nuclear pore complex protein Nup155

Overview
Namenuclear pore complex protein Nup155
Smed IDSMED30010978
Length (bp)3827
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of nuclear pore complex protein Nup155 (SMED30010978) t-SNE clustered cells

Violin plots show distribution of expression levels for nuclear pore complex protein Nup155 (SMED30010978) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of nuclear pore complex protein Nup155 (SMED30010978) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for nuclear pore complex protein Nup155 (SMED30010978) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010978

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30010978SMESG000035494.1 SmedASXL_018024SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30010978SMESG000035494.1 SmedASXL_018024SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
posterior muscle cellSMED30010978SMESG000035494.1 dd_Smed_v4_7844_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30010978SMESG000035494.1 dd_Smed_v4_7844_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30010978SMESG000035494.1 SMED_37221_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30010978SMESG000035494.1 SMED_37221_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of nuclear pore complex protein Nup155 vs. Ensembl Human
Match: NUP155 (nucleoporin 155 [Source:HGNC Symbol;Acc:HGNC:8063])

HSP 1 Score: 265.003 bits (676), Expect = 1.156e-71
Identity = 181/571 (31.70%), Postives = 297/571 (52.01%), Query Frame = 1
Query:   64 EKILNILESQLFKEKNIHNLVDQLHIQQ-NHVSVSGHKDSDYPDVGINISSNIRISKTSE-----MPKELQERTRDMKQNCLIGVFKDIERIWVTVDTDLFIWNYENGSDLAYYDGCCDTILAVELIKPKQKVFNTCIHYLLILAGQVEILVMGVSI------RGYKNNTL----ELLPEPLFKIATENEHITAIQDI-NGRIVLGTKSGNVLEISYWSEKPSWFKFGQSAVYSNIKYSHENDYKLCARLLNHSTWKLSVLLPNIIVNGLMINEPIVQITADPSRNVFYTRSDNSLIAQYQLLPN-DGLQRLNYVTEDSFVSKAYKSVKSVEKHQFKNIVELCPLGEGYGSL--QLMAITQSGVRLYFM-----------DNLQLCHVRMPP-ISQSSMFGKITNVRLCCESRGSVLMICGSSIDNQALYTISPDAFVLPE-LVETVSMSWAQGSSWFL------------MPLDRNDNKWHAHPVIQTQHLDPLRRFLMVSVENIIQLELPSPIDYLREILEKCSSPQSPAIKSWINHYGPEETIYAALVI-----ASDKRSSFVASRAI 1626
            E    +++ QL +++   +L + L +   N+ +VSG  D DYP  G  + S   + + S      +P EL E+   M+ NC++GVF  I R W+T+D+D+F+WNYE+G DLAY+DG  +TILAV L+KPK  +F   + +LL+LA  V+I+++G+S        G  N++L    +LLP+PL+ + T+N ++  I    NGRI L  K G + E++Y +E   WF                   + C R +NHS   LS L+P+++      ++PI+QI  D SRN+ YTRS+  +I  Y L  +  G+ R+  V++++ VS A    +++++  FK IV++  + E   SL  QL+A+T +GVRLYF            + L L HVR+PP  S SS   K + V     S+G +LM    + DN  L+ ++ D F   + ++ET   +   G SW L             PL+++       PV+  QH+ P ++F+++S +  +      P+D LR +L          I+ +   +  ++     L++     A D+  S  A+RA 
Sbjct:   24 ENAGRLIDRQLQEDRMYPDLSELLMVSAPNNPTVSGMSDMDYPLQGPGLLSVPNLPEISSIRRVPLPPELVEQFGHMQCNCMMGVFPPISRAWLTIDSDIFMWNYEDGGDLAYFDGLSETILAVGLVKPKAGIFQPHVRHLLVLATPVDIVILGLSYANLQTGSGVLNDSLSGGMQLLPDPLYSLPTDNTYLLTITSTDNGRIFLAGKDGCLYEVAYQAEA-GWFS------------------QRC-RKINHSKSSLSFLVPSLLQFTFSEDDPILQIAIDNSRNILYTRSEKGVIQVYDLGQDGQGMSRVASVSQNAIVSAAGNIARTIDRSVFKPIVQIAVI-ENSESLDCQLLAVTHAGVRLYFSTCPFRQPLARPNTLTLVHVRLPPGFSASSTVEKPSKVHRALYSKGILLMAASENEDNDILWCVNHDTFPFQKPMMETQMTAGVDGHSWALSAIDELKVDKIITPLNKDHIPITDSPVVVQQHMLPPKKFVLLSAQGSLMFHKLRPVDQLRHLLVSNVGGDGEEIERFFKLHQEDQACATCLILACSTAACDREVSAWATRAF 573          

HSP 2 Score: 174.481 bits (441), Expect = 2.537e-43
Identity = 136/505 (26.93%), Postives = 254/505 (50.30%), Query Frame = 1
Query: 2338 KKEHLLINAIQLYEQVGPGIDLGSVIFRLKSVGCTWGAVHLCLHAAKLRDPQDYAIRALKEGLRPHASVEINAIEGRSDAYKYLLECLSNLLEMSKFNV-SNNISSKIG--IIRDIRNLFPNNEIRNHALTDLNVILKTIFDRKDDIMVHFEVYSWMIENDLINQILDFNSEHLESFLQQRLMTDPQNIDAKNLLWKHYEMQGRLLEAARVLDDLAVTECENFGLDERLGCISRAIVFVRAVIG-GNEHFEVDYLKELEDKVDLFHLQKVIIEEIG------NTSEKSIIDLNSRLFKISQLLHDFAEPFDLTVSKLSILKVSGNNCPITIRMIWEELIEKEINRIGNIPSKETREVSLKQTIMQIACQFRDSPMYFPLDLILSHLESYCDMCDFSPDWAVCCFTAIDIPIVKIIQAYFEVLKMKDQDSRKHVYRVYNSMCISFDLFLRTQKN-----NRECQIFSSQFLDIVSACLIEMQSKSDPHS-SSLVEKFRSYKALLEQ 3804
            +KE +L  +++ Y+++   +DL +V  + + V    G V L L AA+ +DPQ   +   K G      V + A + R ++YK + + L  L+  SK    S ++  K G  ++    N+  N E  +H       +LK +  R  D +    +Y+W+I+ DL +++L   S  LE  L +    D   +   +LLW++YE       AARVL  LA        L +RL  I+RAI+  ++     +   + ++L ELE+K+++  +Q  I E +       ++ + ++  L+S L  I++L  +FA+PF L   KL+I+  +G + PI ++ +W+++IEKE++    + S + R  +L   I+ +   +  +P +FPLD I+  LE      ++   + +     I +P+ ++++ Y ++ K +D    +    ++   CI   L +R  +N     N E + F++  LD V   L+E+QS S   +  ++   F+S +A LE+
Sbjct:  828 EKERMLRESLKEYQKISNQVDLSNVCAQYRQVRFYEGVVELSLTAAEKKDPQGLGLHFYKHGEPEEDIVGLQAFQERLNSYKCITDTLQELVNQSKAAPQSPSVPKKPGPPVLSSDPNMLSNEEAGHH----FEQMLK-LSQRSKDELFSIALYNWLIQVDLADKLLQVASPFLEPHLVRMAKVDQNRVRYMDLLWRYYEKNRSFSNAARVLSRLADMHSTEISLQQRLEYIARAILSAKSSTAISSIAADGEFLHELEEKMEVARIQLQIQETLQRQYSHHSSVQDAVSQLDSELMDITKLYGEFADPFKLAECKLAIIHCAGYSDPILVQTLWQDIIEKELSDSVTLSSSD-RMHALSLKIVLLGKIYAGTPRFFPLDFIVQFLEQQVCTLNWDVGFVIQTMNEIGVPLPRLLEVYDQLFKSRDPFWNRMKKPLHLLDCIHV-LLIRYVENPSQVLNCERRRFTNLCLDAVCGYLVELQSMSSSVAVQAITGNFKSLQAKLER 1325          
BLAST of nuclear pore complex protein Nup155 vs. Ensembl Human
Match: NUP155 (nucleoporin 155 [Source:HGNC Symbol;Acc:HGNC:8063])

HSP 1 Score: 265.003 bits (676), Expect = 1.200e-71
Identity = 181/571 (31.70%), Postives = 297/571 (52.01%), Query Frame = 1
Query:   64 EKILNILESQLFKEKNIHNLVDQLHIQQ-NHVSVSGHKDSDYPDVGINISSNIRISKTSE-----MPKELQERTRDMKQNCLIGVFKDIERIWVTVDTDLFIWNYENGSDLAYYDGCCDTILAVELIKPKQKVFNTCIHYLLILAGQVEILVMGVSI------RGYKNNTL----ELLPEPLFKIATENEHITAIQDI-NGRIVLGTKSGNVLEISYWSEKPSWFKFGQSAVYSNIKYSHENDYKLCARLLNHSTWKLSVLLPNIIVNGLMINEPIVQITADPSRNVFYTRSDNSLIAQYQLLPN-DGLQRLNYVTEDSFVSKAYKSVKSVEKHQFKNIVELCPLGEGYGSL--QLMAITQSGVRLYFM-----------DNLQLCHVRMPP-ISQSSMFGKITNVRLCCESRGSVLMICGSSIDNQALYTISPDAFVLPE-LVETVSMSWAQGSSWFL------------MPLDRNDNKWHAHPVIQTQHLDPLRRFLMVSVENIIQLELPSPIDYLREILEKCSSPQSPAIKSWINHYGPEETIYAALVI-----ASDKRSSFVASRAI 1626
            E    +++ QL +++   +L + L +   N+ +VSG  D DYP  G  + S   + + S      +P EL E+   M+ NC++GVF  I R W+T+D+D+F+WNYE+G DLAY+DG  +TILAV L+KPK  +F   + +LL+LA  V+I+++G+S        G  N++L    +LLP+PL+ + T+N ++  I    NGRI L  K G + E++Y +E   WF                   + C R +NHS   LS L+P+++      ++PI+QI  D SRN+ YTRS+  +I  Y L  +  G+ R+  V++++ VS A    +++++  FK IV++  + E   SL  QL+A+T +GVRLYF            + L L HVR+PP  S SS   K + V     S+G +LM    + DN  L+ ++ D F   + ++ET   +   G SW L             PL+++       PV+  QH+ P ++F+++S +  +      P+D LR +L          I+ +   +  ++     L++     A D+  S  A+RA 
Sbjct:   24 ENAGRLIDRQLQEDRMYPDLSELLMVSAPNNPTVSGMSDMDYPLQGPGLLSVPNLPEISSIRRVPLPPELVEQFGHMQCNCMMGVFPPISRAWLTIDSDIFMWNYEDGGDLAYFDGLSETILAVGLVKPKAGIFQPHVRHLLVLATPVDIVILGLSYANLQTGSGVLNDSLSGGMQLLPDPLYSLPTDNTYLLTITSTDNGRIFLAGKDGCLYEVAYQAEA-GWFS------------------QRC-RKINHSKSSLSFLVPSLLQFTFSEDDPILQIAIDNSRNILYTRSEKGVIQVYDLGQDGQGMSRVASVSQNAIVSAAGNIARTIDRSVFKPIVQIAVI-ENSESLDCQLLAVTHAGVRLYFSTCPFRQPLARPNTLTLVHVRLPPGFSASSTVEKPSKVHRALYSKGILLMAASENEDNDILWCVNHDTFPFQKPMMETQMTAGVDGHSWALSAIDELKVDKIITPLNKDHIPITDSPVVVQQHMLPPKKFVLLSAQGSLMFHKLRPVDQLRHLLVSNVGGDGEEIERFFKLHQEDQACATCLILACSTAACDREVSAWATRAF 573          

HSP 2 Score: 212.616 bits (540), Expect = 4.957e-55
Identity = 196/744 (26.34%), Postives = 355/744 (47.72%), Query Frame = 1
Query: 1723 HQVLCMYAARILRPLWDNCIGE---YSKLIQQETHINSTHDSEELTWFLHHLNHLIDFIRDNYP---------------RLKSIDLMRLSNSPVAPVSFALE----------------LSELLKTTVEIVGLWRMITEHQFHQIIKLLSPEMQNELLRCPVKQXXXXXXXXXXXXXXXXXXQHYSDDGASTEMVIEALLRICPNLYRKEDAICSRANEILLNVDSLNISKSQEPEILEQKKEHLLINAIQLYEQVGPGIDLGSVIFRLKSVGCTWGAVHLCLHAAKLRDPQDYAIRALKEGLRPHASVEINAIEGRSDAYKYLLECLSNLLEMSKFNV-SNNISSKIG--IIRDIRNLFPNNEIRNHALTDLNVILKTIFDRKDDIMVHFEVYSWMIENDLINQILDFNSEHLESFLQQRLMTDPQNIDAKNLLWKHYEMQGRLLEAARVLDDLAVTECENFGLDERLGCISRAIVFVRAVIG-GNEHFEVDYLKELEDKVDLFHLQKVIIEEIG------NTSEKSIIDLNSRLFKISQLLHDFAEPFDLTVSKLSILKVSGNNCPITIRMIWEELIEKEINRIGNIPSKETREVSLKQTIMQIACQFRDSPMYFPLDLILSHLESYCDMCDFSPDWAVCCFTAIDIPIVKIIQAYFEVLKMKDQDSRKHVYRVYNSMCISFDLFLRTQKN-----NRECQIFSSQFLDIVSACLIEMQSKSDPHS-SSLVEKFRSYKALLEQ 3804
            H  +C+Y +RI+  +WD  +     +    ++ T I S+   + L   L  L  L +F+  N                 + + I  MR  N     +   L+                + +L++ + + + LW+++ EHQF  I+  L  E+Q E L+    + L++  + L   LI SL+  Y  D A+ + +   L  ICP LY  +DAICS+ANE+L    S  +    E       KE +L  +++ Y+++   +DL +V  + + V    G V L L AA+ +DPQ   +   K G      V + A + R ++YK + + L  L+  SK    S ++  K G  ++    N+  N E  +H       +LK +  R  D +    +Y+W+I+ DL +++L   S  LE  L +    D   +   +LLW++YE       AARVL  LA        L +RL  I+RAI+  ++     +   + ++L ELE+K+++  +Q  I E +       ++ + ++  L+S L  I++L  +FA+PF L   KL+I+  +G + PI ++ +W+++IEKE++    + S + R  +L   I+ +   +  +P +FPLD I+  LE      ++   + +     I +P+ ++++ Y ++ K +D    +    ++   CI   L +R  +N     N E + F++  LD V   L+E+QS S   +  ++   F+S +A LE+
Sbjct:  663 HNGICIYFSRIMGNIWDASLVVERIFKSGNREITAIESSVPCQLLESVLQELKGLQEFLDRNSQFAGGPLGNPNTTAKVQQRLIGFMRPENGNPQQMQQELQRKFHEAQLSEKISLQAIQQLVRKSYQALALWKLLCEHQFTIIVAELQKELQ-EQLKITTFKDLVIRDKELTGALIASLINCYIRDNAAVDGISLHLQDICPLLYSTDDAICSKANELLQR--SRQVQNKTE-------KERMLRESLKEYQKISNQVDLSNVCAQYRQVRFYEGVVELSLTAAEKKDPQGLGLHFYKHGEPEEDIVGLQAFQERLNSYKCITDTLQELVNQSKAAPQSPSVPKKPGPPVLSSDPNMLSNEEAGHH----FEQMLK-LSQRSKDELFSIALYNWLIQVDLADKLLQVASPFLEPHLVRMAKVDQNRVRYMDLLWRYYEKNRSFSNAARVLSRLADMHSTEISLQQRLEYIARAILSAKSSTAISSIAADGEFLHELEEKMEVARIQLQIQETLQRQYSHHSSVQDAVSQLDSELMDITKLYGEFADPFKLAECKLAIIHCAGYSDPILVQTLWQDIIEKELSDSVTLSSSD-RMHALSLKIVLLGKIYAGTPRFFPLDFIVQFLEQQVCTLNWDVGFVIQTMNEIGVPLPRLLEVYDQLFKSRDPFWNRMKKPLHLLDCIHV-LLIRYVENPSQVLNCERRRFTNLCLDAVCGYLVELQSMSSSVAVQAITGNFKSLQAKLER 1389          
BLAST of nuclear pore complex protein Nup155 vs. Ensembl Human
Match: NUP155 (nucleoporin 155 [Source:HGNC Symbol;Acc:HGNC:8063])

HSP 1 Score: 256.914 bits (655), Expect = 4.474e-69
Identity = 172/533 (32.27%), Postives = 277/533 (51.97%), Query Frame = 1
Query:  175 DSDYPDVGINISSNIRISKTSE-----MPKELQERTRDMKQNCLIGVFKDIERIWVTVDTDLFIWNYENGSDLAYYDGCCDTILAVELIKPKQKVFNTCIHYLLILAGQVEILVMGVSI------RGYKNNTL----ELLPEPLFKIATENEHITAIQDI-NGRIVLGTKSGNVLEISYWSEKPSWFKFGQSAVYSNIKYSHENDYKLCARLLNHSTWKLSVLLPNIIVNGLMINEPIVQITADPSRNVFYTRSDNSLIAQYQLLPN-DGLQRLNYVTEDSFVSKAYKSVKSVEKHQFKNIVELCPLGEGYGSL--QLMAITQSGVRLYFM-----------DNLQLCHVRMPP-ISQSSMFGKITNVRLCCESRGSVLMICGSSIDNQALYTISPDAFVLPE-LVETVSMSWAQGSSWFL------------MPLDRNDNKWHAHPVIQTQHLDPLRRFLMVSVENIIQLELPSPIDYLREILEKCSSPQSPAIKSWINHYGPEETIYAALVI-----ASDKRSSFVASRAI 1626
            D DYP  G  + S   + + S      +P EL E+   M+ NC++GVF  I R W+T+D+D+F+WNYE+G DLAY+DG  +TILAV L+KPK  +F   + +LL+LA  V+I+++G+S        G  N++L    +LLP+PL+ + T+N ++  I    NGRI L  K G + E++Y +E   WF                   + C R +NHS   LS L+P+++      ++PI+QI  D SRN+ YTRS+  +I  Y L  +  G+ R+  V++++ VS A    +++++  FK IV++  + E   SL  QL+A+T +GVRLYF            + L L HVR+PP  S SS   K + V     S+G +LM    + DN  L+ ++ D F   + ++ET   +   G SW L             PL+++       PV+  QH+ P ++F+++S +  +      P+D LR +L          I+ +   +  ++     L++     A D+  S  A+RA 
Sbjct:    3 DMDYPLQGPGLLSVPNLPEISSIRRVPLPPELVEQFGHMQCNCMMGVFPPISRAWLTIDSDIFMWNYEDGGDLAYFDGLSETILAVGLVKPKAGIFQPHVRHLLVLATPVDIVILGLSYANLQTGSGVLNDSLSGGMQLLPDPLYSLPTDNTYLLTITSTDNGRIFLAGKDGCLYEVAYQAEA-GWFS------------------QRC-RKINHSKSSLSFLVPSLLQFTFSEDDPILQIAIDNSRNILYTRSEKGVIQVYDLGQDGQGMSRVASVSQNAIVSAAGNIARTIDRSVFKPIVQIAVI-ENSESLDCQLLAVTHAGVRLYFSTCPFRQPLARPNTLTLVHVRLPPGFSASSTVEKPSKVHRALYSKGILLMAASENEDNDILWCVNHDTFPFQKPMMETQMTAGVDGHSWALSAIDELKVDKIITPLNKDHIPITDSPVVVQQHMLPPKKFVLLSAQGSLMFHKLRPVDQLRHLLVSNVGGDGEEIERFFKLHQEDQACATCLILACSTAACDREVSAWATRAF 514          

HSP 2 Score: 212.231 bits (539), Expect = 4.935e-55
Identity = 196/744 (26.34%), Postives = 355/744 (47.72%), Query Frame = 1
Query: 1723 HQVLCMYAARILRPLWDNCIGE---YSKLIQQETHINSTHDSEELTWFLHHLNHLIDFIRDNYP---------------RLKSIDLMRLSNSPVAPVSFALE----------------LSELLKTTVEIVGLWRMITEHQFHQIIKLLSPEMQNELLRCPVKQXXXXXXXXXXXXXXXXXXQHYSDDGASTEMVIEALLRICPNLYRKEDAICSRANEILLNVDSLNISKSQEPEILEQKKEHLLINAIQLYEQVGPGIDLGSVIFRLKSVGCTWGAVHLCLHAAKLRDPQDYAIRALKEGLRPHASVEINAIEGRSDAYKYLLECLSNLLEMSKFNV-SNNISSKIG--IIRDIRNLFPNNEIRNHALTDLNVILKTIFDRKDDIMVHFEVYSWMIENDLINQILDFNSEHLESFLQQRLMTDPQNIDAKNLLWKHYEMQGRLLEAARVLDDLAVTECENFGLDERLGCISRAIVFVRAVIG-GNEHFEVDYLKELEDKVDLFHLQKVIIEEIG------NTSEKSIIDLNSRLFKISQLLHDFAEPFDLTVSKLSILKVSGNNCPITIRMIWEELIEKEINRIGNIPSKETREVSLKQTIMQIACQFRDSPMYFPLDLILSHLESYCDMCDFSPDWAVCCFTAIDIPIVKIIQAYFEVLKMKDQDSRKHVYRVYNSMCISFDLFLRTQKN-----NRECQIFSSQFLDIVSACLIEMQSKSDPHS-SSLVEKFRSYKALLEQ 3804
            H  +C+Y +RI+  +WD  +     +    ++ T I S+   + L   L  L  L +F+  N                 + + I  MR  N     +   L+                + +L++ + + + LW+++ EHQF  I+  L  E+Q E L+    + L++  + L   LI SL+  Y  D A+ + +   L  ICP LY  +DAICS+ANE+L    S  +    E       KE +L  +++ Y+++   +DL +V  + + V    G V L L AA+ +DPQ   +   K G      V + A + R ++YK + + L  L+  SK    S ++  K G  ++    N+  N E  +H       +LK +  R  D +    +Y+W+I+ DL +++L   S  LE  L +    D   +   +LLW++YE       AARVL  LA        L +RL  I+RAI+  ++     +   + ++L ELE+K+++  +Q  I E +       ++ + ++  L+S L  I++L  +FA+PF L   KL+I+  +G + PI ++ +W+++IEKE++    + S + R  +L   I+ +   +  +P +FPLD I+  LE      ++   + +     I +P+ ++++ Y ++ K +D    +    ++   CI   L +R  +N     N E + F++  LD V   L+E+QS S   +  ++   F+S +A LE+
Sbjct:  604 HNGICIYFSRIMGNIWDASLVVERIFKSGNREITAIESSVPCQLLESVLQELKGLQEFLDRNSQFAGGPLGNPNTTAKVQQRLIGFMRPENGNPQQMQQELQRKFHEAQLSEKISLQAIQQLVRKSYQALALWKLLCEHQFTIIVAELQKELQ-EQLKITTFKDLVIRDKELTGALIASLINCYIRDNAAVDGISLHLQDICPLLYSTDDAICSKANELLQR--SRQVQNKTE-------KERMLRESLKEYQKISNQVDLSNVCAQYRQVRFYEGVVELSLTAAEKKDPQGLGLHFYKHGEPEEDIVGLQAFQERLNSYKCITDTLQELVNQSKAAPQSPSVPKKPGPPVLSSDPNMLSNEEAGHH----FEQMLK-LSQRSKDELFSIALYNWLIQVDLADKLLQVASPFLEPHLVRMAKVDQNRVRYMDLLWRYYEKNRSFSNAARVLSRLADMHSTEISLQQRLEYIARAILSAKSSTAISSIAADGEFLHELEEKMEVARIQLQIQETLQRQYSHHSSVQDAVSQLDSELMDITKLYGEFADPFKLAECKLAIIHCAGYSDPILVQTLWQDIIEKELSDSVTLSSSD-RMHALSLKIVLLGKIYAGTPRFFPLDFIVQFLEQQVCTLNWDVGFVIQTMNEIGVPLPRLLEVYDQLFKSRDPFWNRMKKPLHLLDCIHV-LLIRYVENPSQVLNCERRRFTNLCLDAVCGYLVELQSMSSSVAVQAITGNFKSLQAKLER 1330          
BLAST of nuclear pore complex protein Nup155 vs. Ensembl Celegans
Match: npp-8 (Nuclear Pore complex Protein [Source:UniProtKB/TrEMBL;Acc:M1Z882])

HSP 1 Score: 129.798 bits (325), Expect = 5.247e-30
Identity = 140/597 (23.45%), Postives = 268/597 (44.89%), Query Frame = 1
Query: 1723 HQVLCMYAARILRPLWDNCIGEYSKLIQQETHINSTHDSEELTWFLHHLNHLIDFIRDNYPRLKSIDLM--------RLSNSPVAPVSFAL-ELSELLKTTVEIVGLWRMITEHQFHQIIKLLSPEMQNELLRCPVKQXXXXXXXXXXXXXXXXXXQHYSDDGASTEMVIEALLRICPNLYRKEDAICSRANEILLNVDSLNISKSQEPEILEQKKEHLLINAIQLYEQVGPGIDLGSVIFRL-KSVGCTWGAVHLCLHAAKLRDPQDYAIRALKEGLRPHASVEINAIEGRSDAYKYLLECLSNLLEMSKFNVSNNISSKIGIIRDIRNLFPNNEIRNHALTDLNVILKTIFDRKDDIMVHFEVYSWMIENDLINQILDFNSEHLESFLQQRLMTDPQNIDAKNLLWKHYEMQGRLLEAARVLDDLAVTECENFGLDERLGCISRAIVFVRAVIGGNEHFEVDYLKELEDKVDLFHLQKVIIEEIGNTSEKS------IIDLNSRLFKISQLLHDFAEPFDLTVSKLSILKVSGNNCPITIRMIWEELIEKEINRIGNIPSKETREVSLKQTIMQIACQFRDSPMYFPLDLILSHL 3465
            H  L  Y +R++ P+W++ I E    +     +  T + E +      +  L   + D+Y  +  ++          RL++   +    +L  L +L+  T+E + LW +  E+    I   ++P++        +   L+ +   L   LI ++++++  D A T+++ E+L ++CPNLY ++DA  + A E       L  ++ Q P    ++   L+ +A+++++Q    + L S   +L +SV      V LCL  A   DP+  A+ A K G     +  + A + R D Y+ + + L  L +      ++ +     + RD+                +N +L +     DD + H  V+ W++  +  N IL   S  +E FL Q +    +     +LLW+ YE  G   +AAR+L  LA  +    GL +R   +S AI+  ++         +D   EL D++D+ ++Q  I + +G ++  S      +  L+  +  + +LL  +  PF L   KLS+L  +G      I   WE++I+ E     +   + T    L  TI ++   +RD+  YFP + ++  +
Sbjct:  656 HDALFYYFSRLVAPVWNDTICE----VLNGKQLTITFEPESIQSLKEEIQKLARLM-DDYRLVPMMEFNGYSSNMTDRLNHEATSLERHSLIGLRKLIDATLETLSLWLLAYEYNLTAISSGMNPQLLPNFSSRKLAH-LVSDGSNLNAELIRAMIKYFLGDEAGTKILSESLRQLCPNLYSEDDACVTFAME------QLEAARKQGPGAARRR---LVQSAVEMFKQSIGKVVLASTCQQLAESVEDYEPIVELCLLRAAKDDPKQLALLAYKHGRSGSDAEMLGAEKKREDCYRVITDVLDKLED----EATSEVPRDTAVNRDLM---------------INAVLNS-----DDQLAHAAVFRWLLTKNKTNVILQSKSPFIEFFLVQEINAG-RGQKYFDLLWRFYEKSGNYDKAARLLSKLAENDNWKMGLTQRCAYLSHAILCAQSCKDSTVTTNID---ELRDRLDVANVQMRIKDALGCSASASARNQEFVRKLDGPILSLQELLLQYVVPFKLHKIKLSLLHCAGMYVEKHIFETWEDIIQDEFTTAQD---EGTLCEQLSNTIGELFSVYRDTK-YFPREFVIRRI 1205          

HSP 2 Score: 92.8189 bits (229), Expect = 1.123e-18
Identity = 135/602 (22.43%), Postives = 222/602 (36.88%), Query Frame = 1
Query:   37 MDDYSNYSNEKILNILESQLFKEKNIHNLVDQLHIQQNHVSVSGHKDSDYPDVGINISSNIRISKTSEMPKELQERTRDMKQNCLIGVFKDIERIWVTVDTDLFIWNYENGSDLAYYDGCCDTILAVELIKPKQKVFNTCIHYLLILAGQVEILVMGV-SIRGYKNNTLELLPEPLFKIATENEHITAIQDINGRIVLGTKSGNVLEISYWSEKPSWFKFGQSAVYSNIKYSHENDYKLCARLLNHSTWKLSVLLPNIIVNGLMINEPIVQITADPSRNVFY------------TRSDNSLIAQYQLLPNDGLQR----LNYVTEDSFVSKAYKSVKSVEKHQFKNIVELCPLGEGYGSLQLMAITQSGVRLYF-----------MDN-------------------LQLCHVRMPP-ISQSSMFGKITNVRLCCESRGSVLMICGSSIDNQ-ALYTISPDAFVLPE---LVETVSMSWAQGSSWFLMPLDRND-----------NKWHAHPVIQTQHLDPLRRFLMVSVENIIQLELPSPIDYLREILEKCSSPQSPAIKSWINHYGPEETIYAALVIASDKRSSFVASRAIEVVLYYLNE 1653
            M+  S  S E   N +   + +     +  D+L  Q     VSG  +  Y        S  RI     +P ELQ +  ++     +G F  I R+WV +D +L++WNYE   DLA++D     IL V L+  K  VF   I Y L++    +I +  V        +++ +  +  FKIA +   +  I   +   V  T    + E  Y  ++  WF                 ++K   R +N +   L  L+           EP+ QIT D SRN+ Y              +D +  A++  +P   +      L     D     +  S+K++E  Q               +L L+A T  GVRLYF           M N                   L++ HVR  P ++ +S++G   N      +  S   IC  +  N+  ++  S   F  P     VE+ +     G  W +  + R             ++ H H   ++Q     ++ L+ S E + +    + +D LRE L       +  ++ W      E    A  ++ SD           E +LY L E
Sbjct:    6 MELGSADSAEAAANKVAHHVEQMMETSDFFDRL-TQHGTTPVSGLGEKFYVKGAPEFVSTRRIP----IPGELQMQMSNIHSEFSMGFFTQISRVWVVIDNNLYMWNYETNDDLAFFDSSDAAILKVSLVNIKPGVFEPEIQYGLVVGTISDICLYPVFDFVENGASSISIDSKRCFKIALDGATVNDISYTSNGRVFYTADDQLFEFVY-EKQNGWFG--------------STNHK--CRGVNQTASILGTLISLPFFGS--SKEPLDQITIDKSRNIMYLLGRAGTVSVWDLGADGAACAKFLSVPISKIAHEAHILTQFGHDETSFHSITSIKALEASQ-------------SAALNLVATTAKGVRLYFSVSTGPQSTMAMFNNSGTPNERNRPQTSVRPQCLRVAHVRFAPGVTPASIYGDGPNGVSVVYADES---ICAMATANRNTIFAFS--NFFYPSSQFFVESTTECDISGHVWEIETVSRCKVKSRPPPRHLVDRVHPHSYFRSQLESGNQKLLVCSNEGVFEFTHVNAVDALREALFDGGVEGNATLQLWQKLGSTEMLCLAFRILTSDAPIDERIRGKAEQILYSLKE 565          
BLAST of nuclear pore complex protein Nup155 vs. Ensembl Celegans
Match: npp-8 (Nuclear Pore complex Protein [Source:UniProtKB/TrEMBL;Acc:M1Z882])

HSP 1 Score: 86.2705 bits (212), Expect = 2.663e-17
Identity = 97/388 (25.00%), Postives = 151/388 (38.92%), Query Frame = 1
Query:   58 SNEKILNILESQLFKEKNIHNLVDQLHIQQNHVSVSGHKDSDYPDVGINISSNIRISKTSEMPKELQERTRDMKQNCLIGVFKDIERIWVTVDTDLFIWNYENGSDLAYYDGCCDTILAVELIKPKQKVFNTCIHYLLILAGQVEILVMGV-SIRGYKNNTLELLPEPLFKIATENEHITAIQ-DINGRIVLGTKSGNVLEISYWSEKPSWFKFGQSAVYSNIKYSHENDYKLCARLLNHSTWKLSVLLPNIIVNGLMINEPIVQITADPSRNVFY------------TRSDNSLIAQYQLLPNDGLQR----LNYVTEDSFVSKAYKSVKSVEKHQFKNIVELCPLGEGYGSLQLMAITQSGVRLYFMDNLQLCHVRMPPISQSSMF 1167
            S E   N +   + +     +  D+L  Q     VSG  +  Y        S  RI     +P ELQ +  ++     +G F  I R+WV +D +L++WNYE   DLA++D     IL V L+  K  VF   I Y L++    +I +  V        +++ +  +  FKIA +   +  I    NGR+   T    + E  Y  ++  WF                 ++K   R +N +   L  L+           EP+ QIT D SRN+ Y              +D +  A++  +P   +      L     D     +  S+K++E  Q               +L L+A T  GVRLYF        V   P S  +MF
Sbjct:   13 SAEAAANKVAHHVEQMMETSDFFDRL-TQHGTTPVSGLGEKFYVKGAPEFVSTRRI----PIPGELQMQMSNIHSEFSMGFFTQISRVWVVIDNNLYMWNYETNDDLAFFDSSDAAILKVSLVNIKPGVFEPEIQYGLVVGTISDICLYPVFDFVENGASSISIDSKRCFKIALDGATVNDISYTSNGRVFY-TADDQLFEFVY-EKQNGWFG--------------STNHK--CRGVNQTASILGTLISLPFFGSS--KEPLDQITIDKSRNIMYLLGRAGTVSVWDLGADGAACAKFLSVPISKIAHEAHILTQFGHDETSFHSITSIKALEASQ-------------SAALNLVATTAKGVRLYF-------SVSTGPQSTMAMF 355          
BLAST of nuclear pore complex protein Nup155 vs. Ensembl Celegans
Match: npp-8 (Nuclear Pore complex Protein [Source:UniProtKB/TrEMBL;Acc:M1Z882])

HSP 1 Score: 83.5741 bits (205), Expect = 1.391e-16
Identity = 65/241 (26.97%), Postives = 113/241 (46.89%), Query Frame = 1
Query: 2761 DDIMVHFEVYSWMIENDLINQILDFNSEHLESFLQQRLMTDPQNIDAKNLLWKHYEMQGRLLEAARVLDDLAVTECENFGLDERLGCISRAIVFVRAVIGGNEHFEVDYLKELEDKVDLFHLQKVIIEEIGNTSEKS------IIDLNSRLFKISQLLHDFAEPFDLTVSKLSILKVSGNNCPITIRMIWEELIEKEINRIGNIPSKETREVSLKQTIMQIACQFRDSPMYFPLDLILSHL 3465
            DD + H  V+ W++  +  N IL   S  +E FL Q +    +     +LLW+ YE  G   +AAR+L  LA  +    GL +R   +S AI+  ++         +D   EL D++D+ ++Q  I + +G ++  S      +  L+  +  + +LL  +  PF L   KLS+L  +G      I   WE++I+ E         + T    L  TI ++   +RD+  YFP + ++  +
Sbjct:    9 DDQLAHAAVFRWLLTKNKTNVILQSKSPFIEFFLVQEINAG-RGQKYFDLLWRFYEKSGNYDKAARLLSKLAENDNWKMGLTQRCAYLSHAILCAQSCKDSTVTTNID---ELRDRLDVANVQMRIKDALGCSASASARNQEFVRKLDGPILSLQELLLQYVVPFKLHKIKLSLLHCAGMYVEKHIFETWEDIIQDEFT---TAQDEGTLCEQLSNTIGELFSVYRDTK-YFPREFVIRRI 241          
BLAST of nuclear pore complex protein Nup155 vs. Ensembl Fly
Match: Nup154 (gene:FBgn0021761 transcript:FBtr0089881)

HSP 1 Score: 356.681 bits (914), Expect = 1.699e-102
Identity = 332/1315 (25.25%), Postives = 577/1315 (43.88%), Query Frame = 1
Query:   76 NILESQLFKEKNIHNLVDQLHI-QQNHVSVSGHKDSDYPDVGINIS------SNIRISKTSEMPKELQERTRDMKQNCLIGVFKDIERIWVTVDTDLFIWNYENGSDLAYYDGCCDTILAVELIKPKQKVFNTCIHYLLILAGQVEILVMGVSIRGYKNNTLELLPEPLFKIATENEHITAIQDIN-GRIVLGTKSGNVLEISYWSEKPSWFKFGQSAVYSNIKYSHENDYKLCARLLNHSTWKLSVLLPNIIVNGLMINEPIVQITADPSRNVFYTRSDNSLIAQYQLLPN-DGLQRLNYVTEDSFVSKAYKSVKSVEKHQFKNIVELCPL-GEGYGSLQLMAITQSGVRLYFM----------------------------------------DNLQLCHVRMPP-ISQSSMFGKITNVRLCCESRGSVLMICGSSIDNQALYTISPDAFV-LPELVETVSMSWAQGSSWFLMPLDRNDNKWHAHPVIQTQHLDPLRRFLMVSVENIIQLELPSPIDYLREILEKCSSPQSPAIKSWINHYGPEETIYAALVIASDK--RSSFVASRAIEVVLYYLNE-------IIKA--RSMASQSLN--------RASYDIGNPL---------------------------------------------HQVLCMYAARILRPLWD-NCIGEY--SKLIQQETHINSTHDSEELTWFLHHLNHLIDFIR----DNY-PRLKSIDLMRLSNS--PV---------APVSFALELSEL---LKTTVEIVGLWRMITEHQFHQIIKLLSPEMQNELLRCPVKQXXXXXXXXXXXXXXXXXXQHYSDDGASTEMVIEALLRICPNLYRKEDAICSRANEILLNVDSLNISKSQEPEILEQKKEHLLINAIQLYEQVGPGIDLGSVIFRLKSVGCTWGAVHLCLHAAKLRDPQDYAIRALKEGLRPHASVEINAIEGRSDAYKYLLECLSNLLEMSKFNVSNNISSKIGIIRDIRNLFPNNEIRNHALTDLNVILKTIFDRKDDIMVHFEVYSWMIENDLINQILDFNSEHLESFLQQRLMTDPQNIDAKNLLWKHYEMQGRLLEAARVLDDLAVTECENFGLDERLGCISRAIVFVRAVIGGNEHFEVDYLKELEDKVDLFHLQKVIIEEIGN-TSEK-----SIIDLNSRLFKISQLLHDFAEPFDLTVSKLSILKVSGNNCPITIRMIWEELIEKEINRIGNIPSKETREVSLKQTIMQIACQFRDSPMYFPLDLILSHLESYCDMCDFSPDWAVCCFTAIDIPIVKIIQAYFEVLKMKDQ 3588
            ++LE     E+N   L++   + Q    ++SG  D DY  +    S        +R    S +P E+ E  + +K +C +G+F +I R W+T+D++++IW +    D+AYYDG    I++V L+KPK  VF   + YLL+L   +E++V+GV+      N ++L+  P+F I T+N  I+ I+  + GRI LG + G + EI Y +E  SWF                   K C ++ N S   +S ++P+ +     + +PI  I  D SR + Y  ++  +I  + +  +    +RL  +T++   ++A   + +V+   FK++  +CPL  +    L L+A+TQ GVRL+F                                           L L HVR+PP  + ++   K   V     + G++LMI     +   L+++S    V    LVE+ ++    G  W L  +          P+   +H    R+  +++ +    +E+   +D LR+IL  C+ P    +K +       E    AL++A+    R S VA  A +  + Y  E        + A  R+MA+Q+L         R S  +  P+                                             H  L MY +R+L  +W   C+ E   S L Q E  +  +      ++   H  H I        DN+  R  S + + + N+  P+         A V     LS L   +K   E++ LW ++  H F  I   LSPE Q +LL C   + LL+ +  +   LI SL+  Y  D A    V + L   CPNLYR ED +  +A E+L+N    N + + E       KEH+L   + + ++  P + L S+  +  S     G + L    A   DP++  +     G              R   YK +   L ++ +     V N    +   I  ++     ++ +N A   +  I+      KD  ++H  +Y W++ +D++ ++LD     L  FL++ +  +  N+   +LLWK+YE      +AA +LD+LA+T  EN  L++R+  + RA++ +R    G+      +LKELEDK+D+  +QK ++  +    S+K     ++ +LN  L+ I+QL   FAEPFDL   +LSIL  S +N P+ I  +W ++I   +++ G    +  R   L   I  +  ++ +S + FP   ++  LE       F          ++++ I  +++ Y  ++ M ++
Sbjct:   16 SMLEWHYNLERNKPGLLELTGVSQHGRATMSGLNDYDYQSLSFLKSDRTHNLQQMRTVTKSAIPNEILEHFKHIKCHCTMGLFPEIGRAWLTIDSEIYIWTFNQTRDVAYYDGLSHLIVSVGLVKPKPGVFVQDVKYLLVLTTPIEVIVLGVTFGESSYNEMQLMNRPVFVIGTDNVSISVIKGTDDGRIFLGGRDGCLYEIYYQAES-SWFG------------------KRCKKI-NLSQGLVSYMVPSFLKVFSEV-DPIEHIEIDNSRKLLYVLTEKGVIEAWDISTSYTTARRLGRITQNDITNQAVSLITTVDPSIFKSVKAICPLSADDADKLHLVAVTQCGVRLFFSTTSLNVKQQFGPAVPCSPGENTGFGQPAVQPPLSPNAEAPKGLYLLHVRLPPGYTPNATTNKPKQVHAAHYTEGTMLMITTQQHEQDLLWSLSSAPSVNFTYLVESTALESLDGVVWGLAEVHEPSTPQRKSPLNSARHA---RKVALLTNQGTHIIEVLKMVDVLRQILLSCNGPHHEEVKMFFQSQNQREACVTALLLATSDTYRGSDVALWAAQAFMLYGGEPCYQHQKFLNASNRNMANQTLGPNTTNVRERQSMFMSTPMPNSVANSPVGFPGSQFNQPISPIGNMQPPQVAVSNENSPIVFSAKHDGLYMYVSRMLHSVWQMRCVNEQFCSNLSQSECALLLSDLRSLRSFLEVHSVHDISSTTRVSFDNHLDRTNSYNTIMMGNTLLPIPEQRVLSEQAQVEETRSLSALNLFVKHACEVISLWNILNSHSFQLICVQLSPEHQ-KLLTCSTFRDLLITRSEVCAFLIISLINLYLKDAAGVSEVSKNLRENCPNLYRHEDDVTYKATELLMNAK--NCTSATE-------KEHMLRTTLHMCKEAAPTLPLHSICMQFISADFFEGVIELSAVCASKSDPEEVGVHFYNNGEPADDREGYTCFATRMAYYKEVQLMLDHIYQ----RVCNKTHVQDKSINPLKGTAKASDAKNGATQTIPKIVAHTLKVKDP-LIHITLYEWLLAHDMLKELLDVVEPSLGEFLRRSVSQNVDNVVLIDLLWKYYEKNSHHSQAAHILDNLAMTRSENINLEQRIEYLVRAVMCMRNGNVGSSLSNGIFLKELEDKLDIARVQKSVLAAMTELASDKLEAATAVKELNYALYDITQLYQHFAEPFDLWECQLSILNCSHHNDPLLIESVWGQIINSVVDKPGTTSERCNR---LFTKIEILVREYGESGVCFPFAFLIRELEVKACQLRFPEGIVPEKLVSMNLDIELLLEYYSRMISMNER 1288          
BLAST of nuclear pore complex protein Nup155 vs. Ensembl Fly
Match: Nup154 (gene:FBgn0021761 transcript:FBtr0340225)

HSP 1 Score: 356.681 bits (914), Expect = 1.699e-102
Identity = 332/1315 (25.25%), Postives = 577/1315 (43.88%), Query Frame = 1
Query:   76 NILESQLFKEKNIHNLVDQLHI-QQNHVSVSGHKDSDYPDVGINIS------SNIRISKTSEMPKELQERTRDMKQNCLIGVFKDIERIWVTVDTDLFIWNYENGSDLAYYDGCCDTILAVELIKPKQKVFNTCIHYLLILAGQVEILVMGVSIRGYKNNTLELLPEPLFKIATENEHITAIQDIN-GRIVLGTKSGNVLEISYWSEKPSWFKFGQSAVYSNIKYSHENDYKLCARLLNHSTWKLSVLLPNIIVNGLMINEPIVQITADPSRNVFYTRSDNSLIAQYQLLPN-DGLQRLNYVTEDSFVSKAYKSVKSVEKHQFKNIVELCPL-GEGYGSLQLMAITQSGVRLYFM----------------------------------------DNLQLCHVRMPP-ISQSSMFGKITNVRLCCESRGSVLMICGSSIDNQALYTISPDAFV-LPELVETVSMSWAQGSSWFLMPLDRNDNKWHAHPVIQTQHLDPLRRFLMVSVENIIQLELPSPIDYLREILEKCSSPQSPAIKSWINHYGPEETIYAALVIASDK--RSSFVASRAIEVVLYYLNE-------IIKA--RSMASQSLN--------RASYDIGNPL---------------------------------------------HQVLCMYAARILRPLWD-NCIGEY--SKLIQQETHINSTHDSEELTWFLHHLNHLIDFIR----DNY-PRLKSIDLMRLSNS--PV---------APVSFALELSEL---LKTTVEIVGLWRMITEHQFHQIIKLLSPEMQNELLRCPVKQXXXXXXXXXXXXXXXXXXQHYSDDGASTEMVIEALLRICPNLYRKEDAICSRANEILLNVDSLNISKSQEPEILEQKKEHLLINAIQLYEQVGPGIDLGSVIFRLKSVGCTWGAVHLCLHAAKLRDPQDYAIRALKEGLRPHASVEINAIEGRSDAYKYLLECLSNLLEMSKFNVSNNISSKIGIIRDIRNLFPNNEIRNHALTDLNVILKTIFDRKDDIMVHFEVYSWMIENDLINQILDFNSEHLESFLQQRLMTDPQNIDAKNLLWKHYEMQGRLLEAARVLDDLAVTECENFGLDERLGCISRAIVFVRAVIGGNEHFEVDYLKELEDKVDLFHLQKVIIEEIGN-TSEK-----SIIDLNSRLFKISQLLHDFAEPFDLTVSKLSILKVSGNNCPITIRMIWEELIEKEINRIGNIPSKETREVSLKQTIMQIACQFRDSPMYFPLDLILSHLESYCDMCDFSPDWAVCCFTAIDIPIVKIIQAYFEVLKMKDQ 3588
            ++LE     E+N   L++   + Q    ++SG  D DY  +    S        +R    S +P E+ E  + +K +C +G+F +I R W+T+D++++IW +    D+AYYDG    I++V L+KPK  VF   + YLL+L   +E++V+GV+      N ++L+  P+F I T+N  I+ I+  + GRI LG + G + EI Y +E  SWF                   K C ++ N S   +S ++P+ +     + +PI  I  D SR + Y  ++  +I  + +  +    +RL  +T++   ++A   + +V+   FK++  +CPL  +    L L+A+TQ GVRL+F                                           L L HVR+PP  + ++   K   V     + G++LMI     +   L+++S    V    LVE+ ++    G  W L  +          P+   +H    R+  +++ +    +E+   +D LR+IL  C+ P    +K +       E    AL++A+    R S VA  A +  + Y  E        + A  R+MA+Q+L         R S  +  P+                                             H  L MY +R+L  +W   C+ E   S L Q E  +  +      ++   H  H I        DN+  R  S + + + N+  P+         A V     LS L   +K   E++ LW ++  H F  I   LSPE Q +LL C   + LL+ +  +   LI SL+  Y  D A    V + L   CPNLYR ED +  +A E+L+N    N + + E       KEH+L   + + ++  P + L S+  +  S     G + L    A   DP++  +     G              R   YK +   L ++ +     V N    +   I  ++     ++ +N A   +  I+      KD  ++H  +Y W++ +D++ ++LD     L  FL++ +  +  N+   +LLWK+YE      +AA +LD+LA+T  EN  L++R+  + RA++ +R    G+      +LKELEDK+D+  +QK ++  +    S+K     ++ +LN  L+ I+QL   FAEPFDL   +LSIL  S +N P+ I  +W ++I   +++ G    +  R   L   I  +  ++ +S + FP   ++  LE       F          ++++ I  +++ Y  ++ M ++
Sbjct:   16 SMLEWHYNLERNKPGLLELTGVSQHGRATMSGLNDYDYQSLSFLKSDRTHNLQQMRTVTKSAIPNEILEHFKHIKCHCTMGLFPEIGRAWLTIDSEIYIWTFNQTRDVAYYDGLSHLIVSVGLVKPKPGVFVQDVKYLLVLTTPIEVIVLGVTFGESSYNEMQLMNRPVFVIGTDNVSISVIKGTDDGRIFLGGRDGCLYEIYYQAES-SWFG------------------KRCKKI-NLSQGLVSYMVPSFLKVFSEV-DPIEHIEIDNSRKLLYVLTEKGVIEAWDISTSYTTARRLGRITQNDITNQAVSLITTVDPSIFKSVKAICPLSADDADKLHLVAVTQCGVRLFFSTTSLNVKQQFGPAVPCSPGENTGFGQPAVQPPLSPNAEAPKGLYLLHVRLPPGYTPNATTNKPKQVHAAHYTEGTMLMITTQQHEQDLLWSLSSAPSVNFTYLVESTALESLDGVVWGLAEVHEPSTPQRKSPLNSARHA---RKVALLTNQGTHIIEVLKMVDVLRQILLSCNGPHHEEVKMFFQSQNQREACVTALLLATSDTYRGSDVALWAAQAFMLYGGEPCYQHQKFLNASNRNMANQTLGPNTTNVRERQSMFMSTPMPNSVANSPVGFPGSQFNQPISPIGNMQPPQVAVSNENSPIVFSAKHDGLYMYVSRMLHSVWQMRCVNEQFCSNLSQSECALLLSDLRSLRSFLEVHSVHDISSTTRVSFDNHLDRTNSYNTIMMGNTLLPIPEQRVLSEQAQVEETRSLSALNLFVKHACEVISLWNILNSHSFQLICVQLSPEHQ-KLLTCSTFRDLLITRSEVCAFLIISLINLYLKDAAGVSEVSKNLRENCPNLYRHEDDVTYKATELLMNAK--NCTSATE-------KEHMLRTTLHMCKEAAPTLPLHSICMQFISADFFEGVIELSAVCASKSDPEEVGVHFYNNGEPADDREGYTCFATRMAYYKEVQLMLDHIYQ----RVCNKTHVQDKSINPLKGTAKASDAKNGATQTIPKIVAHTLKVKDP-LIHITLYEWLLAHDMLKELLDVVEPSLGEFLRRSVSQNVDNVVLIDLLWKYYEKNSHHSQAAHILDNLAMTRSENINLEQRIEYLVRAVMCMRNGNVGSSLSNGIFLKELEDKLDIARVQKSVLAAMTELASDKLEAATAVKELNYALYDITQLYQHFAEPFDLWECQLSILNCSHHNDPLLIESVWGQIINSVVDKPGTTSERCNR---LFTKIEILVREYGESGVCFPFAFLIRELEVKACQLRFPEGIVPEKLVSMNLDIELLLEYYSRMISMNER 1288          
BLAST of nuclear pore complex protein Nup155 vs. Ensembl Fly
Match: Nup154 (gene:FBgn0021761 transcript:FBtr0340224)

HSP 1 Score: 356.681 bits (914), Expect = 1.699e-102
Identity = 332/1315 (25.25%), Postives = 577/1315 (43.88%), Query Frame = 1
Query:   76 NILESQLFKEKNIHNLVDQLHI-QQNHVSVSGHKDSDYPDVGINIS------SNIRISKTSEMPKELQERTRDMKQNCLIGVFKDIERIWVTVDTDLFIWNYENGSDLAYYDGCCDTILAVELIKPKQKVFNTCIHYLLILAGQVEILVMGVSIRGYKNNTLELLPEPLFKIATENEHITAIQDIN-GRIVLGTKSGNVLEISYWSEKPSWFKFGQSAVYSNIKYSHENDYKLCARLLNHSTWKLSVLLPNIIVNGLMINEPIVQITADPSRNVFYTRSDNSLIAQYQLLPN-DGLQRLNYVTEDSFVSKAYKSVKSVEKHQFKNIVELCPL-GEGYGSLQLMAITQSGVRLYFM----------------------------------------DNLQLCHVRMPP-ISQSSMFGKITNVRLCCESRGSVLMICGSSIDNQALYTISPDAFV-LPELVETVSMSWAQGSSWFLMPLDRNDNKWHAHPVIQTQHLDPLRRFLMVSVENIIQLELPSPIDYLREILEKCSSPQSPAIKSWINHYGPEETIYAALVIASDK--RSSFVASRAIEVVLYYLNE-------IIKA--RSMASQSLN--------RASYDIGNPL---------------------------------------------HQVLCMYAARILRPLWD-NCIGEY--SKLIQQETHINSTHDSEELTWFLHHLNHLIDFIR----DNY-PRLKSIDLMRLSNS--PV---------APVSFALELSEL---LKTTVEIVGLWRMITEHQFHQIIKLLSPEMQNELLRCPVKQXXXXXXXXXXXXXXXXXXQHYSDDGASTEMVIEALLRICPNLYRKEDAICSRANEILLNVDSLNISKSQEPEILEQKKEHLLINAIQLYEQVGPGIDLGSVIFRLKSVGCTWGAVHLCLHAAKLRDPQDYAIRALKEGLRPHASVEINAIEGRSDAYKYLLECLSNLLEMSKFNVSNNISSKIGIIRDIRNLFPNNEIRNHALTDLNVILKTIFDRKDDIMVHFEVYSWMIENDLINQILDFNSEHLESFLQQRLMTDPQNIDAKNLLWKHYEMQGRLLEAARVLDDLAVTECENFGLDERLGCISRAIVFVRAVIGGNEHFEVDYLKELEDKVDLFHLQKVIIEEIGN-TSEK-----SIIDLNSRLFKISQLLHDFAEPFDLTVSKLSILKVSGNNCPITIRMIWEELIEKEINRIGNIPSKETREVSLKQTIMQIACQFRDSPMYFPLDLILSHLESYCDMCDFSPDWAVCCFTAIDIPIVKIIQAYFEVLKMKDQ 3588
            ++LE     E+N   L++   + Q    ++SG  D DY  +    S        +R    S +P E+ E  + +K +C +G+F +I R W+T+D++++IW +    D+AYYDG    I++V L+KPK  VF   + YLL+L   +E++V+GV+      N ++L+  P+F I T+N  I+ I+  + GRI LG + G + EI Y +E  SWF                   K C ++ N S   +S ++P+ +     + +PI  I  D SR + Y  ++  +I  + +  +    +RL  +T++   ++A   + +V+   FK++  +CPL  +    L L+A+TQ GVRL+F                                           L L HVR+PP  + ++   K   V     + G++LMI     +   L+++S    V    LVE+ ++    G  W L  +          P+   +H    R+  +++ +    +E+   +D LR+IL  C+ P    +K +       E    AL++A+    R S VA  A +  + Y  E        + A  R+MA+Q+L         R S  +  P+                                             H  L MY +R+L  +W   C+ E   S L Q E  +  +      ++   H  H I        DN+  R  S + + + N+  P+         A V     LS L   +K   E++ LW ++  H F  I   LSPE Q +LL C   + LL+ +  +   LI SL+  Y  D A    V + L   CPNLYR ED +  +A E+L+N    N + + E       KEH+L   + + ++  P + L S+  +  S     G + L    A   DP++  +     G              R   YK +   L ++ +     V N    +   I  ++     ++ +N A   +  I+      KD  ++H  +Y W++ +D++ ++LD     L  FL++ +  +  N+   +LLWK+YE      +AA +LD+LA+T  EN  L++R+  + RA++ +R    G+      +LKELEDK+D+  +QK ++  +    S+K     ++ +LN  L+ I+QL   FAEPFDL   +LSIL  S +N P+ I  +W ++I   +++ G    +  R   L   I  +  ++ +S + FP   ++  LE       F          ++++ I  +++ Y  ++ M ++
Sbjct:   16 SMLEWHYNLERNKPGLLELTGVSQHGRATMSGLNDYDYQSLSFLKSDRTHNLQQMRTVTKSAIPNEILEHFKHIKCHCTMGLFPEIGRAWLTIDSEIYIWTFNQTRDVAYYDGLSHLIVSVGLVKPKPGVFVQDVKYLLVLTTPIEVIVLGVTFGESSYNEMQLMNRPVFVIGTDNVSISVIKGTDDGRIFLGGRDGCLYEIYYQAES-SWFG------------------KRCKKI-NLSQGLVSYMVPSFLKVFSEV-DPIEHIEIDNSRKLLYVLTEKGVIEAWDISTSYTTARRLGRITQNDITNQAVSLITTVDPSIFKSVKAICPLSADDADKLHLVAVTQCGVRLFFSTTSLNVKQQFGPAVPCSPGENTGFGQPAVQPPLSPNAEAPKGLYLLHVRLPPGYTPNATTNKPKQVHAAHYTEGTMLMITTQQHEQDLLWSLSSAPSVNFTYLVESTALESLDGVVWGLAEVHEPSTPQRKSPLNSARHA---RKVALLTNQGTHIIEVLKMVDVLRQILLSCNGPHHEEVKMFFQSQNQREACVTALLLATSDTYRGSDVALWAAQAFMLYGGEPCYQHQKFLNASNRNMANQTLGPNTTNVRERQSMFMSTPMPNSVANSPVGFPGSQFNQPISPIGNMQPPQVAVSNENSPIVFSAKHDGLYMYVSRMLHSVWQMRCVNEQFCSNLSQSECALLLSDLRSLRSFLEVHSVHDISSTTRVSFDNHLDRTNSYNTIMMGNTLLPIPEQRVLSEQAQVEETRSLSALNLFVKHACEVISLWNILNSHSFQLICVQLSPEHQ-KLLTCSTFRDLLITRSEVCAFLIISLINLYLKDAAGVSEVSKNLRENCPNLYRHEDDVTYKATELLMNAK--NCTSATE-------KEHMLRTTLHMCKEAAPTLPLHSICMQFISADFFEGVIELSAVCASKSDPEEVGVHFYNNGEPADDREGYTCFATRMAYYKEVQLMLDHIYQ----RVCNKTHVQDKSINPLKGTAKASDAKNGATQTIPKIVAHTLKVKDP-LIHITLYEWLLAHDMLKELLDVVEPSLGEFLRRSVSQNVDNVVLIDLLWKYYEKNSHHSQAAHILDNLAMTRSENINLEQRIEYLVRAVMCMRNGNVGSSLSNGIFLKELEDKLDIARVQKSVLAAMTELASDKLEAATAVKELNYALYDITQLYQHFAEPFDLWECQLSILNCSHHNDPLLIESVWGQIINSVVDKPGTTSERCNR---LFTKIEILVREYGESGVCFPFAFLIRELEVKACQLRFPEGIVPEKLVSMNLDIELLLEYYSRMISMNER 1288          
BLAST of nuclear pore complex protein Nup155 vs. Ensembl Zebrafish
Match: nup155 (nucleoporin 155 [Source:ZFIN;Acc:ZDB-GENE-040426-711])

HSP 1 Score: 442.195 bits (1136), Expect = 1.377e-132
Identity = 383/1410 (27.16%), Postives = 662/1410 (46.95%), Query Frame = 1
Query:   79 ILESQLFKEKNIHNLVDQLHI-QQNHVSVSGHKDSDYPDVG---INISSNIRIS--KTSEMPKELQERTRDMKQNCLIGVFKDIERIWVTVDTDLFIWNYENGSDLAYYDGCCDTILAVELIKPKQKVFNTCIHYLLILAGQVEILVMGVSI----RGYKNNT---LELLPEPLFKIATENEHITAIQDIN-GRIVLGTKSGNVLEISYWSEKPSWFKFGQSAVYSNIKYSHENDYKLCARLLNHSTWKLSVLLPNIIVNGLMINEPIVQITADPSRNVFYTRSDNSLIAQYQLLPN-DGLQRLNYVTEDSFVSKAYKSVKSVEKHQFKNIVELCPLGEGYGS-LQLMAITQSGVRLYFM----------------DNLQLCHVRMPP-ISQSSMFGKITNVRLCCESRGSVLMICGSSIDNQALYTISPDAFVLPELVETVSM-------SWA------QGSSWFLMPLDRNDNKWHAHPVIQTQHLDPLRRFLMVSVENIIQLELPSPIDYLREILEKCSSPQSPAIKSWINHYGPEETIYAALVIA-----SDKRSSFVASRAI-----EVVLYYLNEIIKARSMA---SQSLNRASYDIGNPL-------------------------------------------------HQVLCMYAARILRPLWDNCIG---EYSKLIQQETHINSTHDSEELTWFLHHLNHLIDFIRDNYP-----------------RLKSIDLMRLSNSPVAPVSFALE-----------------LSELLKTTVEIVGLWRMITEHQFHQIIKLLSPEMQNELLRCPVKQXXXXXXXXXXXXXXXXXXQHYSDDGASTEMVIEALLRICPNLYRKEDAICSRANEILLNVDSLNISKSQEPEILEQKKEHLLINAIQLYEQVGPGIDLGSVIFRLKSVGCTWGAVHLCLHAAKLRDPQDYAIRALKEGLRPHASVEINAIEGRSDAYKYLLECLSNLLEMSKFNV-SNNISSKIG--IIRDIRNLFPNNEIRNHALTDLNVILKTIFDRKDDIMVHFEVYSWMIENDLINQILDFNSEHLESFLQQRLMTDPQNIDAKNLLWKHYEMQGRLLEAARVLDDLAVTECENFGLDERLGCISRAIV-----FVRAVIGGNEHFEVDYLKELEDKVDLFHLQKVIIEEIGN------TSEKSIIDLNSRLFKISQLLHDFAEPFDLTVSKLSILKVSGNNCPITIRMIWEELIEKEIN-RIGNIPSKETREVSLKQTIMQIACQFRDSPMYFPLDLILSHLESYCDMCDFSPDWAVCCFTA--IDIPIVKIIQAYFEVLKMKDQDSRKHVYRVYNSMCISFDLFLRTQKNNR----ECQIFSSQFLDIVSACLIEMQSKSDPHSS--SLVEKFRSYKALLEQ 3804
            +++  L +++   +L + L++   N  S+SG  D DYP  G   I++ S   +S  +   +P EL E+   M+ NC++GVF +I R W+T+D D+F+WNYE+GSD+AY+DG  +TIL+V L+KPK  +F   IH+LL+L+  V+++++G+S      G  ++T   ++LLP+PL+ I T+N ++ AI   + GRI +  K G + E++Y +E   WF                   + C R +NHS   LS L+P+++      ++P+VQI  D SRN+ YTRS+  ++  Y L  +  G+ R+  +++ S VS A    +++++  FK IV++  +     S  QL+A+T +GVRLYF                   L L HVR+PP  S SS   K   V     SRG +LM    + D+  L+ I+ D+F   + +    M       SWA      + S   L PL+++       P++  QH  P ++F+++S +         P+D LR +L   +  +S  I+ +   +  E+    AL++A      D+  S  A+RA      E  + + + +    ++    S  +  +   IG+PL                                                 H  + +Y  RIL  +WD  +      +K  Q    + ST  S +L   L  L  L +F+  N                   + + +  MR   S    +   L+                 + +L+  + + + LW+++ +HQF  I+  +  E Q+++     K  +++  R L   LI +L+  Y  D AS + +   L  ICP LY  +D+ICS+ANE+L +  S  I    E       KE  L  +++LY+Q+    DL  V  + + V    G + LCL AA  +D Q   +   + G     +    A + R   YK + + +  L+  SK    S ++  + G  ++    N+  N +   H    L +       R  D + H  +Y+W+I+ DL +++L+ NS +LE  L   +  D   +   +LLW++YE      +AA VL  LA        L +RL  ISRAI+        + +G +  F    L ELE+K+++  +Q  I E +        + + +I  L+S L  I++L  +FA+ F L+  KL+I+  +G++ PI +  +W+E+IEKE+N  +   PS   R VSLK  ++ +   +  +P YFPLD ++  LE   ++C  S D     FT   I + + ++++ Y ++ K +D   ++    ++   CI   L       +R    + + F++  LD +   L+E+QS S P+++   ++  F+S +A LE+
Sbjct:   24 LIDRHLQEDRCFPDLSELLNVPSHNMPSLSGVSDMDYPLQGPALISVPSLPELSSIRRVPLPPELVEQFGHMQCNCMMGVFPEISRAWLTIDNDIFMWNYEDGSDVAYFDGLSETILSVGLVKPKPGIFQPHIHFLLVLSTPVDVVILGLSFPKVQTGLNDSTCGAMQLLPDPLYTIPTDNTYLLAITSTDTGRIFMAGKDGCLYEVAYQAEA-GWFS------------------QRC-RKINHSKSSLSFLIPSLLQFSFSEDDPVVQIAVDNSRNILYTRSEKGVLQVYDLGADGQGMSRVAAISQSSIVSAAGNIARTIDRSVFKPIVQIAVIDRSESSDCQLLAVTHAGVRLYFSTIPFAPPNAKHVSARPSILALVHVRLPPGFSASSTLQKPAKVHKALYSRGVLLMAVSQTEDSDLLWCINHDSFPFKKPLMEAQMTVNVDGHSWALCSIEDKKSPRILTPLNKDLIPVTDSPLVVQQHNVPPQKFVLLSAQGSHIFHKLRPVDQLRHLLVSSAGGESEEIERFFKLHREEQACATALILACSNATCDREVSVWATRAFFRYGGEAQMRFPSALSAPSNVGPLFSSPVPGSPMPIGSPLPNPSFLATPAPGMFPPNVSTPYVPATPMSPGGAPITAVSSGPEVVFSGKHNGISIYFTRILGNIWDGSLAMETPINKGTQTVMILESTASSSDLELVLMQLQDLKEFLDKNSQFSPTSLGVANFSSPANLQQRLLGFMRPDGSSSQQMQQELQRKYHTEAQAYEKASLQAMQQLIHRSCQTLALWKLLCDHQFSLILSEMPKEFQDQMKAVSFKD-VVVCGRELSGALITALINVYIKDSASVDTLSAHLRDICPLLYSSDDSICSKANELLQS--SRQIQNKLE-------KERTLKESLRLYQQISHNTDLPLVCSQYRQVRFYEGVMELCLTAADKKDHQRLGLHFYRNGEPEEDTSGQQAFQERLLCYKCITDTMQELVNQSKAAPQSPSVPKQPGPPVMTSDPNMLSNEDAAAHFEQMLGLA-----QRSQDELFHIALYNWLIQADLTDKLLEVNSPYLEDHLMHMIKQDQSKVRNMDLLWRYYEKNRSFGKAAHVLARLADMHSTEISLKQRLEYISRAILSAKSSSSVSSLGADGEF----LHELEEKMEVVRIQVQIQETLRRQFSQHPSVQGAITQLDSELMDITKLYGEFADHFRLSECKLAIIHCAGHSDPILVHSLWQEIIEKELNDSVVMSPSDRMRAVSLK--LVSLGKLYAGTPRYFPLDFLVKFLEQ--EVCRLSWDVGFVTFTMQEIGVQLPRLLEVYDQLFKTRDPCWQRLKKPLHLVECIHVLLSGYVDDPSRVPTYDRRRFTNACLDNICGYLVELQSLS-PNAALQDIIRNFKSLQAKLEK 1389          
BLAST of nuclear pore complex protein Nup155 vs. Ensembl Zebrafish
Match: nup155 (nucleoporin 155 [Source:ZFIN;Acc:ZDB-GENE-040426-711])

HSP 1 Score: 290.426 bits (742), Expect = 6.446e-81
Identity = 287/1144 (25.09%), Postives = 503/1144 (43.97%), Query Frame = 1
Query:  835 PIVQITADPSRNVFYTRSDNSLIAQYQLLPN-DGLQRLNYVTEDSFVSKAYKSVKSVEKHQFKNIVELCPLGEGYGS-LQLMAITQSGVRLYFM----------------DNLQLCHVRMPP-ISQSSMFGKITNVRLCCESRGSVLMICGSSIDNQALYTISPDAFVLPELVETVSM-------SWA------QGSSWFLMPLDRNDNKWHAHPVIQTQHLDPLRRFLMVSVENIIQLELPSPIDYLREILEKCSSPQSPAIKSWINHYGPEETIYAALVIAS-----DKRSSFVASRAI-----EVVLYYLNEIIKARSMA---SQSLNRASYDIGNPL-------------------------------------------------HQVLCMYAARILRPLWDNCIG---EYSKLIQQETHINSTHDSEELTWFLHHLNHLIDFIRDNYP-----------------RLKSIDLMRLSNSPVAPVSFALE-----------------LSELLKTTVEIVGLWRMITEHQFHQIIKLLSPEMQNELLRCPVKQXXXXXXXXXXXXXXXXXXQHYSDDGASTEMVIEALLRICPNLYRKEDAICSRANEILLNVDSLNISKSQEPEILEQKKEHLLINAIQLYEQVGPGIDLGSVIFRLKSVGCTWGAVHLCLHAAKLRDPQDYAIRALKEGLRPHASVEINAIEGRSDAYKYLLECLSNLLEMSKFNV-SNNISSKIG--IIRDIRNLFPNNEIRNHALTDLNVILKTIFDRKDDIMVHFEVYSWMIENDLINQILDFNSEHLESFLQQRLMTDPQNIDAKNLLWKHYEMQGRLLEAARVLDDLAVTECENFGLDERLGCISRAIV-----FVRAVIGGNEHFEVDYLKELEDKVDLFHLQKVIIEEIGN------TSEKSIIDLNSRLFKISQLLHDFAEPFDLTVSKLSILKVSGNNCPITIRMIWEELIEKEIN-RIGNIPSKETREVSLKQTIMQIACQFRDSPMYFPLDLILSHLESYCDMCDFSPDWAVCCFT--AIDIPIVKIIQAYFEVLKMKDQDSRKHVYRVYNSMCISFDLFLRTQKNNR----ECQIFSSQFLDIVSACLIEMQSKSDPHSS--SLVEKFRSYKALLEQ 3804
            P+VQI  D SRN+ YTRS+  ++  Y L  +  G+ R+  +++ S VS A    +++++  FK IV++  +     S  QL+A+T +GVRLYF                   L L HVR+PP  S SS   K   V     SRG +LM    + D+  L+ I+ D+F   + +    M       SWA      + S   L PL+++       P++  QH  P ++F+++S +         P+D LR +L   +  +S  I+ +   +  E+    AL++A      D+  S  A+RA      E  + + + +    ++    S  +  +   IG+PL                                                 H  + +Y  RIL  +WD  +      +K  Q    + ST  S +L   L  L  L +F+  N                   + + +  MR   S    +   L+                 + +L+  + + + LW+++ +HQF  I+  +  E Q+++     K +++  +      +   +   Y  D AS + +   L  ICP LY  +D+ICS+ANE+L +  S  I    E       KE  L  +++LY+Q+    DL  V  + + V    G + LCL AA  +D Q   +   + G     +    A + R   YK + + +  L+  SK    S ++  + G  ++    N+  N +   H    L +       R  D + H  +Y+W+I+ DL +++L+ NS +LE  L   +  D   +   +LLW++YE      +AA VL  LA        L +RL  ISRAI+        + +G +  F    L ELE+K+++  +Q  I E +        + + +I  L+S L  I++L  +FA+ F L+  KL+I+  +G++ PI +  +W+E+IEKE+N  +   PS   R VSLK  ++ +   +  +P YFPLD ++  LE   ++C  S D     FT   I + + ++++ Y ++ K +D   ++    ++   CI   L       +R    + + F++  LD +   L+E+QS S P+++   ++  F+S +A LE+
Sbjct:    2 PVVQIAVDNSRNILYTRSEKGVLQVYDLGADGQGMSRVAAISQSSIVSAAGNIARTIDRSVFKPIVQIAVIDRSESSDCQLLAVTHAGVRLYFSTIPFAPPNAKHVSARPSILALVHVRLPPGFSASSTLQKPAKVHKALYSRGVLLMAVSQTEDSDLLWCINHDSFPFKKPLMEAQMTVNVDGHSWALCSIEDKKSPRILTPLNKDLIPVTDSPLVVQQHNVPPQKFVLLSAQGSHIFHKLRPVDQLRHLLVSSAGGESEEIERFFKLHREEQACATALILACSNATCDREVSVWATRAFFRYGGEAQMRFPSALSAPSNVGPLFSSPVPGSPMPIGSPLPNPSFLATPAPGMFPPNVSTPYVPATPMSPGGAPITAVSSGPEVVFSGKHNGISIYFTRILGNIWDGSLAMETPINKGTQTVMILESTASSSDLELVLMQLQDLKEFLDKNSQFSPTSLGVANFSSPANLQQRLLGFMRPDGSSSQQMQQELQRKYHTEAQAYEKASLQAMQQLIHRSCQTLALWKLLCDHQFSLILSEMPKEFQDQMKAVSFKDVVVCGRELSGALITALINV-YIKDSASVDTLSAHLRDICPLLYSSDDSICSKANELLQS--SRQIQNKLE-------KERTLKESLRLYQQISHNTDLPLVCSQYRQVRFYEGVMELCLTAADKKDHQRLGLHFYRNGEPEEDTSGQQAFQERLLCYKCITDTMQELVNQSKAAPQSPSVPKQPGPPVMTSDPNMLSNEDAAAHFEQMLGLA-----QRSQDELFHIALYNWLIQADLTDKLLEVNSPYLEDHLMHMIKQDQSKVRNMDLLWRYYEKNRSFGKAAHVLARLADMHSTEISLKQRLEYISRAILSAKSSSSVSSLGADGEF----LHELEEKMEVVRIQVQIQETLRRQFSQHPSVQGAITQLDSELMDITKLYGEFADHFRLSECKLAIIHCAGHSDPILVHSLWQEIIEKELNDSVVMSPSDRMRAVSLK--LVSLGKLYAGTPRYFPLDFLVKFLEQ--EVCRLSWDVGFVTFTMQEIGVQLPRLLEVYDQLFKTRDPCWQRLKKPLHLVECIHVLLSGYVDDPSRVPTYDRRRFTNACLDNICGYLVELQSLS-PNAALQDIIRNFKSLQAKLEK 1121          
BLAST of nuclear pore complex protein Nup155 vs. Ensembl Xenopus
Match: NUP155 (nucleoporin 155kDa [Source:NCBI gene;Acc:100379911])

HSP 1 Score: 451.825 bits (1161), Expect = 5.625e-136
Identity = 384/1377 (27.89%), Postives = 651/1377 (47.28%), Query Frame = 1
Query:  157 SVSGHKDSDYP--DVGI-NISSNIRIS--KTSEMPKELQERTRDMKQNCLIGVFKDIERIWVTVDTDLFIWNYENGSDLAYYDGCCDTILAVELIKPKQKVFNTCIHYLLILAGQVEILVMGVSIRGYKNNTL--------ELLPEPLFKIATENEHITAIQDI-NGRIVLGTKSGNVLEISYWSEKPSWFKFGQSAVYSNIKYSHENDYKLCARLLNHSTWKLSVLLPNIIVNGLMINEPIVQITADPSRNVFYTRSDNSLIAQYQL-LPNDGLQRLNYVTEDSFVSKAYKSVKSVEKHQFKNIVELCPLGEGYG-SLQLMAITQSGVRLYFM-----------DNLQLCHVRMPP-ISQSSMFGKITNVRLCCESRGSVLMICGSSIDNQALYTISPDAFVLPE-LVETVSMSWAQGSSWFL------------MPLDRNDNKWHAHPVIQTQHLDPLRRFLMVSVENIIQLELPSPIDYLREILEKCSSPQSPAIKSW------INHYGPEETIYAALVIASDKRSSFVASRA-----------IEVVLYYLNEI---------------------------IKARSMASQSLNRASYDIGNPLHQV-------------------LCMYAARILRPLWDNCIG---EYSKLIQQETHINSTHDSEELTWFLHHLNHLIDFIRDNYPRLKSIDLMRLS-NSPV-----------------------------APVSFALELS-----ELLKTTVEIVGLWRMITEHQFHQIIKLLSPEMQNELLRCPVKQXXXXXXXXXXXXXXXXXXQHYSDDGASTEMVIEALLRICPNLYRKEDAICSRANEILLNVDSLNISKSQEPEILEQKKEHLLINAIQLYEQVGPGIDLGSVIFRLKSVGCTWGAVHLCLHAAKLRDPQDYAIRALKEGLRPHASVEINAIEGRSDAYKYLLECLSNLLEMSKFNV-SNNISSKIG--IIRDIRNLFPNNEIRNHALTDLNVILKTIFDRKDDIMVHFEVYSWMIENDLINQILDFNSEHLESFLQQRLMTDPQNIDAKNLLWKHYEMQGRLLEAARVLDDLAVTECENFGLDERLGCISRAIVFVR-AVIGGNEHFEVDYLKELEDKVDLFHLQKVIIEEIG------NTSEKSIIDLNSRLFKISQLLHDFAEPFDLTVSKLSILKVSGNNCPITIRMIWEELIEKEI-NRIGNIPSKETREVSLKQTIMQIACQFRDSPMYFPLDLILSHLESYCDMCDFSPDWAVCCFT--AIDIPIVKIIQAYFEVLKMKDQ--DSRKHVYRVYNSMCISFDLFLR--TQKNNRECQIFSSQFLDIVSACLIEMQSKSDPHSSSL--VEKFRSYKALLEQ 3804
            ++SG  + DYP    G+  I S   IS  +   +P EL E+   M+ NC++GVF +I R W+T+D+D+F+WNYE+G DLAYYDG  +TIL+V L+KPK  +F   I +LL+LA  V+I+++G+S    +   L        +LLP+PL+ + T+N ++ +I    NGRI L  K G + E+ Y +E   WF                   + C R +NHS   LS L+P+++      ++PIVQI  D SRN+ YTRS+  +I  Y L +   G+ R+  V+++S VS A    ++++++ FK I+ +  +      +  L+A+T +GVRLYF              L L HVR+PP  S SS   K + V     + G +LM    + DN  L+ I+ D+F     ++ET   +   G SW L             PL+++       PVI  QH+ P +RF+++S +         P+D LR +L   S      I+ +      IN       I A    ASD+  S  A+RA           ++  L+    +                              +     +++  +Y +  P  Q                    +C+Y  RI+  +WD  +     +    ++ T I+S+   + L   L  L  L++F+ D Y +  +  L   S  +P                                   A +LS     +L++   + + LW+++ EHQF  I+  L  E+Q E L+    + L++  + L   L  SL+  Y  D AS + V   L  +CP LY  +DA+CS+ANE+L     +       P  LE  KE +L  +++ Y+++   +DL +V  + + V    G V LCL AA+ +DPQ   +   K G        + A + R ++YK + + L  L+  SK    S ++  K G  ++    N+  N E   H       +LK +  R  D + +  +++W+I+ DL +++L+ NS  LE  L +    D   +   +LLW++YE       AARV+  LA        L +RL  ISRAI+  + +        + ++L ELE+K+++  +Q  I E +       +    ++  L+S+L  I++L   +A+PF L+  KL+I+  +G++ PI ++ +W+E+I+KE+ + +GN  S   R  SL   +  +   +  +P YFPL+ ++ +LE    +C+FS D     +T   I++P+ K+++ Y  + K +D      K    +  S+ +    +++  ++  + E + F++  LD +S  L+E+QS  DP  + L  V  F+S +A LE+
Sbjct:   52 TISGVSEMDYPLQSPGLLTIPSLPEISAIRRVPLPPELVEQFGHMQCNCMMGVFPEISRAWLTIDSDIFMWNYEDGGDLAYYDGLSETILSVGLVKPKAGIFQPHIRFLLVLATPVDIVILGLSFANLQPGNLNDSISGGMQLLPDPLYSLPTDNTYLLSITSTDNGRIFLSGKDGCLYEVEYQAEA-GWFS------------------QRC-RKINHSKSSLSFLVPSVLQFAFSEDDPIVQIAIDNSRNILYTRSEKGVIQVYDLGVDGHGMSRVASVSQNSLVSAAGNIARTIDRNVFKPIIHISVIEMSESVNCHLLAVTHAGVRLYFSTVPFKQPTARPSMLALVHVRLPPGFSASSNVEKPSKVHRALYNSGVLLMAASENEDNDILWCINRDSFPFQRPMMETQVTTQVDGHSWALSAVDEQKADKIVTPLNKDLIPLTDSPVIIQQHMIPPKRFVLLSAQGSHIFYKLRPVDQLRHLLVSNSGGDGEEIERFFKLHQVINQACATCLILACSTAASDREVSAWAARAFFRYGGEAQLRVQSALHQPGNVGPIFGSPLPVASPMPVGSPMPNPSFLGTPTQGACPPNVSTPAYGVATPAPQPAAVPGMMGTEIAFSGKHNGICIYFCRIIGNIWDGSVAVENTFKSGNREVTAIDSSVTPQLLESVLQELKGLLEFL-DRYSQFTAGSLGNPSFGTPANRQQRLVGLGRPDSGSSQQAQQELQRKYHTEAQLAEQLSLQGIHQLVRKMCQALALWKLLCEHQFSLIVSDLQKELQ-EQLKITTFKDLVIRDKELAGALTASLINCYIQDNASVDGVSYRLQEVCPLLYSTDDAVCSKANELLQRSRHV-------PNKLE--KERMLRESLKEYQKISQQVDLPNVCAQYRQVRFYEGVVELCLTAAEKKDPQGLGLHFHKNGEPEEDVAGLQAFQERLNSYKCITDTLQELVNQSKAAPQSPSVPKKPGPPVLSSDPNMLSNEEAGIH----FEQMLK-LAQRSTDELFNIALFNWLIQADLTDKLLELNSPFLEPHLVRMAKLDQNKVRYMDLLWRYYEKNRNFSNAARVVAKLADMPSTEISLKQRLEYISRAILSAKSSTTMSTLAADGEFLHELEEKLEVARIQLQIQETLSRQYSHHSAVGDAVSQLDSQLMDITKLFGQYADPFRLSECKLAIIHCAGHSDPILVQTLWQEIIDKELSDSLGN--SSVDRMQSLHLKMTSLGKIYASTPRYFPLEFLVKYLEQ--QVCNFSWDAGFVTYTMQEINVPVPKLLEVYDHLFKARDPWWSRMKKPLHLLESIYLLLSGYVQEPSKVPSYERRRFTTLCLDAISCYLVELQSM-DPAPALLNTVSNFKSLQAKLER 1387          
BLAST of nuclear pore complex protein Nup155 vs. Ensembl Xenopus
Match: NUP155 (nucleoporin 155kDa [Source:NCBI gene;Acc:100379911])

HSP 1 Score: 441.039 bits (1133), Expect = 1.379e-132
Identity = 379/1319 (28.73%), Postives = 638/1319 (48.37%), Query Frame = 1
Query:  157 SVSGHKDSDYP--DVGI-NISSNIRIS--KTSEMPKELQERTRDMKQNCLIGVFKDIERIWVTVDTDLFIWNYENGSDLAYYDGCCDTILAVELIKPKQKVFNTCIHYLLILAGQVEILVMGVSIRGYKNNTL--------ELLPEPLFKIATENEHITAIQDI-NGRIVLGTKSGNVLEISYWSEKPSWFKFGQSAVYSNIKYSHENDYKLCARLLNHSTWKLSVLLPNIIVNGLMINEPIVQITADPSRNVFYTRSDNSLIAQYQL-LPNDGLQRLNYVTEDSFVSKAYKSVKSVEKHQFKNIVELCPLGEGYG-SLQLMAITQSGVRLYFM-----------DNLQLCHVRMPP-ISQSSMFGKITNVRLCCESRGSVLMICGSSIDNQALYTISPDAFVLPE-LVETVSMSWAQGSSWFL------------MPLDRNDNKWHAHPVIQTQHLDPLRRFLMVSVENIIQLELPSPIDYLREILEKCSSPQSPAIKSWINHYGPEETIYAALVI-----ASDKRSSFVASRAIEVVLYYLNEIIKARSMASQSLNRASYDIGNPL--------------------------HQVLCMYAARILRP----LWDNCIGEYSKLIQ-QETHINSTHDSEELTWFLHHLNHLIDFIRDNYPRLKSIDLMR--LSNSPVAPVSFALELS-----ELLKTTVEIVGLWRMITEHQFHQIIKLLSPEMQNELLRCPVKQXXXXXXXXXXXXXXXXXXQHYSDDGASTEMVIEALLRICPNLYRKEDAICSRANEILLNVDSLNISKSQEPEILEQKKEHLLINAIQLYEQVGPGIDLGSVIFRLKSVGCTWGAVHLCLHAAKLRDPQDYAIRALKEGLRPHASVEINAIEGRSDAYKYLLECLSNLLEMSKFNV-SNNISSKIG--IIRDIRNLFPNNEIRNHALTDLNVILKTIFDRKDDIMVHFEVYSWMIENDLINQILDFNSEHLESFLQQRLMTDPQNIDAKNLLWKHYEMQGRLLEAARVLDDLAVTECENFGLDERLGCISRAIVFVR-AVIGGNEHFEVDYLKELEDKVDLFHLQKVIIEEIG------NTSEKSIIDLNSRLFKISQLLHDFAEPFDLTVSKLSILKVSGNNCPITIRMIWEELIEKEI-NRIGNIPSKETREVSLKQTIMQIACQFRDSPMYFPLDLILSHLESYCDMCDFSPDWAVCCFT--AIDIPIVKIIQAYFEVLKMKDQ--DSRKHVYRVYNSMCISFDLFLR--TQKNNRECQIFSSQFLDIVSACLIEMQSKSDPHSSSL--VEKFRSYKALLEQ 3804
            ++SG  + DYP    G+  I S   IS  +   +P EL E+   M+ NC++GVF +I R W+T+D+D+F+WNYE+G DLAYYDG  +TIL+V L+KPK  +F   I +LL+LA  V+I+++G+S    +   L        +LLP+PL+ + T+N ++ +I    NGRI L  K G + E+ Y +E   WF                   + C R +NHS   LS L+P+++      ++PIVQI  D SRN+ YTRS+  +I  Y L +   G+ R+  V+++S VS A    ++++++ FK I+ +  +      +  L+A+T +GVRLYF              L L HVR+PP  S SS   K + V     + G +LM    + DN  L+ I+ D+F     ++ET   +   G SW L             PL+++       PVI  QH+ P +RF+++S +         P+D LR +L   S      I+ +   +   +     L++     ASD+  S  A+RA     Y     ++ +S   Q  N      G+PL                          H  +C+Y  RI+      L ++ + E   L++  + +   T  S     F    N     +    P   S    +  L          A +LS     +L++   + + LW+++ EHQF  I+  L  E+Q E L+    + L++  + L   L  SL+  Y  D AS + V   L  +CP LY  +DA+CS+ANE+L     +       P  LE  KE +L  +++ Y+++   +DL +V  + + V    G V LCL AA+ +DPQ   +   K G       ++ A+      YK + + L  L+  SK    S ++  K G  ++    N+  N E   H       +LK +  R  D + +  +++W+I+ DL +++L+ NS  LE  L +    D   +   +LLW++YE       AARV+  LA        L +RL  ISRAI+  + +        + ++L ELE+K+++  +Q  I E +       +    ++  L+S+L  I++L   +A+PF L+  KL+I+  +G++ PI ++ +W+E+I+KE+ + +GN  S   R  SL   +  +   +  +P YFPL+ ++ +LE    +C+FS D     +T   I++P+ K+++ Y  + K +D      K    +  S+ +    +++  ++  + E + F++  LD +S  L+E+QS  DP  + L  V  F+S +A LE+
Sbjct:   52 TISGVSEMDYPLQSPGLLTIPSLPEISAIRRVPLPPELVEQFGHMQCNCMMGVFPEISRAWLTIDSDIFMWNYEDGGDLAYYDGLSETILSVGLVKPKAGIFQPHIRFLLVLATPVDIVILGLSFANLQPGNLNDSISGGMQLLPDPLYSLPTDNTYLLSITSTDNGRIFLSGKDGCLYEVEYQAEA-GWFS------------------QRC-RKINHSKSSLSFLVPSVLQFAFSEDDPIVQIAIDNSRNILYTRSEKGVIQVYDLGVDGHGMSRVASVSQNSLVSAAGNIARTIDRNVFKPIIHISVIEMSESVNCHLLAVTHAGVRLYFSTVPFKQPTARPSMLALVHVRLPPGFSASSNVEKPSKVHRALYNSGVLLMAASENEDNDILWCINRDSFPFQRPMMETQVTTQVDGHSWALSAVDEQKADKIVTPLNKDLIPLTDSPVIIQQHMIPPKRFVLLSAQGSHIFYKLRPVDQLRHLLVSNSGGDGEEIERFFKLHQENQACATCLILACSTAASDREVSAWAARAF--FRYGGEAQLRVQSALHQPGNVGPI-FGSPLPVVATPAPQPAAVPGMMGTEIAFSGKHNGICIYFCRIIGSVTPQLLESVLQELKGLLEFLDRYSQFTAGSLGNPSFGTPANRQQRLVGLGRPDSGSSQQAQQELQRKYHTEAQLAEQLSLQGIHQLVRKMCQALALWKLLCEHQFSLIVSDLQKELQ-EQLKITTFKDLVIRDKELAGALTASLINCYIQDNASVDGVSYRLQEVCPLLYSTDDAVCSKANELLQRSRHV-------PNKLE--KERMLRESLKEYQKISQQVDLPNVCAQYRQVRFYEGVVELCLTAAEKKDPQGLGLHFHKNG---EPEEDVGAVLC---VYKCITDTLQELVNQSKAAPQSPSVPKKPGPPVLSSDPNMLSNEEAGIH----FEQMLK-LAQRSTDELFNIALFNWLIQADLTDKLLELNSPFLEPHLVRMAKLDQNKVRYMDLLWRYYEKNRNFSNAARVVAKLADMPSTEISLKQRLEYISRAILSAKSSTTMSTLAADGEFLHELEEKLEVARIQLQIQETLSRQYSHHSAVGDAVSQLDSQLMDITKLFGQYADPFRLSECKLAIIHCAGHSDPILVQTLWQEIIDKELSDSLGN--SSVDRMQSLHLKMTSLGKIYASTPRYFPLEFLVKYLEQ--QVCNFSWDAGFVTYTMQEINVPVPKLLEVYDHLFKARDPWWSRMKKPLHLLESIYLLLSGYVQEPSKVPSYERRRFTTLCLDAISCYLVELQSM-DPAPALLNTVSNFKSLQAKLER 1321          
BLAST of nuclear pore complex protein Nup155 vs. Ensembl Xenopus
Match: NUP155 (nucleoporin 155kDa [Source:NCBI gene;Acc:100379911])

HSP 1 Score: 256.144 bits (653), Expect = 6.945e-69
Identity = 214/787 (27.19%), Postives = 353/787 (44.85%), Query Frame = 1
Query:  157 SVSGHKDSDYP--DVGI-NISSNIRIS--KTSEMPKELQERTRDMKQNCLIGVFKDIERIWVTVDTDLFIWNYENGSDLAYYDGCCDTILAVELIKPKQKVFNTCIHYLLILAGQVEILVMGVSIRGYKNNTL--------ELLPEPLFKIATENEHITAIQDI-NGRIVLGTKSGNVLEISYWSEKPSWFKFGQSAVYSNIKYSHENDYKLCARLLNHSTWKLSVLLPNIIVNGLMINEPIVQITADPSRNVFYTRSDNSLIAQYQL-LPNDGLQRLNYVTEDSFVSKAYKSVKSVEKHQFKNIVELCPLGEGYG-SLQLMAITQSGVRLYFM-----------DNLQLCHVRMPP-ISQSSMFGKITNVRLCCESRGSVLMICGSSIDNQALYTISPDAFVLPE-LVETVSMSWAQGSSWFL------------MPLDRNDNKWHAHPVIQTQHLDPLRRFLMVSVENIIQLELPSPIDYLREILEKCSSPQSPAIKSWINHYGPEETIYAALVI-----ASDKRSSFVASRA-----------IEVVLYYLNEI---------------------------IKARSMASQSLNRASYDIGNPLHQV-------------------LCMYAARILRPLWDNCIG---EYSKLIQQETHINSTHDSEELTWFLHHLNHLIDFIRDNYPRLKSIDLMRLS-NSPV-----------------------------APVSFALELS-----ELLKTTVEIVGLWRMITEHQFHQIIKLLSPEMQNELLR 2094
            ++SG  + DYP    G+  I S   IS  +   +P EL E+   M+ NC++GVF +I R W+T+D+D+F+WNYE+G DLAYYDG  +TIL+V L+KPK  +F   I +LL+LA  V+I+++G+S    +   L        +LLP+PL+ + T+N ++ +I    NGRI L  K G + E+ Y +E   WF                   + C R +NHS   LS L+P+++      ++PIVQI  D SRN+ YTRS+  +I  Y L +   G+ R+  V+++S VS A    ++++++ FK I+ +  +      +  L+A+T +GVRLYF              L L HVR+PP  S SS   K + V     + G +LM    + DN  L+ I+ D+F     ++ET   +   G SW L             PL+++       PVI  QH+ P +RF+++S +         P+D LR +L   S      I+ +   +   +     L++     ASD+  S  A+RA           ++  L+    +                              +     +++  +Y +  P  Q                    +C+Y  RI+  +WD  +     +    ++ T I+S+   + L   L  L  L++F+ D Y +  +  L   S  +P                                   A +LS     +L++   + + LW+++ EHQF  I+  L  +  NELL+
Sbjct:   54 TISGVSEMDYPLQSPGLLTIPSLPEISAIRRVPLPPELVEQFGHMQCNCMMGVFPEISRAWLTIDSDIFMWNYEDGGDLAYYDGLSETILSVGLVKPKAGIFQPHIRFLLVLATPVDIVILGLSFANLQPGNLNDSISGGMQLLPDPLYSLPTDNTYLLSITSTDNGRIFLSGKDGCLYEVEYQAEA-GWFS------------------QRC-RKINHSKSSLSFLVPSVLQFAFSEDDPIVQIAIDNSRNILYTRSEKGVIQVYDLGVDGHGMSRVASVSQNSLVSAAGNIARTIDRNVFKPIIHISVIEMSESVNCHLLAVTHAGVRLYFSTVPFKQPTARPSMLALVHVRLPPGFSASSNVEKPSKVHRALYNSGVLLMAASENEDNDILWCINRDSFPFQRPMMETQVTTQVDGHSWALSAVDEQKADKIVTPLNKDLIPLTDSPVIIQQHMIPPKRFVLLSAQGSHIFYKLRPVDQLRHLLVSNSGGDGEEIERFFKLHQENQACATCLILACSTAASDREVSAWAARAFFRYGGEAQLRVQSALHQPGNVGPIFGSPLPVASPMPVGSPMPNPSFLGTPTQGACPPNVSTPAYGVATPAPQPAAVPGMMGTEIAFSGKHNGICIYFCRIIGNIWDGSVAVENTFKSGNREVTAIDSSVTPQLLESVLQELKGLLEFL-DRYSQFTAGSLGNPSFGTPANRQQRLVGLGRPDSGSSQQAQQELQRKYHTEAQLAEQLSLQGIHQLVRKMCQALALWKLLCEHQFSLIVSDL--QKANELLQ 817          

HSP 2 Score: 185.267 bits (469), Expect = 1.194e-46
Identity = 141/508 (27.76%), Postives = 262/508 (51.57%), Query Frame = 1
Query: 2338 KKEHLLINAIQLYEQVGPGIDLGSVIFRLKSVGCTWGAVHLCLHAAKLRDPQDYAIRALKEGLRPHASVEINAIEGRSDAYKYLLECLSNLLEMSKFNV-SNNISSKIG--IIRDIRNLFPNNEIRNHALTDLNVILKTIFDRKDDIMVHFEVYSWMIENDLINQILDFNSEHLESFLQQRLMTDPQNIDAKNLLWKHYEMQGRLLEAARVLDDLAVTECENFGLDERLGCISRAIVFVR-AVIGGNEHFEVDYLKELEDKVDLFHLQKVIIEEIG------NTSEKSIIDLNSRLFKISQLLHDFAEPFDLTVSKLSILKVSGNNCPITIRMIWEELIEKEI-NRIGNIPSKETREVSLKQTIMQIACQFRDSPMYFPLDLILSHLESYCDMCDFSPDWAVCCFT--AIDIPIVKIIQAYFEVLKMKDQ--DSRKHVYRVYNSMCISFDLFLR--TQKNNRECQIFSSQFLDIVSACLIEMQSKSDPHSSSL--VEKFRSYKALLEQ 3804
            +KE +L  +++ Y+++   +DL +V  + + V    G V LCL AA+ +DPQ   +   K G        + A + R ++YK + + L  L+  SK    S ++  K G  ++    N+  N E   H       +LK +  R  D + +  +++W+I+ DL +++L+ NS  LE  L +    D   +   +LLW++YE       AARV+  LA        L +RL  ISRAI+  + +        + ++L ELE+K+++  +Q  I E +       +    ++  L+S+L  I++L   +A+PF L+  KL+I+  +G++ PI ++ +W+E+I+KE+ + +GN  S   R  SL   +  +   +  +P YFPL+ ++ +LE    +C+FS D     +T   I++P+ K+++ Y  + K +D      K    +  S+ +    +++  ++  + E + F++  LD +S  L+E+QS  DP  + L  V  F+S +A LE+
Sbjct:  827 EKERMLRESLKEYQKISQQVDLPNVCAQYRQVRFYEGVVELCLTAAEKKDPQGLGLHFHKNGEPEEDVAGLQAFQERLNSYKCITDTLQELVNQSKAAPQSPSVPKKPGPPVLSSDPNMLSNEEAGIH----FEQMLK-LAQRSTDELFNIALFNWLIQADLTDKLLELNSPFLEPHLVRMAKLDQNKVRYMDLLWRYYEKNRNFSNAARVVAKLADMPSTEISLKQRLEYISRAILSAKSSTTMSTLAADGEFLHELEEKLEVARIQLQIQETLSRQYSHHSAVGDAVSQLDSQLMDITKLFGQYADPFRLSECKLAIIHCAGHSDPILVQTLWQEIIDKELSDSLGN--SSVDRMQSLHLKMTSLGKIYASTPRYFPLEFLVKYLEQ--QVCNFSWDAGFVTYTMQEINVPVPKLLEVYDHLFKARDPWWSRMKKPLHLLESIYLLLSGYVQEPSKVPSYERRRFTTLCLDAISCYLVELQSM-DPAPALLNTVSNFKSLQAKLER 1324          
BLAST of nuclear pore complex protein Nup155 vs. Ensembl Xenopus
Match: NUP155 (nucleoporin 155kDa [Source:NCBI gene;Acc:100379911])

HSP 1 Score: 253.832 bits (647), Expect = 3.225e-68
Identity = 175/536 (32.65%), Postives = 275/536 (51.31%), Query Frame = 1
Query:  157 SVSGHKDSDYP--DVGI-NISSNIRIS--KTSEMPKELQERTRDMKQNCLIGVFKDIERIWVTVDTDLFIWNYENGSDLAYYDGCCDTILAVELIKPKQKVFNTCIHYLLILAGQVEILVMGVSIRGYKNNTL--------ELLPEPLFKIATENEHITAIQDI-NGRIVLGTKSGNVLEISYWSEKPSWFKFGQSAVYSNIKYSHENDYKLCARLLNHSTWKLSVLLPNIIVNGLMINEPIVQITADPSRNVFYTRSDNSLIAQYQL-LPNDGLQRLNYVTEDSFVSKAYKSVKSVEKHQFKNIVELCPLGEGYG-SLQLMAITQSGVRLYFM-----------DNLQLCHVRMPP-ISQSSMFGKITNVRLCCESRGSVLMICGSSIDNQALYTISPDAFVLPE-LVETVSMSWAQGSSWFL------------MPLDRNDNKWHAHPVIQTQHLDPLRRFLMVSVENIIQLELPSPIDYLREILEKCSSPQSPAIKSWINHYGPEETIYAALVI-----ASDKRSSFVASRAI 1626
            ++SG  + DYP    G+  I S   IS  +   +P EL E+   M+ NC++GVF +I R W+T+D+D+F+WNYE+G DLAYYDG  +TIL+V L+KPK  +F   I +LL+LA  V+I+++G+S    +   L        +LLP+PL+ + T+N ++ +I    NGRI L  K G + E+ Y +E   WF                   + C R +NHS   LS L+P+++      ++PIVQI  D SRN+ YTRS+  +I  Y L +   G+ R+  V+++S VS A    ++++++ FK I+ +  +      +  L+A+T +GVRLYF              L L HVR+PP  S SS   K + V     + G +LM    + DN  L+ I+ D+F     ++ET   +   G SW L             PL+++       PVI  QH+ P +RF+++S +         P+D LR +L   S      I+ +   +   +     L++     ASD+  S  A+RA 
Sbjct:   52 TISGVSEMDYPLQSPGLLTIPSLPEISAIRRVPLPPELVEQFGHMQCNCMMGVFPEISRAWLTIDSDIFMWNYEDGGDLAYYDGLSETILSVGLVKPKAGIFQPHIRFLLVLATPVDIVILGLSFANLQPGNLNDSISGGMQLLPDPLYSLPTDNTYLLSITSTDNGRIFLSGKDGCLYEVEYQAEA-GWFS------------------QRC-RKINHSKSSLSFLVPSVLQFAFSEDDPIVQIAIDNSRNILYTRSEKGVIQVYDLGVDGHGMSRVASVSQNSLVSAAGNIARTIDRNVFKPIIHISVIEMSESVNCHLLAVTHAGVRLYFSTVPFKQPTARPSMLALVHVRLPPGFSASSNVEKPSKVHRALYNSGVLLMAASENEDNDILWCINRDSFPFQRPMMETQVTTQVDGHSWALSAVDEQKADKIVTPLNKDLIPLTDSPVIIQQHMIPPKRFVLLSAQGSHIFYKLRPVDQLRHLLVSNSGGDGEEIERFFKLHQENQACATCLILACSTAASDREVSAWAARAF 567          

HSP 2 Score: 215.698 bits (548), Expect = 3.468e-56
Identity = 179/627 (28.55%), Postives = 320/627 (51.04%), Query Frame = 1
Query: 1981 ELLKTTVEIVGLWRMITEHQFHQIIKLLSPEMQNELLRCPVKQXXXXXXXXXXXXXXXXXXQHYSDDGASTEMVIEALLRICPNLYRKEDAICSRANEILLNVDSLNISKSQEPEILEQKKEHLLINAIQLYEQVGPGIDLGSVIFRLKSVGCTWGAVHLCLHAAKLRDPQDYAIRALKEGLRPHASVEINAIEGRSDAYKYLLECLSNLLEMSKFNV-SNNISSKIG--IIRDIRNLFPNNEIRNHALTDLNVILKTIFDRKDDIMVHFEVYSWMIENDLINQILDFNSEHLESFLQQRLMTDPQNIDAKNLLWKHYEMQGRLLEAARVLDDLAVTECENFGLDERLGCISRAIVFVR-AVIGGNEHFEVDYLKELEDKVDLFHLQKVIIEEIG------NTSEKSIIDLNSRLFKISQLLHDFAEPFDLTVSKLSILKVSGNNCPITIRMIWEELIEKEI-NRIGNIPSKETREVSLKQTIMQIACQFRDSPMYFPLDLILSHLESYCDMCDFSPDWAVCCFT--AIDIPIVKIIQAYFEVLKMKDQ--DSRKHVYRVYNSMCISFDLFLR--TQKNNRECQIFSSQFLDIVSACLIEMQSKSDPHSSSL--VEKFRSYKALLEQ 3804
            +L++   + + LW+++ EHQF  I+  L  E+Q E L+    + L++  + L   L  SL+  Y  D AS + V   L  +CP LY  +DA+CS+ANE+L     +       P  LE  KE +L  +++ Y+++   +DL +V  + + V    G V LCL AA+ +DPQ   +   K G  P     +  +      YK + + L  L+  SK    S ++  K G  ++    N+  N E   H       +LK +  R  D + +  +++W+I+ DL +++L+ NS  LE  L +    D   +   +LLW++YE       AARV+  LA        L +RL  ISRAI+  + +        + ++L ELE+K+++  +Q  I E +       +    ++  L+S+L  I++L   +A+PF L+  KL+I+  +G++ PI ++ +W+E+I+KE+ + +GN  S   R  SL   +  +   +  +P YFPL+ ++ +LE    +C+FS D     +T   I++P+ K+++ Y  + K +D      K    +  S+ +    +++  ++  + E + F++  LD +S  L+E+QS  DP  + L  V  F+S +A LE+
Sbjct:  724 QLVRKMCQALALWKLLCEHQFSLIVSDLQKELQ-EQLKITTFKDLVIRDKELAGALTASLINCYIQDNASVDGVSYRLQEVCPLLYSTDDAVCSKANELLQRSRHV-------PNKLE--KERMLRESLKEYQKISQQVDLPNVCAQYRQVRFYEGVVELCLTAAEKKDPQGLGLHFHKNG-EPEEDGAVLCV------YKCITDTLQELVNQSKAAPQSPSVPKKPGPPVLSSDPNMLSNEEAGIH----FEQMLK-LAQRSTDELFNIALFNWLIQADLTDKLLELNSPFLEPHLVRMAKLDQNKVRYMDLLWRYYEKNRNFSNAARVVAKLADMPSTEISLKQRLEYISRAILSAKSSTTMSTLAADGEFLHELEEKLEVARIQLQIQETLSRQYSHHSAVGDAVSQLDSQLMDITKLFGQYADPFRLSECKLAIIHCAGHSDPILVQTLWQEIIDKELSDSLGN--SSVDRMQSLHLKMTSLGKIYASTPRYFPLEFLVKYLEQ--QVCNFSWDAGFVTYTMQEINVPVPKLLEVYDHLFKARDPWWSRMKKPLHLLESIYLLLSGYVQEPSKVPSYERRRFTTLCLDAISCYLVELQSM-DPAPALLNTVSNFKSLQAKLER 1323          
BLAST of nuclear pore complex protein Nup155 vs. Ensembl Xenopus
Match: NUP155 (nucleoporin 155kDa [Source:NCBI gene;Acc:100379911])

HSP 1 Score: 253.832 bits (647), Expect = 3.846e-68
Identity = 175/536 (32.65%), Postives = 275/536 (51.31%), Query Frame = 1
Query:  157 SVSGHKDSDYP--DVGI-NISSNIRIS--KTSEMPKELQERTRDMKQNCLIGVFKDIERIWVTVDTDLFIWNYENGSDLAYYDGCCDTILAVELIKPKQKVFNTCIHYLLILAGQVEILVMGVSIRGYKNNTL--------ELLPEPLFKIATENEHITAIQDI-NGRIVLGTKSGNVLEISYWSEKPSWFKFGQSAVYSNIKYSHENDYKLCARLLNHSTWKLSVLLPNIIVNGLMINEPIVQITADPSRNVFYTRSDNSLIAQYQL-LPNDGLQRLNYVTEDSFVSKAYKSVKSVEKHQFKNIVELCPLGEGYG-SLQLMAITQSGVRLYFM-----------DNLQLCHVRMPP-ISQSSMFGKITNVRLCCESRGSVLMICGSSIDNQALYTISPDAFVLPE-LVETVSMSWAQGSSWFL------------MPLDRNDNKWHAHPVIQTQHLDPLRRFLMVSVENIIQLELPSPIDYLREILEKCSSPQSPAIKSWINHYGPEETIYAALVI-----ASDKRSSFVASRAI 1626
            ++SG  + DYP    G+  I S   IS  +   +P EL E+   M+ NC++GVF +I R W+T+D+D+F+WNYE+G DLAYYDG  +TIL+V L+KPK  +F   I +LL+LA  V+I+++G+S    +   L        +LLP+PL+ + T+N ++ +I    NGRI L  K G + E+ Y +E   WF                   + C R +NHS   LS L+P+++      ++PIVQI  D SRN+ YTRS+  +I  Y L +   G+ R+  V+++S VS A    ++++++ FK I+ +  +      +  L+A+T +GVRLYF              L L HVR+PP  S SS   K + V     + G +LM    + DN  L+ I+ D+F     ++ET   +   G SW L             PL+++       PVI  QH+ P +RF+++S +         P+D LR +L   S      I+ +   +   +     L++     ASD+  S  A+RA 
Sbjct:   52 TISGVSEMDYPLQSPGLLTIPSLPEISAIRRVPLPPELVEQFGHMQCNCMMGVFPEISRAWLTIDSDIFMWNYEDGGDLAYYDGLSETILSVGLVKPKAGIFQPHIRFLLVLATPVDIVILGLSFANLQPGNLNDSISGGMQLLPDPLYSLPTDNTYLLSITSTDNGRIFLSGKDGCLYEVEYQAEA-GWFS------------------QRC-RKINHSKSSLSFLVPSVLQFAFSEDDPIVQIAIDNSRNILYTRSEKGVIQVYDLGVDGHGMSRVASVSQNSLVSAAGNIARTIDRNVFKPIIHISVIEMSESVNCHLLAVTHAGVRLYFSTVPFKQPTARPSMLALVHVRLPPGFSASSNVEKPSKVHRALYNSGVLLMAASENEDNDILWCINRDSFPFQRPMMETQVTTQVDGHSWALSAVDEQKADKIVTPLNKDLIPLTDSPVIIQQHMIPPKRFVLLSAQGSHIFYKLRPVDQLRHLLVSNSGGDGEEIERFFKLHQENQACATCLILACSTAASDREVSAWAARAF 567          

HSP 2 Score: 224.942 bits (572), Expect = 5.182e-59
Identity = 180/627 (28.71%), Postives = 323/627 (51.52%), Query Frame = 1
Query: 1981 ELLKTTVEIVGLWRMITEHQFHQIIKLLSPEMQNELLRCPVKQXXXXXXXXXXXXXXXXXXQHYSDDGASTEMVIEALLRICPNLYRKEDAICSRANEILLNVDSLNISKSQEPEILEQKKEHLLINAIQLYEQVGPGIDLGSVIFRLKSVGCTWGAVHLCLHAAKLRDPQDYAIRALKEGLRPHASVEINAIEGRSDAYKYLLECLSNLLEMSKFNV-SNNISSKIG--IIRDIRNLFPNNEIRNHALTDLNVILKTIFDRKDDIMVHFEVYSWMIENDLINQILDFNSEHLESFLQQRLMTDPQNIDAKNLLWKHYEMQGRLLEAARVLDDLAVTECENFGLDERLGCISRAIVFVR-AVIGGNEHFEVDYLKELEDKVDLFHLQKVIIEEIG------NTSEKSIIDLNSRLFKISQLLHDFAEPFDLTVSKLSILKVSGNNCPITIRMIWEELIEKEI-NRIGNIPSKETREVSLKQTIMQIACQFRDSPMYFPLDLILSHLESYCDMCDFSPDWAVCCFT--AIDIPIVKIIQAYFEVLKMKDQ--DSRKHVYRVYNSMCISFDLFLR--TQKNNRECQIFSSQFLDIVSACLIEMQSKSDPHSSSL--VEKFRSYKALLEQ 3804
            +L++   + + LW+++ EHQF  I+  L  E+Q E L+    + L++  + L   L  SL+  Y  D AS + V   L  +CP LY  +DA+CS+ANE+L     +       P  LE  KE +L  +++ Y+++   +DL +V  + + V    G V LCL AA+ +DPQ   +   K G        + A + R ++YK + + L  L+  SK    S ++  K G  ++    N+  N E   H       +LK +  R  D + +  +++W+I+ DL +++L+ NS  LE  L +    D   +   +LLW++YE       AARV+  LA        L +RL  ISRAI+  + +        + ++L ELE+K+++  +Q  I E +       +    ++  L+S+L  I++L   +A+PF L+  KL+I+  +G++ PI ++ +W+E+I+KE+ + +GN  S   R  SL   +  +   +  +P YFPL+ ++ +LE    +C+FS D     +T   I++P+ K+++ Y  + K +D      K    +  S+ +    +++  ++  + E + F++  LD +S  L+E+QS  DP  + L  V  F+S +A LE+
Sbjct:  731 QLVRKMCQALALWKLLCEHQFSLIVSDLQKELQ-EQLKITTFKDLVIRDKELAGALTASLINCYIQDNASVDGVSYRLQEVCPLLYSTDDAVCSKANELLQRSRHV-------PNKLE--KERMLRESLKEYQKISQQVDLPNVCAQYRQVRFYEGVVELCLTAAEKKDPQGLGLHFHKNGEPEEDVAGLQAFQERLNSYKCITDTLQELVNQSKAAPQSPSVPKKPGPPVLSSDPNMLSNEEAGIH----FEQMLK-LAQRSTDELFNIALFNWLIQADLTDKLLELNSPFLEPHLVRMAKLDQNKVRYMDLLWRYYEKNRNFSNAARVVAKLADMPSTEISLKQRLEYISRAILSAKSSTTMSTLAADGEFLHELEEKLEVARIQLQIQETLSRQYSHHSAVGDAVSQLDSQLMDITKLFGQYADPFRLSECKLAIIHCAGHSDPILVQTLWQEIIDKELSDSLGN--SSVDRMQSLHLKMTSLGKIYASTPRYFPLEFLVKYLEQ--QVCNFSWDAGFVTYTMQEINVPVPKLLEVYDHLFKARDPWWSRMKKPLHLLESIYLLLSGYVQEPSKVPSYERRRFTTLCLDAISCYLVELQSM-DPAPALLNTVSNFKSLQAKLER 1337          
BLAST of nuclear pore complex protein Nup155 vs. Ensembl Mouse
Match: Nup155 (nucleoporin 155 [Source:MGI Symbol;Acc:MGI:2181182])

HSP 1 Score: 264.618 bits (675), Expect = 1.185e-71
Identity = 179/571 (31.35%), Postives = 292/571 (51.14%), Query Frame = 1
Query:   64 EKILNILESQLFKEKNIHNLVDQLHIQQ-NHVSVSGHKDSDYPDVGINISS-----NIRISKTSEMPKELQERTRDMKQNCLIGVFKDIERIWVTVDTDLFIWNYENGSDLAYYDGCCDTILAVELIKPKQKVFNTCIHYLLILAGQVEILVMGVSIRGYKNNT----------LELLPEPLFKIATENEHITAIQDI-NGRIVLGTKSGNVLEISYWSEKPSWFKFGQSAVYSNIKYSHENDYKLCARLLNHSTWKLSVLLPNIIVNGLMINEPIVQITADPSRNVFYTRSDNSLIAQYQLL-PNDGLQRLNYVTEDSFVSKAYKSVKSVEKHQFKNIVELCPLGEGYGSL--QLMAITQSGVRLYFM-----------DNLQLCHVRMPP-ISQSSMFGKITNVRLCCESRGSVLMICGSSIDNQALYTISPDAFVLPE-LVETVSMSWAQGSSWFL------------MPLDRNDNKWHAHPVIQTQHLDPLRRFLMVSVENIIQLELPSPIDYLREILEKCSSPQSPAIKSWINHYGPEETIYAALVI-----ASDKRSSFVASRAI 1626
            E    +++ QL +++   +L + L +   N  +VSG  D DYP  G  + S      I   +   +P EL E+   M+ NC++GVF  I R W+T+D+D+F+WNYE+G DLAY+DG  +TILAV L+KPK  +F   + +LL+LA  V+I+++G+S    +  +          ++LLP+PL+ + T+N ++  I    NGRI L  K G + E++Y +E   WF                   + C R +NHS   LS L+P+++      ++PIVQI  D SRN+ YTRS+  +I  Y L     G+ R+  V++++ VS A    +++++  FK IV++  + E   SL  QL+A+T +GVRLYF            + L L HVR+PP  S SS   K + V     S+G +LM    + DN  L+ ++ D F   + ++ET   +   G SW L             PL+++       PV+  QH+ P ++F+++S +  +      P+D LR +L          I+ +   +  ++     L++     A D+  S  A+RA 
Sbjct:   24 ENAGRLIDRQLQEDRMYPDLSELLMVSAPNSPTVSGMSDMDYPLQGPGLLSVPSLPEISTIRRVPLPPELVEQFGHMQCNCMMGVFPPISRAWLTIDSDIFMWNYEDGGDLAYFDGLSETILAVGLVKPKAGIFQPHVRHLLVLATPVDIVILGLSYANVQTGSGILNDSMCGGMQLLPDPLYSLPTDNTYLLTITSTDNGRIFLAGKDGCLYEVAYQAEA-GWFS------------------QRC-RKINHSKSSLSFLVPSLLQFTFSEDDPIVQIEIDNSRNILYTRSEKGVIQVYDLGHDGQGMSRVASVSQNAIVSAAGNIARTIDRSVFKPIVQIAVI-ESSESLDCQLLAVTHAGVRLYFSTCPFRQPLARPNTLTLVHVRLPPGFSASSTVEKPSKVHKALYSKGILLMTASENEDNDILWCVNHDTFPFQKPMMETQMTTRVDGHSWALSAIDELKVDKIITPLNKDHIPITDSPVVVQQHMLPPKKFVLLSAQGSLMFHKLRPVDQLRHLLVSNVGGDGEEIERFFKLHQEDQACATCLILACSTAACDREVSAWATRAF 573          

HSP 2 Score: 210.305 bits (534), Expect = 1.770e-54
Identity = 192/744 (25.81%), Postives = 353/744 (47.45%), Query Frame = 1
Query: 1723 HQVLCMYAARILRPLWDNCI---GEYSKLIQQETHINSTHDSEELTWFLHHLNHLIDFIRDN-------------YPRLKS--IDLMRLSNSPVAPVSFALE----------------LSELLKTTVEIVGLWRMITEHQFHQIIKLLSPEMQNELLRCPVKQXXXXXXXXXXXXXXXXXXQHYSDDGASTEMVIEALLRICPNLYRKEDAICSRANEILLNVDSLNISKSQEPEILEQKKEHLLINAIQLYEQVGPGIDLGSVIFRLKSVGCTWGAVHLCLHAAKLRDPQDYAIRALKEGLRPHASVEINAIEGRSDAYKYLLECLSNLLEMSKFNV-SNNISSKIG--IIRDIRNLFPNNEIRNHALTDLNVILKTIFDRKDDIMVHFEVYSWMIENDLINQILDFNSEHLESFLQQRLMTDPQNIDAKNLLWKHYEMQGRLLEAARVLDDLAVTECENFGLDERLGCISRAIVFVRAVIG-GNEHFEVDYLKELEDKVDLFHLQKVIIEEIG------NTSEKSIIDLNSRLFKISQLLHDFAEPFDLTVSKLSILKVSGNNCPITIRMIWEELIEKEINRIGNIPSKETREVSLKQTIMQIACQFRDSPMYFPLDLILSHLESYCDMCDFSPDWAVCCFTAIDIPIVKIIQAYFEVLKMKDQDSRKHVYRVYNSMCISFDLFLRTQKN-----NRECQIFSSQFLDIVSACLIEMQSKSDPHS-SSLVEKFRSYKALLEQ 3804
            H  +C+Y +RI+  +WD  +     +    ++ T I S+   + L   L  L  L +F+  N               R++   +  MR  N     +   L+                + +L++ + + + LW+++ EHQF  I+  L  E Q E L+    + L++  + +   LI SL+  Y  D A+ + +   L   CP LY  +DA+CS+ANE+L     +  SK++        +E +L  +++ Y+++   +DL SV  + + V    G V L L AA+ +DPQ   +   K G      V +   + R ++YK + + L  L+  SK    S ++  K G  ++    N+  N E  +H       +LK +  R  D +    +Y+W+I+ DL +++L   S  LE  L +    D   +   +LLW++YE       AARVL  LA        L +RL  I+RAI+  ++     +   + ++L ELE+K+++  +Q  I E +       ++ + +I  L+S L  I++L  +FA+PF L   KL+++  +G + PI +  +W+++IEKE+N    + S + R  +L   ++ +   +  +P +FPLD I+  LE      ++   + +     I +P+ ++++ Y ++ K +D    +    ++   CI   L  R  +N     N E + F++  LD V   L+E+QS S   +  ++   F+S +A LE+
Sbjct:  663 HNGICIYFSRIMGNIWDASLVVERVFKSSNREITAIESSVPVQLLESVLQELKGLQEFLDRNSQFSGGPLGNPNTTARVQQRLVGFMRPENGNTQQMQQELQRKFQEAQLSEKISLQAIQQLVRKSYQALALWKLLCEHQFSVIVGELQKEFQ-EQLKITTFKDLVIRDKEVTGALIASLINCYIRDNAAVDGISLHLQDTCPLLYSTDDAVCSKANELLQRSRQVQ-SKTE--------RERMLRESLKEYQKISNQVDLPSVCAQYRQVRFYEGVVELSLTAAEKKDPQGLGLHFYKHGEPEEDVVGLQTFQERLNSYKCITDTLQELVNQSKAAPQSPSVPKKPGPPVLSSDPNMLSNEEAGHH----FEQMLK-LAQRSKDELFSIALYNWLIQADLADKLLQIASPFLEPHLVRMARVDQNRVRYMDLLWRYYEKNRSFSSAARVLSKLADMHSTEISLQQRLEYIARAILSAKSSTAISSIAADGEFLHELEEKMEVARIQLQIQETLQRQYSHHSSVQDAISQLDSELMDITKLYGEFADPFKLAECKLAVIHCAGYSDPILVHTLWQDIIEKELNDSVALSSSD-RMHALSLKLVLLGKIYAGTPRFFPLDFIVQFLEQQVCTLNWDVGFVIQTMNEIGVPLPRLLEVYDQLFKSRDPFWNRVKSPLHLLDCIHV-LLTRYVENPSLVLNCERRRFTNLCLDAVCGYLVELQSMSSSVAVQAITGNFKSLQAKLER 1389          
BLAST of nuclear pore complex protein Nup155 vs. Ensembl Mouse
Match: Nup155 (nucleoporin 155 [Source:MGI Symbol;Acc:MGI:2181182])

HSP 1 Score: 264.233 bits (674), Expect = 1.328e-71
Identity = 179/571 (31.35%), Postives = 292/571 (51.14%), Query Frame = 1
Query:   64 EKILNILESQLFKEKNIHNLVDQLHIQQ-NHVSVSGHKDSDYPDVGINISS-----NIRISKTSEMPKELQERTRDMKQNCLIGVFKDIERIWVTVDTDLFIWNYENGSDLAYYDGCCDTILAVELIKPKQKVFNTCIHYLLILAGQVEILVMGVSIRGYKNNT----------LELLPEPLFKIATENEHITAIQDI-NGRIVLGTKSGNVLEISYWSEKPSWFKFGQSAVYSNIKYSHENDYKLCARLLNHSTWKLSVLLPNIIVNGLMINEPIVQITADPSRNVFYTRSDNSLIAQYQLL-PNDGLQRLNYVTEDSFVSKAYKSVKSVEKHQFKNIVELCPLGEGYGSL--QLMAITQSGVRLYFM-----------DNLQLCHVRMPP-ISQSSMFGKITNVRLCCESRGSVLMICGSSIDNQALYTISPDAFVLPE-LVETVSMSWAQGSSWFL------------MPLDRNDNKWHAHPVIQTQHLDPLRRFLMVSVENIIQLELPSPIDYLREILEKCSSPQSPAIKSWINHYGPEETIYAALVI-----ASDKRSSFVASRAI 1626
            E    +++ QL +++   +L + L +   N  +VSG  D DYP  G  + S      I   +   +P EL E+   M+ NC++GVF  I R W+T+D+D+F+WNYE+G DLAY+DG  +TILAV L+KPK  +F   + +LL+LA  V+I+++G+S    +  +          ++LLP+PL+ + T+N ++  I    NGRI L  K G + E++Y +E   WF                   + C R +NHS   LS L+P+++      ++PIVQI  D SRN+ YTRS+  +I  Y L     G+ R+  V++++ VS A    +++++  FK IV++  + E   SL  QL+A+T +GVRLYF            + L L HVR+PP  S SS   K + V     S+G +LM    + DN  L+ ++ D F   + ++ET   +   G SW L             PL+++       PV+  QH+ P ++F+++S +  +      P+D LR +L          I+ +   +  ++     L++     A D+  S  A+RA 
Sbjct:   24 ENAGRLIDRQLQEDRMYPDLSELLMVSAPNSPTVSGMSDMDYPLQGPGLLSVPSLPEISTIRRVPLPPELVEQFGHMQCNCMMGVFPPISRAWLTIDSDIFMWNYEDGGDLAYFDGLSETILAVGLVKPKAGIFQPHVRHLLVLATPVDIVILGLSYANVQTGSGILNDSMCGGMQLLPDPLYSLPTDNTYLLTITSTDNGRIFLAGKDGCLYEVAYQAEA-GWFS------------------QRC-RKINHSKSSLSFLVPSLLQFTFSEDDPIVQIEIDNSRNILYTRSEKGVIQVYDLGHDGQGMSRVASVSQNAIVSAAGNIARTIDRSVFKPIVQIAVI-ESSESLDCQLLAVTHAGVRLYFSTCPFRQPLARPNTLTLVHVRLPPGFSASSTVEKPSKVHKALYSKGILLMTASENEDNDILWCVNHDTFPFQKPMMETQMTTRVDGHSWALSAIDELKVDKIITPLNKDHIPITDSPVVVQQHMLPPKKFVLLSAQGSLMFHKLRPVDQLRHLLVSNVGGDGEEIERFFKLHQEDQACATCLILACSTAACDREVSAWATRAF 573          

HSP 2 Score: 201.445 bits (511), Expect = 7.458e-52
Identity = 171/665 (25.71%), Postives = 317/665 (47.67%), Query Frame = 1
Query: 1723 HQVLCMYAARILRPLWDNCI---GEYSKLIQQETHINSTHDSEELTWFLHHLNHLIDFIRDN-------------YPRLKS--IDLMRLSNSPVAPVSFALE----------------LSELLKTTVEIVGLWRMITEHQFHQIIKLLSPEMQNELLRCPVKQXXXXXXXXXXXXXXXXXXQHYSDDGASTEMVIEALLRICPNLYRKEDAICSRANEILLNVDSLNISKSQEPEILEQKKEHLLINAIQLYEQVGPGIDLGSVIFRLKSVGCTWGAVHLCLHAAKLRDPQDYAIRALKEGLRPHASVEINAIEGRSDAYKYLLECLSNLLEMSKFNV-SNNISSKIG--IIRDIRNLFPNNEIRNHALTDLNVILKTIFDRKDDIMVHFEVYSWMIENDLINQILDFNSEHLESFLQQRLMTDPQNIDAKNLLWKHYEMQGRLLEAARVLDDLAVTECENFGLDERLGCISRAIVFVRAVIG-GNEHFEVDYLKELEDKVDLFHLQKVIIEEIG------NTSEKSIIDLNSRLFKISQLLHDFAEPFDLTVSKLSILKVSGNNCPITIRMIWEELIEKEINRIGNIPSKETREVSLKQTIMQIACQFRDSPMYFPLDLILSHLESYCDMCDFSPDWAVCCFTAIDIPIVKIIQAYFEVLKMKD 3585
            H  +C+Y +RI+  +WD  +     +    ++ T I S+   + L   L  L  L +F+  N               R++   +  MR  N     +   L+                + +L++ + + + LW+++ EHQF  I+  L  E Q E L+    + L++  + +   LI SL+  Y  D A+ + +   L   CP LY  +DA+CS+ANE+L     +  SK++        +E +L  +++ Y+++   +DL SV  + + V    G V L L AA+ +DPQ   +   K G      V +   + R ++YK + + L  L+  SK    S ++  K G  ++    N+  N E  +H       +LK +  R  D +    +Y+W+I+ DL +++L   S  LE  L +    D   +   +LLW++YE       AARVL  LA        L +RL  I+RAI+  ++     +   + ++L ELE+K+++  +Q  I E +       ++ + +I  L+S L  I++L  +FA+PF L   KL+++  +G + PI +  +W+++IEKE+N    + S + R  +L   ++ +   +  +P +FPLD I+  LE      ++   + +     I +P+ ++++ Y ++ K +D
Sbjct:  663 HNGICIYFSRIMGNIWDASLVVERVFKSSNREITAIESSVPVQLLESVLQELKGLQEFLDRNSQFSGGPLGNPNTTARVQQRLVGFMRPENGNTQQMQQELQRKFQEAQLSEKISLQAIQQLVRKSYQALALWKLLCEHQFSVIVGELQKEFQ-EQLKITTFKDLVIRDKEVTGALIASLINCYIRDNAAVDGISLHLQDTCPLLYSTDDAVCSKANELLQRSRQVQ-SKTE--------RERMLRESLKEYQKISNQVDLPSVCAQYRQVRFYEGVVELSLTAAEKKDPQGLGLHFYKHGEPEEDVVGLQTFQERLNSYKCITDTLQELVNQSKAAPQSPSVPKKPGPPVLSSDPNMLSNEEAGHH----FEQMLK-LAQRSKDELFSIALYNWLIQADLADKLLQIASPFLEPHLVRMARVDQNRVRYMDLLWRYYEKNRSFSSAARVLSKLADMHSTEISLQQRLEYIARAILSAKSSTAISSIAADGEFLHELEEKMEVARIQLQIQETLQRQYSHHSSVQDAISQLDSELMDITKLYGEFADPFKLAECKLAVIHCAGYSDPILVHTLWQDIIEKELNDSVALSSSD-RMHALSLKLVLLGKIYAGTPRFFPLDFIVQFLEQQVCTLNWDVGFVIQTMNEIGVPLPRLLEVYDQLFKSRD 1311          
BLAST of nuclear pore complex protein Nup155 vs. UniProt/SwissProt
Match: sp|P37199|NU155_RAT (Nuclear pore complex protein Nup155 OS=Rattus norvegicus OX=10116 GN=Nup155 PE=1 SV=1)

HSP 1 Score: 428.328 bits (1100), Expect = 8.695e-127
Identity = 377/1404 (26.85%), Postives = 657/1404 (46.79%), Query Frame = 1
Query:   64 EKILNILESQLFKEKNIHNLVDQLHIQQ-NHVSVSGHKDSDYPDVG---INISSNIRISKTSEMPKELQ--ERTRDMKQNCLIGVFKDIERIWVTVDTDLFIWNYENGSDLAYYDGCCDTILAVELIKPKQKVFNTCIHYLLILAGQVEILVMGVSIRGYKNNT----------LELLPEPLFKIATENEHITAIQDI-NGRIVLGTKSGNVLEISYWSEKPSWFKFGQSAVYSNIKYSHENDYKLCARLLNHSTWKLSVLLPNIIVNGLMINEPIVQITADPSRNVFYTRSDNSLIAQYQLL-PNDGLQRLNYVTEDSFVSKAYKSVKSVEKHQFKNIVELCPLGEGYGSL--QLMAITQSGVRLYFM-----------DNLQLCHVRMPP-ISQSSMFGKITNVRLCCESRGSVLMICGSSIDNQALYTISPDAFVLPE-LVETVSMSWAQGSSWFL------------MPLDRNDNKWHAHPVIQTQHLDPLRRFLMVSVENIIQLELPSPIDYLREILEKCSSPQSPAIKSWINHYGPEETIYAALVI-----ASDKRSSFVASRAI-----EVVLYY---------LNEIIKARSMAS------------QSLNRASYD------------IGNPL-------------------HQVLCMYAARILRPLWDNCI---GEYSKLIQQETHINSTHDSEELTWFLHHLNHLIDFIRDNY---------PRLKS------IDLMRLSNSPVAPVSFALE----------------LSELLKTTVEIVGLWRMITEHQFHQIIKLLSPEMQNELLRCPVKQXXXXXXXXXXXXXXXXXXQHYSDDGASTEMVIEALLRICPNLYRKEDAICSRANEILLNVDSLNISKSQEPEILEQKKEHLLINAIQLYEQVGPGIDLGSVIFRLKSVGCTWGAVHLCLHAAKLRDPQDYAIRALKEGLRPHASVEINAIEGRSDAYKYLLECLSNLLEMSKFNV-SNNISSKIG--IIRDIRNLFPNNEIRNHALTDLNVILKTIFDRKDDIMVHFEVYSWMIENDLINQILDFNSEHLESFLQQRLMTDPQNIDAKNLLWKHYEMQGRLLEAARVLDDLAVTECENFGLDERLGCISRAIVFVRAVIG-GNEHFEVDYLKELEDKVDLFHLQKVIIEEIG------NTSEKSIIDLNSRLFKISQLLHDFAEPFDLTVSKLSILKVSGNNCPITIRMIWEELIEKEINRIGNIPSKETREVSLKQTIMQIACQFRDSPMYFPLDLILSHLESYCDMCDFSPDWAVCCFTAIDIPIVKIIQAYFEVLKMKDQDSRKHVYRVYNSMCISFDLFLRTQKN-----NRECQIFSSQFLDIVSACLIEMQSKSDPHS-SSLVEKFRSYKALLEQ 3804
            E    +++ QL +++   +L + L +   N  +VSG  D DYP  G   +++ S   IS    +P  L             ++GVF  I R W+T+D+D+F+WNYE+G DLAY+DG  +TILAV L+KPK  +F   + +LL+LA  V+I+++G+S    +  +          L+LLP+PL+ + T+N ++  I    NGRI L  K G + E++Y +E   WF                   + C R +NHS   LS L+P+++      ++PIVQI  D SRN+ YTRS+  +I  Y L     G+ R+  V++++ V  A    +++++  FK IV++  + E   SL  QL+A+T +GVRLYF            + L L HVR+PP  S SS   K + V     S+G +LM    + DN  L+ ++ D F   + ++ET   +   G SW L             PL+++       PV+  QH+ P ++F+++S +  +      P+D LR +L          I+ +   +  ++     L++     A D+  S  A+RA      E  + +         +  I+ +   +S             SL   S+             +GNP                    H  +C+Y +RI+  +WD  +     +    ++ T I S+   + L   L  L  L +F+  N          P   +      + +MR  N     +   L+                + +L++ + + + LW+++ EHQF  I+  L  E Q E L+    + L++ ++ +   LI SL+  Y  D A+ + +   L   CP LY  +DA+CS+ANE+L     +  SKS+        +E +L  +++ Y+++   +DL SV  + + V    G V L L AA+ +DPQ   +   K G      V +   + R ++YK + + L  L+  SK    S ++  K G  ++    N+  N E  +H       +LK +  R  D +    +Y+W+I+ DL +++L   S  LE  L +    D   +   +LLW++YE       AARVL  LA        L +RL  I+RAI+  ++     +   + ++L ELE+K+++  +Q  I E +       ++ + +I  L+S L  I++L  +FA+PF L   KL+I+  +G + PI +  +W+++IEKE++    + S + R  +L   ++ +   +  +P +FPLD I+  LE      ++   + +     I +P+ ++++ Y ++ K +D    +    ++   CI   L  R  +N     N E + F++  LD V   L+E+QS S   +  ++   F+S +A LE+
Sbjct:   23 ENAGRLIDRQLQEDRMYPDLSELLMVSAPNSPTVSGMSDMDYPLQGPGLLSVPSLPEISTIRRVPLRLSWLNSLDTCSVTAMMGVFPPISRAWLTIDSDIFMWNYEDGGDLAYFDGLSETILAVGLVKPKAGIFQPHVRHLLVLATPVDIVILGLSYANVQTGSGILNDSVCGGLQLLPDPLYSLPTDNTYLLTITSTDNGRIFLAGKDGCLYEVAYQAEA-GWFS------------------QRC-RKINHSKSSLSFLVPSLLQFTFSEDDPIVQIEIDNSRNILYTRSEKGVIQVYDLGHDGQGMSRVASVSQNAIVCAAGNIARTIDRSVFKPIVQIAVI-ENSESLDCQLLAVTHAGVRLYFSTCPFRQPLARPNTLTLVHVRLPPGFSASSTVEKPSKVHKALYSKGILLMTASENEDNDILWCVNHDTFPFQKPMMETQMTTRVDGHSWALSAIDELKVDKIITPLNKDHIPITDSPVVVQQHMLPPKKFVLLSAQGSLMFHKLRPVDQLRHLLVSNVGGDGEEIERFFKLHQEDQACATCLILACSTAACDREVSAWATRAFFRYGGEAQMRFPATLPTPSNVGPILGSPMYSSSPVPTGSPYPNPSSLGTPSHGAQPPTMSTPMSAVGNPAMQAASLSGLTGPEIVYSGKHNGICIYFSRIMGNIWDASLVVERVFKSSNREITAIESSVPIQLLESVLQELKGLQEFLDRNSQFSGGPLGNPNTTAKVQQRLLGVMRPENGNTQQMQQELQRKFHEAQLSEKISLQAIQQLVRKSYQALALWKLLCEHQFTVIVGELQKEFQ-EQLKITTFKDLVIREKEVTGALIASLINCYIRDNAAVDGISLHLQDTCPLLYSTDDAVCSKANELLQRSRQVQ-SKSE--------RERMLRESLKEYQKISNQVDLPSVCAQYRQVRFYEGVVELSLTAAEKKDPQGLGLHFYKHGEPEEDVVGLQTFQERLNSYKCITDTLQELVNQSKAAPQSPSVPKKPGPPVLSSDPNMLSNEEAGHH----FEQMLK-LAQRSKDELFSIALYNWLIQADLADKLLQIASPFLEPHLVRMAKVDQNRVRYMDLLWRYYEKNRSFSSAARVLSKLADMHSTEISLQQRLEYIARAILSAKSSTAISSIAADGEFLHELEEKMEVARIQLQIQETLQRQYSHHSSVQDAISQLDSELMDITKLYGEFADPFKLAECKLAIIHCAGYSDPILVHTLWQDIIEKELSDSVTLSSSD-RMHALSLKLVLLGKIYAGTPRFFPLDFIVQFLEQQVCTLNWDVGFVIQTMNEIGVPLPRLLEVYDQLFKSRDPFWNRVKSPLHLLDCIHV-LLTRYVENPSLVLNCERRRFTNLCLDAVCGYLVELQSMSSSVAVQAITGNFKSLQAKLER 1388          
BLAST of nuclear pore complex protein Nup155 vs. UniProt/SwissProt
Match: sp|Q9V463|NU154_DROME (Nuclear pore complex protein Nup154 OS=Drosophila melanogaster OX=7227 GN=Nup154 PE=1 SV=1)

HSP 1 Score: 356.681 bits (914), Expect = 1.703e-101
Identity = 332/1315 (25.25%), Postives = 577/1315 (43.88%), Query Frame = 1
Query:   76 NILESQLFKEKNIHNLVDQLHI-QQNHVSVSGHKDSDYPDVGINIS------SNIRISKTSEMPKELQERTRDMKQNCLIGVFKDIERIWVTVDTDLFIWNYENGSDLAYYDGCCDTILAVELIKPKQKVFNTCIHYLLILAGQVEILVMGVSIRGYKNNTLELLPEPLFKIATENEHITAIQDIN-GRIVLGTKSGNVLEISYWSEKPSWFKFGQSAVYSNIKYSHENDYKLCARLLNHSTWKLSVLLPNIIVNGLMINEPIVQITADPSRNVFYTRSDNSLIAQYQLLPN-DGLQRLNYVTEDSFVSKAYKSVKSVEKHQFKNIVELCPL-GEGYGSLQLMAITQSGVRLYFM----------------------------------------DNLQLCHVRMPP-ISQSSMFGKITNVRLCCESRGSVLMICGSSIDNQALYTISPDAFV-LPELVETVSMSWAQGSSWFLMPLDRNDNKWHAHPVIQTQHLDPLRRFLMVSVENIIQLELPSPIDYLREILEKCSSPQSPAIKSWINHYGPEETIYAALVIASDK--RSSFVASRAIEVVLYYLNE-------IIKA--RSMASQSLN--------RASYDIGNPL---------------------------------------------HQVLCMYAARILRPLWD-NCIGEY--SKLIQQETHINSTHDSEELTWFLHHLNHLIDFIR----DNY-PRLKSIDLMRLSNS--PV---------APVSFALELSEL---LKTTVEIVGLWRMITEHQFHQIIKLLSPEMQNELLRCPVKQXXXXXXXXXXXXXXXXXXQHYSDDGASTEMVIEALLRICPNLYRKEDAICSRANEILLNVDSLNISKSQEPEILEQKKEHLLINAIQLYEQVGPGIDLGSVIFRLKSVGCTWGAVHLCLHAAKLRDPQDYAIRALKEGLRPHASVEINAIEGRSDAYKYLLECLSNLLEMSKFNVSNNISSKIGIIRDIRNLFPNNEIRNHALTDLNVILKTIFDRKDDIMVHFEVYSWMIENDLINQILDFNSEHLESFLQQRLMTDPQNIDAKNLLWKHYEMQGRLLEAARVLDDLAVTECENFGLDERLGCISRAIVFVRAVIGGNEHFEVDYLKELEDKVDLFHLQKVIIEEIGN-TSEK-----SIIDLNSRLFKISQLLHDFAEPFDLTVSKLSILKVSGNNCPITIRMIWEELIEKEINRIGNIPSKETREVSLKQTIMQIACQFRDSPMYFPLDLILSHLESYCDMCDFSPDWAVCCFTAIDIPIVKIIQAYFEVLKMKDQ 3588
            ++LE     E+N   L++   + Q    ++SG  D DY  +    S        +R    S +P E+ E  + +K +C +G+F +I R W+T+D++++IW +    D+AYYDG    I++V L+KPK  VF   + YLL+L   +E++V+GV+      N ++L+  P+F I T+N  I+ I+  + GRI LG + G + EI Y +E  SWF                   K C ++ N S   +S ++P+ +     + +PI  I  D SR + Y  ++  +I  + +  +    +RL  +T++   ++A   + +V+   FK++  +CPL  +    L L+A+TQ GVRL+F                                           L L HVR+PP  + ++   K   V     + G++LMI     +   L+++S    V    LVE+ ++    G  W L  +          P+   +H    R+  +++ +    +E+   +D LR+IL  C+ P    +K +       E    AL++A+    R S VA  A +  + Y  E        + A  R+MA+Q+L         R S  +  P+                                             H  L MY +R+L  +W   C+ E   S L Q E  +  +      ++   H  H I        DN+  R  S + + + N+  P+         A V     LS L   +K   E++ LW ++  H F  I   LSPE Q +LL C   + LL+ +  +   LI SL+  Y  D A    V + L   CPNLYR ED +  +A E+L+N    N + + E       KEH+L   + + ++  P + L S+  +  S     G + L    A   DP++  +     G              R   YK +   L ++ +     V N    +   I  ++     ++ +N A   +  I+      KD  ++H  +Y W++ +D++ ++LD     L  FL++ +  +  N+   +LLWK+YE      +AA +LD+LA+T  EN  L++R+  + RA++ +R    G+      +LKELEDK+D+  +QK ++  +    S+K     ++ +LN  L+ I+QL   FAEPFDL   +LSIL  S +N P+ I  +W ++I   +++ G    +  R   L   I  +  ++ +S + FP   ++  LE       F          ++++ I  +++ Y  ++ M ++
Sbjct:   16 SMLEWHYNLERNKPGLLELTGVSQHGRATMSGLNDYDYQSLSFLKSDRTHNLQQMRTVTKSAIPNEILEHFKHIKCHCTMGLFPEIGRAWLTIDSEIYIWTFNQTRDVAYYDGLSHLIVSVGLVKPKPGVFVQDVKYLLVLTTPIEVIVLGVTFGESSYNEMQLMNRPVFVIGTDNVSISVIKGTDDGRIFLGGRDGCLYEIYYQAES-SWFG------------------KRCKKI-NLSQGLVSYMVPSFLKVFSEV-DPIEHIEIDNSRKLLYVLTEKGVIEAWDISTSYTTARRLGRITQNDITNQAVSLITTVDPSIFKSVKAICPLSADDADKLHLVAVTQCGVRLFFSTTSLNVKQQFGPAVPCSPGENTGFGQPAVQPPLSPNAEAPKGLYLLHVRLPPGYTPNATTNKPKQVHAAHYTEGTMLMITTQQHEQDLLWSLSSAPSVNFTYLVESTALESLDGVVWGLAEVHEPSTPQRKSPLNSARHA---RKVALLTNQGTHIIEVLKMVDVLRQILLSCNGPHHEEVKMFFQSQNQREACVTALLLATSDTYRGSDVALWAAQAFMLYGGEPCYQHQKFLNASNRNMANQTLGPNTTNVRERQSMFMSTPMPNSVANSPVGFPGSQFNQPISPIGNMQPPQVAVSNENSPIVFSAKHDGLYMYVSRMLHSVWQMRCVNEQFCSNLSQSECALLLSDLRSLRSFLEVHSVHDISSTTRVSFDNHLDRTNSYNTIMMGNTLLPIPEQRVLSEQAQVEETRSLSALNLFVKHACEVISLWNILNSHSFQLICVQLSPEHQ-KLLTCSTFRDLLITRSEVCAFLIISLINLYLKDAAGVSEVSKNLRENCPNLYRHEDDVTYKATELLMNAK--NCTSATE-------KEHMLRTTLHMCKEAAPTLPLHSICMQFISADFFEGVIELSAVCASKSDPEEVGVHFYNNGEPADDREGYTCFATRMAYYKEVQLMLDHIYQ----RVCNKTHVQDKSINPLKGTAKASDAKNGATQTIPKIVAHTLKVKDP-LIHITLYEWLLAHDMLKELLDVVEPSLGEFLRRSVSQNVDNVVLIDLLWKYYEKNSHHSQAAHILDNLAMTRSENINLEQRIEYLVRAVMCMRNGNVGSSLSNGIFLKELEDKLDIARVQKSVLAAMTELASDKLEAATAVKELNYALYDITQLYQHFAEPFDLWECQLSILNCSHHNDPLLIESVWGQIINSVVDKPGTTSERCNR---LFTKIEILVREYGESGVCFPFAFLIRELEVKACQLRFPEGIVPEKLVSMNLDIELLLEYYSRMISMNER 1288          
BLAST of nuclear pore complex protein Nup155 vs. UniProt/SwissProt
Match: sp|O75694|NU155_HUMAN (Nuclear pore complex protein Nup155 OS=Homo sapiens OX=9606 GN=NUP155 PE=1 SV=1)

HSP 1 Score: 265.003 bits (676), Expect = 5.761e-71
Identity = 181/571 (31.70%), Postives = 297/571 (52.01%), Query Frame = 1
Query:   64 EKILNILESQLFKEKNIHNLVDQLHIQQ-NHVSVSGHKDSDYPDVGINISSNIRISKTSE-----MPKELQERTRDMKQNCLIGVFKDIERIWVTVDTDLFIWNYENGSDLAYYDGCCDTILAVELIKPKQKVFNTCIHYLLILAGQVEILVMGVSI------RGYKNNTL----ELLPEPLFKIATENEHITAIQDI-NGRIVLGTKSGNVLEISYWSEKPSWFKFGQSAVYSNIKYSHENDYKLCARLLNHSTWKLSVLLPNIIVNGLMINEPIVQITADPSRNVFYTRSDNSLIAQYQLLPN-DGLQRLNYVTEDSFVSKAYKSVKSVEKHQFKNIVELCPLGEGYGSL--QLMAITQSGVRLYFM-----------DNLQLCHVRMPP-ISQSSMFGKITNVRLCCESRGSVLMICGSSIDNQALYTISPDAFVLPE-LVETVSMSWAQGSSWFL------------MPLDRNDNKWHAHPVIQTQHLDPLRRFLMVSVENIIQLELPSPIDYLREILEKCSSPQSPAIKSWINHYGPEETIYAALVI-----ASDKRSSFVASRAI 1626
            E    +++ QL +++   +L + L +   N+ +VSG  D DYP  G  + S   + + S      +P EL E+   M+ NC++GVF  I R W+T+D+D+F+WNYE+G DLAY+DG  +TILAV L+KPK  +F   + +LL+LA  V+I+++G+S        G  N++L    +LLP+PL+ + T+N ++  I    NGRI L  K G + E++Y +E   WF                   + C R +NHS   LS L+P+++      ++PI+QI  D SRN+ YTRS+  +I  Y L  +  G+ R+  V++++ VS A    +++++  FK IV++  + E   SL  QL+A+T +GVRLYF            + L L HVR+PP  S SS   K + V     S+G +LM    + DN  L+ ++ D F   + ++ET   +   G SW L             PL+++       PV+  QH+ P ++F+++S +  +      P+D LR +L          I+ +   +  ++     L++     A D+  S  A+RA 
Sbjct:   24 ENAGRLIDRQLQEDRMYPDLSELLMVSAPNNPTVSGMSDMDYPLQGPGLLSVPNLPEISSIRRVPLPPELVEQFGHMQCNCMMGVFPPISRAWLTIDSDIFMWNYEDGGDLAYFDGLSETILAVGLVKPKAGIFQPHVRHLLVLATPVDIVILGLSYANLQTGSGVLNDSLSGGMQLLPDPLYSLPTDNTYLLTITSTDNGRIFLAGKDGCLYEVAYQAEA-GWFS------------------QRC-RKINHSKSSLSFLVPSLLQFTFSEDDPILQIAIDNSRNILYTRSEKGVIQVYDLGQDGQGMSRVASVSQNAIVSAAGNIARTIDRSVFKPIVQIAVI-ENSESLDCQLLAVTHAGVRLYFSTCPFRQPLARPNTLTLVHVRLPPGFSASSTVEKPSKVHRALYSKGILLMAASENEDNDILWCVNHDTFPFQKPMMETQMTAGVDGHSWALSAIDELKVDKIITPLNKDHIPITDSPVVVQQHMLPPKKFVLLSAQGSLMFHKLRPVDQLRHLLVSNVGGDGEEIERFFKLHQEDQACATCLILACSTAACDREVSAWATRAF 573          

HSP 2 Score: 212.616 bits (540), Expect = 2.381e-54
Identity = 196/744 (26.34%), Postives = 355/744 (47.72%), Query Frame = 1
Query: 1723 HQVLCMYAARILRPLWDNCIGE---YSKLIQQETHINSTHDSEELTWFLHHLNHLIDFIRDNYP---------------RLKSIDLMRLSNSPVAPVSFALE----------------LSELLKTTVEIVGLWRMITEHQFHQIIKLLSPEMQNELLRCPVKQXXXXXXXXXXXXXXXXXXQHYSDDGASTEMVIEALLRICPNLYRKEDAICSRANEILLNVDSLNISKSQEPEILEQKKEHLLINAIQLYEQVGPGIDLGSVIFRLKSVGCTWGAVHLCLHAAKLRDPQDYAIRALKEGLRPHASVEINAIEGRSDAYKYLLECLSNLLEMSKFNV-SNNISSKIG--IIRDIRNLFPNNEIRNHALTDLNVILKTIFDRKDDIMVHFEVYSWMIENDLINQILDFNSEHLESFLQQRLMTDPQNIDAKNLLWKHYEMQGRLLEAARVLDDLAVTECENFGLDERLGCISRAIVFVRAVIG-GNEHFEVDYLKELEDKVDLFHLQKVIIEEIG------NTSEKSIIDLNSRLFKISQLLHDFAEPFDLTVSKLSILKVSGNNCPITIRMIWEELIEKEINRIGNIPSKETREVSLKQTIMQIACQFRDSPMYFPLDLILSHLESYCDMCDFSPDWAVCCFTAIDIPIVKIIQAYFEVLKMKDQDSRKHVYRVYNSMCISFDLFLRTQKN-----NRECQIFSSQFLDIVSACLIEMQSKSDPHS-SSLVEKFRSYKALLEQ 3804
            H  +C+Y +RI+  +WD  +     +    ++ T I S+   + L   L  L  L +F+  N                 + + I  MR  N     +   L+                + +L++ + + + LW+++ EHQF  I+  L  E+Q E L+    + L++  + L   LI SL+  Y  D A+ + +   L  ICP LY  +DAICS+ANE+L    S  +    E       KE +L  +++ Y+++   +DL +V  + + V    G V L L AA+ +DPQ   +   K G      V + A + R ++YK + + L  L+  SK    S ++  K G  ++    N+  N E  +H       +LK +  R  D +    +Y+W+I+ DL +++L   S  LE  L +    D   +   +LLW++YE       AARVL  LA        L +RL  I+RAI+  ++     +   + ++L ELE+K+++  +Q  I E +       ++ + ++  L+S L  I++L  +FA+PF L   KL+I+  +G + PI ++ +W+++IEKE++    + S + R  +L   I+ +   +  +P +FPLD I+  LE      ++   + +     I +P+ ++++ Y ++ K +D    +    ++   CI   L +R  +N     N E + F++  LD V   L+E+QS S   +  ++   F+S +A LE+
Sbjct:  663 HNGICIYFSRIMGNIWDASLVVERIFKSGNREITAIESSVPCQLLESVLQELKGLQEFLDRNSQFAGGPLGNPNTTAKVQQRLIGFMRPENGNPQQMQQELQRKFHEAQLSEKISLQAIQQLVRKSYQALALWKLLCEHQFTIIVAELQKELQ-EQLKITTFKDLVIRDKELTGALIASLINCYIRDNAAVDGISLHLQDICPLLYSTDDAICSKANELLQR--SRQVQNKTE-------KERMLRESLKEYQKISNQVDLSNVCAQYRQVRFYEGVVELSLTAAEKKDPQGLGLHFYKHGEPEEDIVGLQAFQERLNSYKCITDTLQELVNQSKAAPQSPSVPKKPGPPVLSSDPNMLSNEEAGHH----FEQMLK-LSQRSKDELFSIALYNWLIQVDLADKLLQVASPFLEPHLVRMAKVDQNRVRYMDLLWRYYEKNRSFSNAARVLSRLADMHSTEISLQQRLEYIARAILSAKSSTAISSIAADGEFLHELEEKMEVARIQLQIQETLQRQYSHHSSVQDAVSQLDSELMDITKLYGEFADPFKLAECKLAIIHCAGYSDPILVQTLWQDIIEKELSDSVTLSSSD-RMHALSLKIVLLGKIYAGTPRFFPLDFIVQFLEQQVCTLNWDVGFVIQTMNEIGVPLPRLLEVYDQLFKSRDPFWNRMKKPLHLLDCIHV-LLIRYVENPSQVLNCERRRFTNLCLDAVCGYLVELQSMSSSVAVQAITGNFKSLQAKLER 1389          
BLAST of nuclear pore complex protein Nup155 vs. UniProt/SwissProt
Match: sp|Q99P88|NU155_MOUSE (Nuclear pore complex protein Nup155 OS=Mus musculus OX=10090 GN=Nup155 PE=1 SV=1)

HSP 1 Score: 264.618 bits (675), Expect = 8.286e-71
Identity = 179/571 (31.35%), Postives = 292/571 (51.14%), Query Frame = 1
Query:   64 EKILNILESQLFKEKNIHNLVDQLHIQQ-NHVSVSGHKDSDYPDVGINISS-----NIRISKTSEMPKELQERTRDMKQNCLIGVFKDIERIWVTVDTDLFIWNYENGSDLAYYDGCCDTILAVELIKPKQKVFNTCIHYLLILAGQVEILVMGVSIRGYKNNT----------LELLPEPLFKIATENEHITAIQDI-NGRIVLGTKSGNVLEISYWSEKPSWFKFGQSAVYSNIKYSHENDYKLCARLLNHSTWKLSVLLPNIIVNGLMINEPIVQITADPSRNVFYTRSDNSLIAQYQLL-PNDGLQRLNYVTEDSFVSKAYKSVKSVEKHQFKNIVELCPLGEGYGSL--QLMAITQSGVRLYFM-----------DNLQLCHVRMPP-ISQSSMFGKITNVRLCCESRGSVLMICGSSIDNQALYTISPDAFVLPE-LVETVSMSWAQGSSWFL------------MPLDRNDNKWHAHPVIQTQHLDPLRRFLMVSVENIIQLELPSPIDYLREILEKCSSPQSPAIKSWINHYGPEETIYAALVI-----ASDKRSSFVASRAI 1626
            E    +++ QL +++   +L + L +   N  +VSG  D DYP  G  + S      I   +   +P EL E+   M+ NC++GVF  I R W+T+D+D+F+WNYE+G DLAY+DG  +TILAV L+KPK  +F   + +LL+LA  V+I+++G+S    +  +          ++LLP+PL+ + T+N ++  I    NGRI L  K G + E++Y +E   WF                   + C R +NHS   LS L+P+++      ++PIVQI  D SRN+ YTRS+  +I  Y L     G+ R+  V++++ VS A    +++++  FK IV++  + E   SL  QL+A+T +GVRLYF            + L L HVR+PP  S SS   K + V     S+G +LM    + DN  L+ ++ D F   + ++ET   +   G SW L             PL+++       PV+  QH+ P ++F+++S +  +      P+D LR +L          I+ +   +  ++     L++     A D+  S  A+RA 
Sbjct:   24 ENAGRLIDRQLQEDRMYPDLSELLMVSAPNSPTVSGMSDMDYPLQGPGLLSVPSLPEISTIRRVPLPPELVEQFGHMQCNCMMGVFPPISRAWLTIDSDIFMWNYEDGGDLAYFDGLSETILAVGLVKPKAGIFQPHVRHLLVLATPVDIVILGLSYANVQTGSGILNDSMCGGMQLLPDPLYSLPTDNTYLLTITSTDNGRIFLAGKDGCLYEVAYQAEA-GWFS------------------QRC-RKINHSKSSLSFLVPSLLQFTFSEDDPIVQIEIDNSRNILYTRSEKGVIQVYDLGHDGQGMSRVASVSQNAIVSAAGNIARTIDRSVFKPIVQIAVI-ESSESLDCQLLAVTHAGVRLYFSTCPFRQPLARPNTLTLVHVRLPPGFSASSTVEKPSKVHKALYSKGILLMTASENEDNDILWCVNHDTFPFQKPMMETQMTTRVDGHSWALSAIDELKVDKIITPLNKDHIPITDSPVVVQQHMLPPKKFVLLSAQGSLMFHKLRPVDQLRHLLVSNVGGDGEEIERFFKLHQEDQACATCLILACSTAACDREVSAWATRAF 573          

HSP 2 Score: 210.305 bits (534), Expect = 1.238e-53
Identity = 192/744 (25.81%), Postives = 353/744 (47.45%), Query Frame = 1
Query: 1723 HQVLCMYAARILRPLWDNCI---GEYSKLIQQETHINSTHDSEELTWFLHHLNHLIDFIRDN-------------YPRLKS--IDLMRLSNSPVAPVSFALE----------------LSELLKTTVEIVGLWRMITEHQFHQIIKLLSPEMQNELLRCPVKQXXXXXXXXXXXXXXXXXXQHYSDDGASTEMVIEALLRICPNLYRKEDAICSRANEILLNVDSLNISKSQEPEILEQKKEHLLINAIQLYEQVGPGIDLGSVIFRLKSVGCTWGAVHLCLHAAKLRDPQDYAIRALKEGLRPHASVEINAIEGRSDAYKYLLECLSNLLEMSKFNV-SNNISSKIG--IIRDIRNLFPNNEIRNHALTDLNVILKTIFDRKDDIMVHFEVYSWMIENDLINQILDFNSEHLESFLQQRLMTDPQNIDAKNLLWKHYEMQGRLLEAARVLDDLAVTECENFGLDERLGCISRAIVFVRAVIG-GNEHFEVDYLKELEDKVDLFHLQKVIIEEIG------NTSEKSIIDLNSRLFKISQLLHDFAEPFDLTVSKLSILKVSGNNCPITIRMIWEELIEKEINRIGNIPSKETREVSLKQTIMQIACQFRDSPMYFPLDLILSHLESYCDMCDFSPDWAVCCFTAIDIPIVKIIQAYFEVLKMKDQDSRKHVYRVYNSMCISFDLFLRTQKN-----NRECQIFSSQFLDIVSACLIEMQSKSDPHS-SSLVEKFRSYKALLEQ 3804
            H  +C+Y +RI+  +WD  +     +    ++ T I S+   + L   L  L  L +F+  N               R++   +  MR  N     +   L+                + +L++ + + + LW+++ EHQF  I+  L  E Q E L+    + L++  + +   LI SL+  Y  D A+ + +   L   CP LY  +DA+CS+ANE+L     +  SK++        +E +L  +++ Y+++   +DL SV  + + V    G V L L AA+ +DPQ   +   K G      V +   + R ++YK + + L  L+  SK    S ++  K G  ++    N+  N E  +H       +LK +  R  D +    +Y+W+I+ DL +++L   S  LE  L +    D   +   +LLW++YE       AARVL  LA        L +RL  I+RAI+  ++     +   + ++L ELE+K+++  +Q  I E +       ++ + +I  L+S L  I++L  +FA+PF L   KL+++  +G + PI +  +W+++IEKE+N    + S + R  +L   ++ +   +  +P +FPLD I+  LE      ++   + +     I +P+ ++++ Y ++ K +D    +    ++   CI   L  R  +N     N E + F++  LD V   L+E+QS S   +  ++   F+S +A LE+
Sbjct:  663 HNGICIYFSRIMGNIWDASLVVERVFKSSNREITAIESSVPVQLLESVLQELKGLQEFLDRNSQFSGGPLGNPNTTARVQQRLVGFMRPENGNTQQMQQELQRKFQEAQLSEKISLQAIQQLVRKSYQALALWKLLCEHQFSVIVGELQKEFQ-EQLKITTFKDLVIRDKEVTGALIASLINCYIRDNAAVDGISLHLQDTCPLLYSTDDAVCSKANELLQRSRQVQ-SKTE--------RERMLRESLKEYQKISNQVDLPSVCAQYRQVRFYEGVVELSLTAAEKKDPQGLGLHFYKHGEPEEDVVGLQTFQERLNSYKCITDTLQELVNQSKAAPQSPSVPKKPGPPVLSSDPNMLSNEEAGHH----FEQMLK-LAQRSKDELFSIALYNWLIQADLADKLLQIASPFLEPHLVRMARVDQNRVRYMDLLWRYYEKNRSFSSAARVLSKLADMHSTEISLQQRLEYIARAILSAKSSTAISSIAADGEFLHELEEKMEVARIQLQIQETLQRQYSHHSSVQDAISQLDSELMDITKLYGEFADPFKLAECKLAVIHCAGYSDPILVHTLWQDIIEKELNDSVALSSSD-RMHALSLKLVLLGKIYAGTPRFFPLDFIVQFLEQQVCTLNWDVGFVIQTMNEIGVPLPRLLEVYDQLFKSRDPFWNRVKSPLHLLDCIHV-LLTRYVENPSLVLNCERRRFTNLCLDAVCGYLVELQSMSSSVAVQAITGNFKSLQAKLER 1389          
BLAST of nuclear pore complex protein Nup155 vs. UniProt/SwissProt
Match: sp|G0S7B6|NU170_CHATD (Nucleoporin NUP170 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=NUP170 PE=1 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 2.206e-38
Identity = 268/1259 (21.29%), Postives = 512/1259 (40.67%), Query Frame = 1
Query:  292 IGVFKDIERIWVTVDTDLFIWNYEN-GSDLAYYDGCCDTILAVELIKPKQKVFNTCIHYLLILAGQVEILVMGVSI----RGYKNNTLELLPEPLFKIATENEHITAIQDINGRIVLGTKSGNVLEISYWSEKPSWFKFGQSAVYSNIKYSHENDYKLCARLLNHSTWKLSVLLPNI--IVNGLMINEPIVQITADPSRNVFYTRSDNSLIAQYQLLPNDGLQRLNYVTED-------SFVSKAYKSVKSVEKHQFKNIVELCPLGEGYGS-LQLMAITQSGVRLYFM-----------------DNLQLCHVRMPPISQS----SMFGKITNVRLCCESR-------------GSVLMICGSSIDNQALYTISPDAFVLPELVETVSMSWAQGSSWFLMPLDRNDNKWHAHPVIQTQHLDPLRRFLMVSVENIIQL-ELPSP-----------------IDYLREILEKCSSPQSPA----IKSWINHYGPEETIYAALVIA----SDKRSSF-------VASRAIEVVLYYLNEIIKARSMASQSLNRASYDIGNPLHQVLCMYAARILRPLWDNCIGEYSKLIQ--QETHINSTHDSEELTWFLHHLNHLIDFIRDNYPRLKSIDLMRLSNSPVAPVSFALE--------------LSELLKTTVEIVGLWRMITEHQFHQIIKLLSPEMQNELLRCPVKQXXXXXXXXXXXXXXXXXXQHYS-DDGASTEMVIEALLRICPNLYRKEDAICSRANEILLNVDSLNISKSQEPEILEQKKEHLLINAIQLYEQVGPGI---DLGSVIFRLKSVGCTWGAVHLCLHAAKLRDPQDYAIRALKEGLRPHASVEINAIEGRSDAYKYLLECLSNLLEMSKFNVSNNISSKIGIIRDIRNLFPNNEIRNHALTDLNVILKTIFDRKDDIMVHFEVYSWMIENDLINQILDFNSEHLESFLQQRLMTDPQNIDAKNLLWKHYEMQGRLLEAARVLDDLAVTECENFGLDERLGCISRAIVFVRA-VIGGNEHFEVDYLKELEDKVDLFHLQKVIIEEIGN-----TSEKSIID--LNSRLFKISQLLHDFAEPFDLTVSKLSILKVSGNNCPITIRMIWEELIEKE-------------INRIGNIPSKETREVS--------LKQTIMQIACQFRDSPMYFPLDLILSHLESYC--DMCDFS----PDWAVCCFTAIDIPIVKIIQAYFEVLKMKDQD-SRKHVYRVYNSMCISFDLFLR 3654
            +G+F +I   W ++D+ LF+W+Y +   +L  Y+    TI AV L+ PK  VF   I ++L++A   EI+++GVS      G K+ TL      + +  ++   I   +D  GRI LG +S   +   ++ ++  WF                     C + +NHS    S ++P++  +  G    E +  +  D +RN+ Y+ S+ S I  Y +   +G ++L  V E         F   A  S    +K    NIV L P+     S L LMA+T +G RL+                    ++QL  V+ PP        ++ G+I + +L   SR             G    +     +   L+  +PD   +       ++ + +  +W  +    N N+      + T      ++ L    E  +Q  ++P                   +D   + L  C S    A    ++ +IN YG  ETI AAL +A    SD R+           + A    + Y  +   A S   QS++  S  + +  H  L +Y  R++R LW       +K++Q    + I+ST  + +L     ++  L +F+  N   ++ +       +P +   F  +              L +L+++  E +    M+ + +   I   L    Q +L     +QL        L  ++   + + +   GA+ E V +AL R C +    +D +  +A E L         ++    +L      LL  +++L+EQV   +   +L + + +  S+    GA+ LCL  A+ +D  + A+  + +G +P       A + R   Y  + + L  L         ++ + +  ++     L     +  + + +         D  D++  HF++Y W IE    ++IL  +S H+ ++LQ+   TD ++ +   LL + Y  + R  EAA+V  +LA ++  N  L +R+  +SRA        IG +   +     E  + +++ H+Q  ++E +          K+ I+  L+  +  ++ L +D+A+  +     L I   +  + P TI   W  LI +              +   G++P+     ++        + Q I  IA +     + FP++ +L  + +Y   +  D S    P W +  F  + +P   ++Q    VL  ++   + +    V   + ++ D+++R
Sbjct:  147 LGLFAEIGYAWASIDSSLFLWDYTHPNPELIGYEEATHTITAVALVPPKPGVFVKTITHVLVVATTSEIILLGVSATPTPSGSKSLTLYSTRMSVHRGGSDVSFIVGTKD--GRIFLGGESDTDIHEIFYQQEERWFS------------------SRCGK-INHSHPGWSAVVPSLAGLPFGSRQQEWLRGLYVDDTRNLLYSLSNRSTIRTYHM---EGPEKLTKVIEKDKTSCLRDFAHMADSSPLFTDK---TNIVALSPIPATEASKLHLMALTDTGCRLFLSATSSASYTMGGATSLAPQSMQLQFVKFPPRESPTRIRTLNGQIIDSQLDKTSRALDPSALGFRFSPGYFFDVVRKHPNQDMLFVSAPDTGRIKVTQPASALKYFEQGTWIEL---ENGNR-TIEIGLTTAPFAAAKQPLGFGNELAVQFDQVPGEFAVLTNTGVHIVRRRRLVDIFAKALGNCVSASDDALEREVRKFINQYGRVETIAAALAVACGQGSDLRTGTGRGMDRNTENLARAAFIEYGGQPRLAESDGKQSVSE-SVRLSS-RHDALALYLTRLVRTLWK------AKVVQVGSGSDISSTIPTSKLVTIQENVERLRNFLEANKSTIQGL-------APPSERLFGRQEDIANQKEHQALHALQKLMESISEGISFVLMLFDERVSDIYARLDAVSQQQLKDLTYEQLFSQTPGKELAKVLVKAIVNRNIASGANVETVADALRRRCGSFCSPDDVVTFKAQEQLQRAS----EQAHNSPVLRA----LLAESLRLFEQVAGSLTPANLTTAVEQYISLKYYAGAIQLCLTVAQQKDRGNTALSWVNDG-KPANDSRKKAFDERKICYNLIHQVLDKL--------ESDFAGEPELVDGRPTLAATKRMEAYNVVN---------DSSDEVF-HFDLYEWYIEKGWTDRILSIDSPHVITYLQRLAETDFRHAE---LLCRFYTTRSRFFEAAQVQTNLAKSDL-NISLKDRIILLSRAKGNASVNTIGISRQQQQQLNHEASELLEIAHIQDDLLERLVADPRIPEERKAEIEEFLDGPIRTLTDLFNDYADQANYYDLCLLIFHAADFHNPRTILDTWNNLINQSHFEAEQRREYWEIVQAGGDLPAGVIAPIAEPPLPYVYVSQQIQLIAHRTSLDSLIFPVNSLLPVVCAYAINNGQDASIGADPCWPIQLFLNLGVPHALVVQVLENVLDTQEAPFTGRRRKLVVQWIAMAVDMWVR 1328          
BLAST of nuclear pore complex protein Nup155 vs. TrEMBL
Match: A0A267G697 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004589g4 PE=4 SV=1)

HSP 1 Score: 567.77 bits (1462), Expect = 2.357e-176
Identity = 397/1314 (30.21%), Postives = 668/1314 (50.84%), Query Frame = 1
Query:   64 EKILNILESQLFKEKNIHNLVDQLHIQQNHVSVSGHKDSDYPDVGINISSNIRISKTSEMPKELQERTRDMKQNCLIGVFKDIERIWVTVDTDLFIWNYENGSDLAYYDGCCDTILAVELIKPKQKVFNTCIHYLLILAGQVEILVMGVSIRGYKNNTLELLPEPLFKIATENEHITAIQD--INGRIVLGTKSGNVLEISYWSEKPSWFKFGQSAVYSNIKYSHENDYKLCARLLNHSTWKLSVLLPNIIVNGLMINEPIVQITADPSRNVFYTRSDNSLIAQYQLLPNDG---LQRLNYVTEDSFVSKAYKSVKSVEKHQFKNIVELCPLGEGYGS-LQLMAITQSGVRLYFMDNLQLCHVRMPPISQSSMFGKITNVRLCCESRGSVLMICGSSIDNQALYTISPDAFV-LPELVETVSMSWAQGSSWFL--MP---LDRN----DNKWHAHPVIQ--------TQHLDPLRRFLMVSVENIIQLELPSPIDYLREILEKCSSPQSPAIKSWINHYGPEETIYAALVIASDKRSSFVASRAIEVVLYYLNEIIKARSMASQSLN---------RASYDIGNPLHQVLCMYAARILRPLWDNCIGEYSKLIQQETH--INSTHDSEELTWFLHHLNHLIDFIRDNYPRLKSIDLMRLSNSPVAPVSFALELSELLKTTVEIVGLWRMITEHQFHQIIKLLSPEMQNELLRCPVKQXXXXXXXXXXXXXXXXXXQHYSDDGASTEMVIEALLRICPNLYRKEDAICSRANEILLNVDSLNISKSQEPEILEQKKEHLLINAIQLYEQVGPGIDLGSVIFRLKSVGCTWGAVHLCLHAAKLRDPQDYAIRALKEGLRPHASVEINAIEGRSDAYKYLLECLSNLLEMSKFNVSNNISSKIGIIRDIRNLFPNNEIR---------------------NHALTDL--NVILKTIFDRKDDIMVHFEVYSWMIENDLINQILDFNSEHLESFLQQRLMTDPQNIDAKNLLWKHYEMQGRLLEAARVLDDLAVTECENFGLDERLGCISRAIVFVRAVIGGNEHFEVDYLKELEDKVDLFHLQKVIIEEIGNTSEKS---------IIDLNSRLFKISQLLHDFAEPFDLTVSKLSILKVSGNNCPITIRMIWEELIEKEINRIGNIPSKETREVSLKQTIMQIACQFRDSPM---YFPLDLILSHLESYCDMCDFSPDWAVCCFTAIDIPIVKIIQAYFEVLKMKDQD----SRKHVYRVYNSMCISFDLFLRTQKN--NRECQIFSSQFLDIVSACLIEMQSKSDPHSSSLVEKF 3777
            E+ L  LE  +  E++  +L   L    + V++SG   + YP         + IS+ + +P EL E+   M+ NCL+GVF +  R W+TVD + F+WNYE+GSDLAYYDG  D I+AV  ++P++ VF   +H+LL LA  +E+ V+GVS   Y++  + LL EPL ++ T+ + +T I+     GR+  GT+SG +LE++Y   +  W   GQ              Y +  RL+NHS   LS L+P+ I +    ++PI Q+  D SR + YTRS  S +  Y L    G    +R+  +      + A +    V++    +IV L PL   + + L LMA+T SGVR YF   L+L HVR+ P+  S    ++ ++RL  ESRG+VLM+     D   LY +SPD F   P+L E  S++W  G +W +  +P   LD      D + H  P++         TQH+DP+RRFL+VSV  ++ LEL +P+  L  +L   + P S  +  W  H+GPEE+    L++A       V  RA+  V+ +        +  + S++          A+    N L   L  YAAR+L PLW      YS ++ +     + S  +S+EL WF  HL HL  F++ N  +L +    R+          A +L +L+ T +E++ LW+++ EHQF+ + + L+ + +  L     + LLL   R LL  LI  LL+HY  D AS + +   L   C +LY  +DA+C++ANE+L         ++   E L+ ++  LL  A +LY + G  + L  V+ RL+++        LCL  AK  DPQD A+   +EG +PH   + +A+ GR   Y+ LL+  + L   +    +  + + +   R +  + P++                         H +  +  NVI  T+    DD++ H+E+++W+ ++ +  Q+L  +S HLES+L+ RL   P++   + LL +H +  G++LEAAR+L+ LAV  C+   L +R   +++AIV  ++  G       + L++LED++D   +Q  ++EE+     +S         +  LN +LF +++L  +FA P  L ++KL I+  +G+     +  +WEEL+++E+              +++QT+ ++   +        +FP   I++ LE           W V  F   D P+ ++ QAY ++L+ +  D    S +  +++  S+      F R   +   R  Q  +SQFLD++S+  ++++S +D  S ++ ++ 
Sbjct:   58 EEGLQFLEPFVQSERSYPDLATLLGGVGDRVTLSGTDVAAYPPSPNGSGGEVSISRVTPLPGELMEKLGAMQTNCLMGVFPEASRAWLTVDNEFFLWNYEDGSDLAYYDGLQDAIVAVGFVQPRRDVFADEVHHLLCLATPLELAVLGVS---YQSGQVHLLAEPLLRLPTDGQVVTCIEGSRSTGRLFAGTQSGCLLEVAYEERRVGWLS-GQ--------------YTVQGRLINHSVSSLSRLVPSFISSLAAADDPICQVCVDDSRRLVYTRSQESTVFAYALSAEAGDTAARRVAALRGSDLAAHAARIAHMVDRSCLTDIVHLSPLTAQHSAMLYLMAVTGSGVRFYFDARLRLAHVRLGPMCPS--LPRLADIRLATESRGTVLMLASRGEDRDTLYVLSPDPFPRRPQLQEACSVAWPPGRAWIMCCLPSPQLDYRDIGIDPQLHDGPLVGRPYPPVFLTQHVDPVRRFLLVSVHGLVLLELQTPLMRLAGLL-AANQPDSRPVTDWFAHFGPEESSCVCLILACCDSDDLVRERALAAVMLHGTAAAVRDAAMAASIDCQTPVPSSAAAADPSANALLSGLSRYAARVLLPLW------YSPIVSERRGCFLVSRLESDELGWFSSHLTHLFRFVQSNLAQLSASARGRVE---AESQQRAYKLLQLISTNLELLNLWKLLAEHQFYLVARRLTEDERAHLRGTRFRDLLLAKNRLLLNRLIACLLEHYLADSASVDSISNKLQEACSSLYTPQDALCAKANEML---------QAAAGEPLD-RRTSLLAEAGRLYREAGTSVSLADVLPRLEALQAYETMAGLCLALAKQWDPQDRALHFTREGRKPHTEADADAVAGRHGCYQALLDICTRLRRAATGAGAATVPAAV-TPRPV-GVSPHSSAAAAAAAAAAAVVSQSPAKAQQGQHEMARVLDNVIRVTL--NSDDMLAHYEMFNWLSQHGMTEQMLSHDSPHLESYLRNRLRKTPEDQQLRELLCRHLKRCGKVLEAARILEHLAVAACDTADLAQRQAYLAQAIVDAKSRPGEGIG---ELLQQLEDELDTATVQAAVLEELQQRYPQSAASPEMAEAVRRLNGQLFPLTELYAEFAAPLRLPLAKLRIVASAGHRDQALVNQLWEELLDRELAGPAGF-------RAVQQTLARLGRSYSSGANGEDFFPAVQIVATLEKRAIEARLEEGWVVNAFCQFDYPLHRLAQAYDQLLRRRAGDPVWQSLRGYHQLLRSLICLLAKFQRAADSMPARNRQRAASQFLDMISSYQVDLRSHTDAMSVNISQRL 1317          
BLAST of nuclear pore complex protein Nup155 vs. TrEMBL
Match: A0A267FDV4 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004589g1 PE=4 SV=1)

HSP 1 Score: 567.385 bits (1461), Expect = 3.125e-176
Identity = 398/1312 (30.34%), Postives = 666/1312 (50.76%), Query Frame = 1
Query:   64 EKILNILESQLFKEKNIHNLVDQLHIQQNHVSVSGHKDSDYPDVGINISSNIRISKTSEMPKELQERTRDMKQNCLIGVFKDIERIWVTVDTDLFIWNYENGSDLAYYDGCCDTILAVELIKPKQKVFNTCIHYLLILAGQVEILVMGVSIRGYKNNTLELLPEPLFKIATENEHITAIQD--INGRIVLGTKSGNVLEISYWSEKPSWFKFGQSAVYSNIKYSHENDYKLCARLLNHSTWKLSVLLPNIIVNGLMINEPIVQITADPSRNVFYTRSDNSLIAQYQLLPNDG---LQRLNYVTEDSFVSKAYKSVKSVEKHQFKNIVELCPLGEGYGS-LQLMAITQSGVRLYFMDNLQLCHVRMPPISQSSMFGKITNVRLCCESRGSVLMICGSSIDNQALYTISPDAFV-LPELVETVSMSWAQGSSWFL--MP---LDRN----DNKWHAHPVIQ--------TQHLDPLRRFLMVSVENIIQLELPSPIDYLREILEKCSSPQSPAIKSWINHYGPEETIYAALVIASDKRSSFVASRAIEVVLYYLNEIIKARSMASQSLN---------RASYDIGNPLHQVLCMYAARILRPLWDNCIGEYSKLIQQETH--INSTHDSEELTWFLHHLNHLIDFIRDNYPRLKSIDLMRLSNSPVAPVSFALELSELLKTTVEIVGLWRMITEHQFHQIIKLLSPEMQNELLRCPVKQXXXXXXXXXXXXXXXXXXQHYSDDGASTEMVIEALLRICPNLYRKEDAICSRANEILLNVDSLNISKSQEPEILEQKKEHLLINAIQLYEQVGPGIDLGSVIFRLKSVGCTWGAVHLCLHAAKLRDPQDYAIRALKEGLRPHASVEINAIEGRSDAYKYLLECLSNL---------------LEMSKFNVSNNISSKIGIIRDIRNLFPNNEIR----NHALTDL--NVILKTIFDRKDDIMVHFEVYSWMIENDLINQILDFNSEHLESFLQQRLMTDPQNIDAKNLLWKHYEMQGRLLEAARVLDDLAVTECENFGLDERLGCISRAIVFVRAVIGGNEHFEVDYLKELEDKVDLFHLQKVIIEEIGNTSEKS---------IIDLNSRLFKISQLLHDFAEPFDLTVSKLSILKVSGNNCPITIRMIWEELIEKEINRIGNIPSKETREVSLKQTIMQIACQFRDSPM---YFPLDLILSHLESYCDMCDFSPDWAVCCFTAIDIPIVKIIQAYFEVLKMKDQD----SRKHVYRVYNSMCISFDLFLRTQKN--NRECQIFSSQFLDIVSACLIEMQSKSDPHSSSLVEKF 3777
            E+ L  LE  +  E++  +L   L    + V++SG   + YP         + IS+ + +P EL E+   M+ NCL+GVF +  R W+TVD + F+WNYE+GSDLAYYDG  D I+AV  ++P++ VF   +H+LL LA  +E+ V+GVS   Y++  + LL EPL ++ T+ + +T I+     GR+  GT+SG +LE++Y   +  W   GQ              Y +  RL+NHS   LS L+P+ I +    ++PI Q+  D SR + YTRS  S +  Y L    G    +R+  +      + A +    V++    +IV L PL   + + L LMA+T SGVR YF   L+L HVR+ P+  S    ++ ++RL  ESRG+VLM+     D   LY +SPD F   P+L E  S++W  G +W +  +P   LD      D + H  P++         TQH+DP+RRFL+VSV  ++ LEL +P+  L  +L   + P S  +  W  H+GPEE+    L++A       V  RA+  V+ +        +  + S++          A+    N L   L  YAAR+L PLW      YS ++ +     + S  +S+EL WF  HL HL  F++ N  +L +    R+          A +L +L+ T +E++ LW+++ EHQF+ + + L+ + +  L     + LLL   R LL  LI  LL+HY  D AS + +   L   C +LY  +DA+C++ANE+L         ++   E L+ ++  LL  A +LY + G  + L  V+ RL+++        LCL  AK  DPQD A+   +EG +PH   + +A+ GR   Y+ LL+  + L               +      VS + S+          +   +  +     H +  +  NVI  T+    DD++ H+E+++W+ ++ +  Q+L  +S HLES+L+ RL   P++   + LL +H +  G++LEAAR+L+ LAV  C+   L +R   +++AIV  ++  G       + L++LED++D   +Q  ++EE+     +S         +  LN +LF +++L  +FA P  L ++KL I+  +G+     +  +WEEL+++E+              +++QT+ ++   +        +FP   I++ LE           W V  F   D P+ ++ QAY ++L+ +  D    S +  +++  S+      F R   +   R  Q  +SQFLD++S+  ++++S +D  S ++ ++ 
Sbjct:   58 EEGLQFLEPFVQSERSYPDLATLLGGVGDRVTMSGTDVAAYPPSPNGSGGEVSISRVTPLPGELMEKLGAMQTNCLMGVFPEASRAWLTVDNEFFLWNYEDGSDLAYYDGLQDAIVAVGFVQPRRDVFADEVHHLLCLATPLELAVLGVS---YQSGQVHLLAEPLLRLPTDGQVVTCIEGSRSTGRLFAGTQSGCLLEVAYEERRVGWLS-GQ--------------YTVQGRLINHSVSSLSRLVPSFISSLAAADDPICQVCVDDSRRLVYTRSQESTVFAYALSAEAGDTAARRVAALRGSDLAAHAARIAHMVDRSCLTDIVHLSPLTAQHSAMLYLMAVTGSGVRFYFDARLRLAHVRLGPMCPS--LPRLADIRLATESRGTVLMLASRGEDRDTLYVLSPDPFPRRPQLQEACSVAWPPGRAWIMCCLPSPQLDYRDIGIDPQLHDGPLVGRPYPPVFLTQHVDPVRRFLLVSVHGLVLLELQTPLMRLAGLL-AANQPDSRPVTDWFAHFGPEESSCVCLILACCDSDDLVRERALAAVMLHGTAAAVRDAAMAASIDCQTPVPSSAAAADPSANALLSGLSRYAARVLLPLW------YSPIVSERRGCFLVSRLESDELGWFSSHLTHLFRFVQSNLAQLSASARGRVE---AESQQRAYKLLQLISTNLELLNLWKLLAEHQFYLVARRLTEDERAHLRGTRFRDLLLAKNRLLLNRLIACLLEHYLADSASVDSISNKLQEACSSLYTPQDALCAKANEML---------QAAAGEPLD-RRTSLLAEAGRLYREAGTSVSLADVLPRLEALQAYETMAGLCLALAKQWDPQDRALHFTREGRKPHTEADADAVAGRHGCYQALLDICTRLRRAATGAGAATVPVAVTPRPVGVSPHSSAAAAAAAAAAAVVSQSPAKAQQGQHEMARVLDNVIRVTL--NSDDMLAHYEMFNWLSQHGMTEQMLSHDSAHLESYLRNRLRKTPEDQQLRELLCRHLKRCGKVLEAARILEHLAVAACDTADLAQRQAYLAQAIVDAKSRPGEGIG---ELLQQLEDELDTATVQAAVLEELQQRYPQSAASPEMAEAVRRLNGQLFPLTELYAEFAAPLRLPLAKLRIVASAGHRDQALVNQLWEELLDRELAGPAGF-------RAVQQTLARLGRSYSSGANGEDFFPAVQIVATLEKRAIEARLEEGWVVNAFCQFDYPLHRLAQAYDQLLRRRAGDPVWQSLRGYHQLLRSLICLLAKFQRAADSMPARNRQRAASQFLDMISSYQVDLRSHTDAMSVNISQRL 1317          
BLAST of nuclear pore complex protein Nup155 vs. TrEMBL
Match: A0A1I8IEQ3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 535.028 bits (1377), Expect = 1.542e-165
Identity = 366/1156 (31.66%), Postives = 598/1156 (51.73%), Query Frame = 1
Query:   64 EKILNILESQLFKEKNIHNLVDQLHIQQNHVSVSGHKDSDYPDVGINISSNIRISKTSEMPKELQERTRDMKQNCLIGVFKDIERIWVTVDTDLFIWNYENGSDLAYYDGCCDTILAVELIKPKQKVFNTCIHYLLILAGQVEILVMGVSIRGYKNNTLELLPEPLFKIATENEHITAIQD--INGRIVLGTKSGNVLEISYWSEKPSWFKFGQSAVYSNIKYSHENDYKLCARLLNHSTWKLSVLLPNIIVNGLMINEPIVQITADPSRNVFYTRSDNSLIAQYQLLPNDG---LQRLNYVTEDSFVSKAYKSVKSVEKHQFKNIVELCPLGEGYGS-LQLMAITQSGVRLYFMDNLQLCHVRMPPISQSSMFGKITNVRLCCESRGSVLMICGSSIDNQALYTISPDAFV-LPELVETVSMSWAQGSSWFL--MP---LDRN----DNKWHAHPVIQ--------TQHLDPLRRFLMVSVENIIQLELPSPIDYLREILEKCSSPQSPAIKSWINHYGPEETIYAALVIASDKRSSFVASRAIEVVLYYLNEIIKARSMASQSLN---------RASYDIGNPLHQVLCMYAARILRPLWDNCIGEYSKLIQQE--THINSTHDSEELTWFLHHLNHLIDFIRDNYPRLKSIDLMRLSNSPVAPVSFALELSELLKTTVEIVGLWRMITEHQFHQIIKLLSPEMQNELLRCPVKQXXXXXXXXXXXXXXXXXXQHYSDDGASTEMVIEALLRICPNLYRKEDAICSRANEILLNVDSLNISKSQEPEILEQKKEHLLINAIQLYEQVGPGIDLGSVIFRLKSVGCTWGAVHLCLHAAKLRDPQDYAIRALKEGLRPHASVEINAIEGRSDAYKYLLECLSNL---------------LEMSKFNVSNNISSKIGIIRDIRNLFPNNEIR----NHALTDL--NVILKTIFDRKDDIMVHFEVYSWMIENDLINQILDFNSEHLESFLQQRLMTDPQNIDAKNLLWKHYEMQGRLLEAARVLDDLAVTECENFGLDERLGCISRAIVFVRAVIGGNEHFEVDYLKELEDKVDLFHLQKVIIEEIGNTSEKS---------IIDLNSRLFKISQLLHDFAEPFDLTVSKLSILKVSGNNCPITIRMIWEELIEKEI 3336
            E+ L  LE  +  E++  +L   L    + V++SG   + YP         + IS+ + +P EL E+   M+ NCL+GVF +  R W+TVD + F+WNYE+GSDLAYYDG  D I+AV  ++P++ VF   +H+LL LA  +E+ V+GVS   Y++  + LL EPL ++ T+ + +T I+     GR+  GT+SG +LE++Y   +  W   GQ              Y +  RL+NHS   LS L+P+ I +    ++PI Q+  D SR + YTRS  S +  Y L    G    +R+  +      + A +    V++    +IV L PL   + + L LMA+T SGVR YF   L+L HVR+ P+  S    ++ ++RL  ESRG+VLM+     D   LY +SPD F   P+L E  S++W  G +W +  +P   LD      D + H  P++         TQH+DP+RRFL+VSV  ++ LEL +P+  L  +L   + P S  +  W  H+GPEE+    L++A       V  RA+  V+ +        +  + S++          A+    N L   L  YAAR+L PLW      YS ++ +     + S  +S+EL WF  HL HL  F++ N  +L +    R+          A +L +L+ T +E++ LW+++ EHQF+ + + L+ + +  L     + LLL   R LL  LI  LL+HY  D AS + +   L   C +LY  +DA+C++ANE+L         ++   E L+ ++  LL  A +LY + G  + L  V+ RL+++        LCL  AK  DPQD A+   +EG +PH   + +A+ GR   Y+ LL+  + L               +      VS + S+          +   +  +     H +  +  NVI  T+    DD++ H+E+++W+ ++ +  Q+L  +S HLES+L+ RL   P++   + LL +H +  G++LEAAR+L+ LAV  C+   L +R   +++AIV  ++  G       + L++LED++D   +Q  ++EE+     +S         +  LN +LF +++L  +FA P  L ++KL I+  +G+     +  +WEEL+++E+
Sbjct:   54 EEGLQFLEPFVQSERSYPDLATLLGGVGDRVTMSGTDVAAYPPSPNGSGGEVSISRVTPLPGELMEKLGAMQTNCLMGVFPEASRAWLTVDNEFFLWNYEDGSDLAYYDGLQDAIVAVGFVQPRRDVFADEVHHLLCLATPLELAVLGVS---YQSGQVHLLAEPLLRLPTDGQVVTCIEGSRSTGRLFAGTQSGCLLEVAYEERRVGWLS-GQ--------------YTVQGRLINHSVSSLSRLVPSFISSLAAADDPICQVCVDDSRRLVYTRSQESTVFAYALSAEAGDTAARRVAALRGSDLAAHAARIAHMVDRSCLTDIVHLSPLTAQHSAMLYLMAVTGSGVRFYFDARLRLAHVRLGPMCPS--LPRLADIRLATESRGTVLMLASRGEDRDTLYVLSPDPFPRRPQLQEACSVAWPPGRAWIMCCLPSPQLDYRDIGIDPQLHDGPLVGRPYPPVFLTQHVDPVRRFLLVSVHGLVLLELQTPLMRLAGLL-AANQPDSRPVTDWFAHFGPEESSCVCLILACCDSDDLVRERALAAVMLHGTAAAVRDAAMAASIDCQTPVPSSAAAADPSANALLSGLSRYAARVLLPLW------YSPIVSERRGCFLVSRLESDELGWFSSHLTHLFRFVQSNLAQLSASARGRVEAE---SQQRAYKLLQLISTNLELLNLWKLLAEHQFYLVARRLTEDERAHLRGTRFRDLLLAKNRLLLNRLIACLLEHYLADSASVDSISNKLQEACSSLYTPQDALCAKANEML---------QAAAGEPLD-RRTSLLAEAGRLYREAGTSVSLADVLPRLEALQAYETMAGLCLALAKQWDPQDRALHFTREGRKPHTEADADAVAGRHGCYQALLDICTRLRRAATGAGAATVPVAVTPRPVGVSPHSSAAAAAAAAAAAVVSQSPAKAQQGQHEMARVLDNVIRVTL--NSDDMLAHYEMFNWLSQHGMTEQMLSHDSAHLESYLRNRLRKTPEDQQLRELLCRHLKRCGKVLEAARILEHLAVAACDTADLAQRQAYLAQAIVDAKSRPGEGIG---ELLQQLEDELDTATVQAAVLEELQQRYPQSAASPEMAEAVRRLNGQLFPLTELYAEFAAPLRLPLAKLRIVASAGHRDQALVNQLWEELLDREL 1164          
BLAST of nuclear pore complex protein Nup155 vs. TrEMBL
Match: A0A267DGY1 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004589g3 PE=4 SV=1)

HSP 1 Score: 490.345 bits (1261), Expect = 1.025e-149
Identity = 336/1048 (32.06%), Postives = 538/1048 (51.34%), Query Frame = 1
Query:   64 EKILNILESQLFKEKNIHNLVDQLHIQQNHVSVSGHKDSDYPDVGINISSNIRISKTSEMPKELQERTRDMKQNCLIGVFKDIERIWVTVDTDLFIWNYENGSDLAYYDGCCDTILAVELIKPKQKVFNTCIHYLLILAGQVEILVMGVSIRGYKNNTLELLPEPLFKIATENEHITAIQD--INGRIVLGTKSGNVLEISYWSEKPSWFKFGQSAVYSNIKYSHENDYKLCARLLNHSTWKLSVLLPNIIVNGLMINEPIVQITADPSRNVFYTRSDNSLIAQYQLLPNDG---LQRLNYVTEDSFVSKAYKSVKSVEKHQFKNIVELCPLGEGYGS-LQLMAITQSGVRLYFMDNLQLCHVRMPPISQSSMFGKITNVRLCCESRGSVLMICGSSIDNQALYTISPDAFV-LPELVETVSMSWAQGSSWFLMPLDRN---------DNKWHAHPVIQ--------TQHLDPLRRFLMVSVENIIQLELPSPIDYLREILEKCSSPQSPAIKSWINHYGPEETIYAALVIASDKRSSFVASRAIEVVLYYLNEIIKARSMASQSLN---------RASYDIGNPLHQVLCMYAARILRPLWDNCIGEYSKLIQQE--THINSTHDSEELTWFLHHLNHLIDFIRDNYPRLKSIDLMRLSNSPVAPVSFALELSELLKTTVEIVGLWRMITEHQFHQIIKLLSPEMQNELLRCPVKQXXXXXXXXXXXXXXXXXXQHYSDDGASTEMVIEALLRICPNLYRKEDAICSRANEILLNVDSLNISKSQEPEILEQKKEHLLINAIQLYEQVGPGIDLGSVIFRLKSVGCTWGAVHLCLHAAKLRDPQDYAIRALKEGLRPHASVEINAIEGRSDAYKYLLECLSNL---------------LEMSKFNVSNNISSKIGIIRDIRNLFPNNEIR----NHALTDL--NVILKTIFDRKDDIMVHFEVYSWMIENDLINQILDFNSEHLESFLQQRLMTDPQNIDAKNLLWKHYEMQGRLLEAARVLDDLAVTECENFGLDERLGCISRAIV 3039
            E+ L  LE  +  E++  +L   L    + V++SG   + YP         + IS+ + +P EL E+   M+ NCL+GVF +  R W+TVD + F+WNYE+GSDLAYYDG  D I+AV  ++P++ VF   +H+LL LA  +E+ V+GVS   Y++  + LL EPL ++ T+ + +T I+     GR+  GT+SG +LE++Y   +  W   GQ              Y +  RL+NHS   LS L+P+ I +    ++PI Q+  D SR + YTRS  S +  Y L    G    +R+  +      + A +    V++    +IV L PL   + + L LMA+T SGVR YF   L+L HVR+ P+  S    ++ ++RL  ESRG+VLM+     D   LY +SPD F   P+L E  S++W  G +W +  L            D + H  P++         TQH+DP+RRFL+VSV  ++ LEL +P+  L  +L   + P S  +  W  H+GPEE+    L++A       V  RA+  V+ +        +  + S++          A+    N L   L  YAAR+L PLW      YS ++ +     + S  +S+EL WF  HL HL  F++ N  +L +    R+          A +L +L+ T +E++ LW+++ EHQF+ + + L+ + +  L     + LLL   R LL  LI  LL+HY  D AS + +   L   C +LY  +DA+C++ANE+L         ++   E L+ ++  LL  A +LY + G  + L  V+ RL+++        LCL  AK  DPQD A+   +EG +PH   + +A+ GR   Y+ LL+  + L               +      VS + S+          +   +  +     H +  +  NVI  T+    DD++ H+E+++W+ ++ +  Q+L  +S HLES+L+ RL   P++   + LL +H +  G++LEAAR+L+ LAV  C+   L +R   +++AIV
Sbjct:   57 EEGLQFLEPFVQSERSYPDLATLLGGVGDRVTMSGTDVAAYPPSPNGSGGEVSISRVTPLPGELMEKLGAMQTNCLMGVFPEASRAWLTVDNEFFLWNYEDGSDLAYYDGLQDAIVAVGFVQPRRDVFADEVHHLLCLATPLELAVLGVS---YQSGQVHLLAEPLLRLPTDGQVVTCIEGSRSTGRLFAGTQSGCLLEVAYEERRVGWLS-GQ--------------YTVQGRLINHSVSSLSRLVPSFISSLAAADDPICQVCVDDSRRLVYTRSQESTVFAYALSAEAGDTAARRVAALRGSDLAAHAARIAHMVDRSCLTDIVHLSPLTAQHSAMLYLMAVTGSGVRFYFDARLRLAHVRLGPMCPS--LPRLADIRLATESRGTVLMLASRGEDRDTLYVLSPDPFPRRPQLQEACSVAWPPGRAWIMCCLPSPQLDYRDIGIDPQLHDGPLVGRPYPPVFLTQHVDPVRRFLLVSVHGLVLLELQTPLMRLAGLL-AANQPDSRPVTDWFAHFGPEESSCVCLILACCDSDDLVRERALAAVMLHGTAAAVRDAAMAASIDCQTPVPSSAAAADPSANALLSGLSRYAARVLLPLW------YSPIVSERRGCFLVSRLESDELGWFSSHLTHLFRFVQSNLAQLSASARGRVE---AESQQRAYKLLQLISTNLELLNLWKLLAEHQFYLVARRLTEDERAHLRGTRFRDLLLAKNRLLLNRLIACLLEHYLADSASVDSISNKLQEACSSLYTPQDALCAKANEML---------QAAAGEPLD-RRTSLLAEAGRLYREAGTSVSLADVLPRLEALQAYETMAGLCLALAKQWDPQDRALHFTREGRKPHTEADADAVAGRHGCYQALLDICTRLRRAATGAGAATVPVAVTPRPVGVSPHSSAAAAAAAAAAAVVSQSPAKAQQGQHEMARVLDNVIRVTL--NSDDMLAHYEMFNWLSQHGMTEQMLSHDSAHLESYLRNRLRKTPEDQQLRELLCRHLKRCGKVLEAARILEHLAVAACDTADLAQRQAYLAQAIV 1062          
BLAST of nuclear pore complex protein Nup155 vs. TrEMBL
Match: A0A1A8HN61 (Nucleoporin 155 OS=Nothobranchius kuhntae OX=321403 GN=NUP155 PE=4 SV=1)

HSP 1 Score: 466.848 bits (1200), Expect = 1.869e-138
Identity = 387/1361 (28.43%), Postives = 643/1361 (47.24%), Query Frame = 1
Query:  148 NHVSVSGHKDSDYPDVGINISSNIRISKTSEM-----PKELQERTRDMKQNCLIGVFKDIERIWVTVDTDLFIWNYENGSDLAYYDGCCDTILAVELIKPKQKVFNTCIHYLLILAGQVEILVMGVS-------IRGYKNNTLELLPEPLFKIATENEHITAIQDIN-GRIVLGTKSGNVLEISYWSEKPSWFKFGQSAVYSNIKYSHENDYKLCARLLNHSTWKLSVLLPNIIVNGLMINEPIVQITADPSRNVFYTRSDNSLIAQYQLLPN-DGLQRLNYVTEDSFVSKAYKSVKSVEKHQFKNIVELCPLGEGYGS-LQLMAITQSGVRLYFMDN----------------LQLCHVRMPP-ISQSSMFGKITNVRLCCESRGSVLMICGSSIDNQALYTISPDAFVLPE-LVETVSMSWAQGSSW------------FLMPLDRNDNKWHAHPVIQTQHLDPLRRFLMVSVENIIQLELPSPIDYLREILEKCSSPQSPAIKSWINHYGPEETIYAALVI-----ASDKRSSFVASRAI-----EVVLYYLNEIIKARS----MASQSLNRASYDIGNPL------------------------HQVLCMYAARILRPLWDNCIG---EYSKLIQQETHINSTHDSEELTWFLHHLNHLIDFIRDNYPRLKS-----------------IDLMRLSNSPVAPVSFALE-----------------LSELLKTTVEIVGLWRMITEHQFHQIIKLLSPEMQNELLRCPVKQXXXXXXXXXXXXXXXXXXQHYSDDGASTEMVIEALLRICPNLYRKEDAICSRANEILLNVDSLNISKSQEPEILEQKKEHLLINAIQLYEQVGPGIDLGSVIFRLKSVGCTWGAVHLCLHAAKLRDPQDYAIRALKEGLRPHASVEINAIEGRSDAYKYLLECLSNLLEMSKFNV-SNNISSKIG--IIRDIRNLFPNNEIRNHALTDLNVILKTIFDRKDDIMVHFEVYSWMIENDLINQILDFNSEHLESFLQQRLMTDPQNIDAKNLLWKHYEMQGRLLEAARVLDDLAVTECENFGLDERLGCISRAIVFVRAVIGGNEHF-EVDYLKELEDKVDLFHLQKVIIEEI------GNTSEKSIIDLNSRLFKISQLLHDFAEPFDLTVSKLSILKVSGNNCPITIRMIWEELIEKEI-NRIGNIPSKETREVSLKQTIMQIACQFRDSPMYFPLDLILSHLESYCDMCDFSPDWAVCCFTAIDIPI--VKIIQAYFEVLKMKD---QDSRKHVYRVYNSMCISFDLFLRTQKNNR----ECQIFSSQFLDIVSACLIEMQSKSDPHSS--SLVEKFRSYKALLEQ 3804
            N  S+SG  D DYP  G  + +   + + S M     P EL E+   M+ NC++GVF DI R W+T+D DLF+WNYE+G D+AY+DG  +TILAV L+KPKQ +    IHYLL+LA  V+++++G+S       +    +  L+LLP+PLF I T+N +I +I   + GRI +  K G + EI+Y +E   W                    + C R +NHS   LS L+P+++      ++PIVQI  D +RN+ +TRS+  ++  Y L  +  G+ R+  +++ S V+ A    +++++  FK IV++  +     S   L+A+T SGVRLYF                   L L HVR+PP  S SS   K + V     S+G +LM    + D+  L+ I+ D+F   + L+ET  MS   G SW             L PL+R        PV+  QH  P ++F++++ +     +   P+D LR +L  C+  +S  I+ +   +  E+    AL++     A D+  S  A+RA      E  + +   +    +    M+S +          P                         H  +C+Y ARIL  +WD  +      SK  Q    + ST  S EL   L  L  L +F+  N     S                 +  MR   +    V   L+                 + +L+  + + + LW+++ +HQF  I+  L  E Q ++     K +++  K      + G +   Y  D AS + +   L  ICP LY  +D+ICS+ANE+L +      SK  + +I    KE  L  ++QLY+Q+   IDL  V  + + V    G + LCL AA  +DPQ       K G          A + R   YK + + +  L+  SK    S ++  + G  ++    N+  N E   H    L +       R  D + H  +Y+W+I+ DL +++L+ NS +LE  L   +  D   +   +LLW++YE      +AA VL  LA        L +RL  I+RAI+  ++  G +    + ++L+ELEDK++L  +Q  I E +        + + +I  L++ L  I++L  +FA+ F L+  KL+I+  +G++ PI +  +W+E++EKE+ + +   P    R ++LK  ++ +   +  +P YFPL+ ++  LE   ++C  + D      T ++I +   ++++ Y ++ K +D   Q  RK ++ V    CI   L    +  +R    + + F++  LD +   L+E+QS S P S+    +  F+S +A LE+
Sbjct:   48 NMPSLSGVSDMDYPLQGPGLLTVPNLPELSAMRRVPLPPELVEQFGHMQFNCMMGVFPDISRAWLTIDNDLFLWNYEDGGDVAYFDGLIETILAVGLVKPKQGILQPHIHYLLVLATSVDVVILGLSFPKSHVGLNDSMSGGLQLLPDPLFSIPTDNTYILSITSTDLGRIFMAGKDGCLYEIAYQAEA-GWLS------------------QRC-RKINHSKSSLSFLVPSVLQFSFSEDDPIVQIAIDNTRNILFTRSEKDVLQVYDLGADGQGMSRIATMSQSSIVAAAGNIARTIDRSVFKPIVQISVIDRSESSDCHLLAVTHSGVRLYFSTTPFAPQHQKHMAVRPSLLALVHVRLPPGFSASSTLQKPSKVHKALHSKGVLLMTASETEDSDVLWCINHDSFPFKKPLMETQVMSNVDGHSWALCEINEEKPPKILTPLNREQIPITDSPVVVQQHNVPPQKFVLLTAKGSHIFQKLRPVDQLRHLLVSCAGGESEEIERFFKLHREEQACGTALILACSSAACDREVSQWATRAFFRYGGEAQMRFPAAMTTPSTVGPVMSSPAPGVVPPAFATPFVSMQSGSAPITPMSAGPEVIFSGKHNGICIYLARILGNIWDGSLAVETTISKGHQTAVILESTVASFELESVLLQLKGLQEFLDKNSQLSPSSLGTVSFSSPANLQQRLLGFMRPDGAGSQQVQQELQRKYHTKAQVYEKVSLQGIQQLVHRSYQTLALWKLLCDHQFSLIMSELPKEFQEQIKGASFKDVVIRGKELSGALITGLINV-YIKDNASVDAISNHLRDICPLLYSSDDSICSKANEMLQS------SKQIQNKI---DKERTLRESLQLYQQISQNIDLPLVCSQYRQVRFYEGVLELCLTAADKKDPQRLGPHFYKNGEPEEDKTGQQAFQERLSCYKCITDTMQELVNQSKAAPQSPSVPKQPGPPVMTSDPNMLSNEEATAHFEQMLGLA-----QRSQDELFHIALYNWLIQADLSDKLLEVNSPYLEEHLMHMIRQDQSKVHNMDLLWRYYEKNRNFGKAAHVLARLADLHSTEISLKQRLEYIARAILSAKSSSGVSARASDGEFLRELEDKMELVRIQVQIQETLIRQYSHHPSVKNAISQLDAELMDITKLYGEFADHFKLSECKLAIIHCAGHSDPILVHSLWQEILEKELGDSVAMSPVDRMRSLNLK--LVSLGKIYAGTPRYFPLEFLVKFLEQ--EVCRLNWDVGFVSSTMLEIGVQLPRLLEVYDQLFKSRDPCWQRLRKPLHLVE---CIHVLLSGYVEDPSRVQTYDRRRFTNVCLDNICGYLVELQSLS-PTSALQQTIGNFKSLQAKLER 1365          
BLAST of nuclear pore complex protein Nup155 vs. Ensembl Cavefish
Match: nup155 (nucleoporin 155 [Source:NCBI gene;Acc:103030964])

HSP 1 Score: 448.358 bits (1152), Expect = 4.440e-135
Identity = 382/1389 (27.50%), Postives = 658/1389 (47.37%), Query Frame = 1
Query:   79 ILESQLFKEKNIHNLVDQLHI-QQNHVSVSGHKDSDYPDVGINISSNIRISKTSE-----MPKELQERTRDMKQNCLIGVFKDIERIWVTVDTDLFIWNYENGSDLAYYDGCCDTILAVELIKPKQKVFNTCIHYLLILAGQVEILVMGVS-------IRGYKNNTLELLPEPLFKIATENEHITAIQDIN-GRIVLGTKSGNVLEISYWSEKPSWFKFGQSAVYSNIKYSHENDYKLCARLLNHSTWKLSVLLPNIIVNGLMINEPIVQITADPSRNVFYTRSDNSLIAQYQLLPN-DGLQRLNYVTEDSFVSKAYKSVKSVEKHQFKNIVELCPLGEGYGS-LQLMAITQSGVRLYFMDN----------------LQLCHVRMPP-ISQSSMFGKITNVRLCCESRGSVLMICGSSIDNQALYTISPDAFVLPE-LVETVSMSWAQGSSW------------FLMPLDRNDNKWHAHPVIQTQHLDPLRRFLMVSVENIIQLELPSPIDYLREILEKCSSPQSPAIKSWINHYGPEETIYAALVI-----ASDKRSSFVASRAI-----EVVLYYLNEI----------------IKARSMASQSLNRASYDIGNPL---------------HQVLCMYAARILRPLWDNCIG---EYSKLIQQETHINSTHDSEELTWFLHHLNHLIDFIRDNYP-----------------RLKSIDLMRLSNSPVAPVSFALE-----------------LSELLKTTVEIVGLWRMITEHQFHQIIKLLSPEMQNELLRCPVKQXXXXXXXXXXXXXXXXXXQHYSDDGASTEMVIEALLRICPNLYRKEDAICSRANEILLNVDSLNISKSQEPEILEQKKEHLLINAIQLYEQVGPGIDLGSVIFRLKSVGCTWGAVHLCLHAAKLRDPQDYAIRALKEGLRPHASVEINAIEGRSDAYKYLLECLSNLLEMSKFNV-SNNISSKIG--IIRDIRNLFPNNEIRNHALTDLNVILKTIFDRKDDIMVHFEVYSWMIENDLINQILDFNSEHLESFLQQRLMTDPQNIDAKNLLWKHYEMQGRLLEAARVLDDLAVTECENFGLDERLGCISRAIV-----FVRAVIGGNEHFEVDYLKELEDKVDLFHLQKVIIEEIGN------TSEKSIIDLNSRLFKISQLLHDFAEPFDLTVSKLSILKVSGNNCPITIRMIWEELIEKEI-NRIGNIPSKETREVSLKQTIMQIACQFRDSPMYFPLDLILSHLESYCDMCDFSPDWAVCCFT--AIDIPIVKIIQAYFEVLKMKDQDSRKHVYRVYNSMCISFDLFLRTQKNNR----ECQIFSSQFLDIVSACLIEMQSKSDPHSS--SLVEKFRSYKALLEQ 3804
            +++  L +++   +L + L++   N  S+SG  D DYP  G  + S   + + S      +P EL E+   M+ NC++GVF +I R W+T+D DLