSIDMGFSTASETLFCQTYGSKKRKLMGLLLQR 73          
BLAST of Multidrug and toxin extrusion protein vs. TrEMBL
Match: A0A158QTL5 (Multidrug and toxin extrusion protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS3302 PE=3 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 1.496e-8
Identity = 26/38 (68.42%), Postives = 33/38 (86.84%), Query Frame = 3
Query:    6 INILGVSIDLGFSTAFDTLFAQIYGSDQKKKMGSLLQR 119
            IN+LG+SID+GFSTA DTLF+Q YGS ++K MG +LQR
Sbjct:   36 INVLGLSIDMGFSTASDTLFSQTYGSSKRKLMGIILQR 73          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Cavefish
Match: slc47a2.1 (solute carrier family 47 member 1 [Source:NCBI gene;Acc:103046628])

HSP 1 Score: 40.817 bits (94), Expect = 5.497e-6
Identity = 18/38 (47.37%), Postives = 28/38 (73.68%), Query Frame = 3
Query:    6 INILGVSIDLGFSTAFDTLFAQIYGSDQKKKMGSLLQR 119
            IN+ G+SI  G ++A DTL +Q +GS+  K++G +LQR
Sbjct:   96 INVTGLSIGSGLASACDTLISQTFGSNNLKRVGVILQR 133          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Nematostella
Match: EDO46474 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ02])

HSP 1 Score: 40.0466 bits (92), Expect = 4.545e-6
Identity = 17/39 (43.59%), Postives = 26/39 (66.67%), Query Frame = 3
Query:    3 FINILGVSIDLGFSTAFDTLFAQIYGSDQKKKMGSLLQR 119
            FIN+ G S+ +G  TA +TL +Q YG+ +   +G+ LQR
Sbjct:   49 FINVTGYSVAVGLCTALETLCSQAYGAKKYGMVGTYLQR 87          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Medaka
Match: slc47a3 (multidrug and toxin extrusion protein 1 [Source:NCBI gene;Acc:101163594])

HSP 1 Score: 41.5874 bits (96), Expect = 2.720e-6
Identity = 19/37 (51.35%), Postives = 27/37 (72.97%), Query Frame = 3
Query:    9 NILGVSIDLGFSTAFDTLFAQIYGSDQKKKMGSLLQR 119
            N+ GVSI +G ++A DTL +Q YGS   +K+G +LQR
Sbjct:   86 NVTGVSIGVGLASACDTLISQTYGSGNLQKVGVILQR 122          
BLAST of Multidrug and toxin extrusion protein vs. Planmine SMEST
Match: SMESG000065608.1 (SMESG000065608.1)

HSP 1 Score: 80.8777 bits (198), Expect = 3.044e-20
Identity = 39/39 (100.00%), Postives = 39/39 (100.00%), Query Frame = 3
Query:    3 FINILGVSIDLGFSTAFDTLFAQIYGSDQKKKMGSLLQR 119
            FINILGVSIDLGFSTAFDTLFAQIYGSDQKKKMGSLLQR
Sbjct:   87 FINILGVSIDLGFSTAFDTLFAQIYGSDQKKKMGSLLQR 125          
BLAST of Multidrug and toxin extrusion protein vs. Planmine SMEST
Match: SMESG000005478.1 (SMESG000005478.1)

HSP 1 Score: 65.0846 bits (157), Expect = 1.077e-14
Identity = 30/38 (78.95%), Postives = 35/38 (92.11%), Query Frame = 3
Query:    6 INILGVSIDLGFSTAFDTLFAQIYGSDQKKKMGSLLQR 119
            INI G SIDLGFST+F+TLFAQI+GS+QKKKMG +LQR
Sbjct:   20 INIFGYSIDLGFSTSFNTLFAQIFGSEQKKKMGIILQR 57          
BLAST of Multidrug and toxin extrusion protein vs. Planmine SMEST
Match: SMESG000005478.1 (SMESG000005478.1)

HSP 1 Score: 65.0846 bits (157), Expect = 1.098e-14
Identity = 30/38 (78.95%), Postives = 35/38 (92.11%), Query Frame = 3
Query:    6 INILGVSIDLGFSTAFDTLFAQIYGSDQKKKMGSLLQR 119
            INI G SIDLGFST+F+TLFAQI+GS+QKKKMG +LQR
Sbjct:   29 INIFGYSIDLGFSTSFNTLFAQIFGSEQKKKMGIILQR 66          
BLAST of Multidrug and toxin extrusion protein vs. Planmine SMEST
Match: SMESG000005478.1 (SMESG000005478.1)

HSP 1 Score: 65.0846 bits (157), Expect = 1.130e-14
Identity = 30/38 (78.95%), Postives = 35/38 (92.11%), Query Frame = 3
Query:    6 INILGVSIDLGFSTAFDTLFAQIYGSDQKKKMGSLLQR 119
            INI G SIDLGFST+F+TLFAQI+GS+QKKKMG +LQR
Sbjct:   29 INIFGYSIDLGFSTSFNTLFAQIFGSEQKKKMGIILQR 66          
BLAST of Multidrug and toxin extrusion protein vs. Planmine SMEST
Match: SMESG000005478.1 (SMESG000005478.1)

HSP 1 Score: 65.0846 bits (157), Expect = 1.153e-14
Identity = 30/38 (78.95%), Postives = 35/38 (92.11%), Query Frame = 3
Query:    6 INILGVSIDLGFSTAFDTLFAQIYGSDQKKKMGSLLQR 119
            INI G SIDLGFST+F+TLFAQI+GS+QKKKMG +LQR
Sbjct:   20 INIFGYSIDLGFSTSFNTLFAQIFGSEQKKKMGIILQR 57          
The following BLAST results are available for this feature:
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC47A21.145e-751.28solute carrier family 47 member 2 [Source:HGNC Sym... [more]
SLC47A21.267e-751.28solute carrier family 47 member 2 [Source:HGNC Sym... [more]
SLC47A21.357e-751.28solute carrier family 47 member 2 [Source:HGNC Sym... [more]
SLC47A23.195e-751.28solute carrier family 47 member 2 [Source:HGNC Sym... [more]
SLC47A13.361e-752.63solute carrier family 47 member 1 [Source:HGNC Sym... [more]
back to top
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
BX248108.15.653e-647.37multidrug and toxin extrusion protein 1-like [Sour... [more]
slc47a2.16.176e-647.37solute carrier family 47 member 2.1 [Source:NCBI g... [more]
back to top
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tysnd12.819e-647.37trypsin domain containing 1 [Source:Xenbase;Acc:XB... [more]
back to top
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Slc47a12.011e-650.00solute carrier family 47, member 1 [Source:MGI Sym... [more]
Slc47a13.221e-650.00solute carrier family 47, member 1 [Source:MGI Sym... [more]
Slc47a15.815e-650.00solute carrier family 47, member 1 [Source:MGI Sym... [more]
back to top
BLAST of Multidrug and toxin extrusion protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5R7E4|S47A2_PONAB5.463e-751.28Multidrug and toxin extrusion protein 2 OS=Pongo a... [more]
sp|Q86VL8|S47A2_HUMAN6.516e-751.28Multidrug and toxin extrusion protein 2 OS=Homo sa... [more]
sp|A7KAU3|S47A2_RABIT1.428e-651.28Multidrug and toxin extrusion protein 2 OS=Oryctol... [more]
sp|A7KAU2|S47A1_RABIT1.486e-652.63Multidrug and toxin extrusion protein 1 OS=Oryctol... [more]
sp|Q96FL8|S47A1_HUMAN3.071e-652.63Multidrug and toxin extrusion protein 1 OS=Homo sa... [more]
back to top
BLAST of Multidrug and toxin extrusion protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YKK13.899e-1178.95Multidrug and toxin extrusion protein OS=Schmidtea... [more]
A0A2H1CJS61.094e-1069.23Uncharacterized protein (Fragment) OS=Fasciola hep... [more]
A0A4E0S2H51.978e-969.23Multidrug and toxin extrusion protein OS=Fasciola ... [more]
A0A183T4643.436e-968.42Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A158QTL51.496e-868.42Multidrug and toxin extrusion protein OS=Mesocesto... [more]
back to top
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
slc47a2.15.497e-647.37solute carrier family 47 member 1 [Source:NCBI gen... [more]
back to top
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO464744.545e-643.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
slc47a32.720e-651.35multidrug and toxin extrusion protein 1 [Source:NC... [more]
back to top
BLAST of Multidrug and toxin extrusion protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000065608.13.044e-20100.00SMESG000065608.1[more]
SMESG000005478.11.077e-1478.95SMESG000005478.1[more]
SMESG000005478.11.098e-1478.95SMESG000005478.1[more]
SMESG000005478.11.130e-1478.95SMESG000005478.1[more]
SMESG000005478.11.153e-1478.95SMESG000005478.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010999 ID=SMED30010999|Name=Multidrug and toxin extrusion protein|organism=Schmidtea mediterranea sexual|type=transcript|length=120bp
AGTTTATCAATATTCTCGGTGTCAGCATTGATCTCGGATTTTCTACAGCC
TTTGATACATTATTTGCACAGATTTATGGAAGTGATCAAAAGAAAAAGAT
GGGATCGCTTTTACAAAGAG
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0042908xenobiotic transport
GO:0006855drug transmembrane transport
GO:0055085transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0042910xenobiotic transporter activity
GO:0015238drug transmembrane transporter activity
GO:0015297antiporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000421tail
PLANA:0003116parenchymal cell
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane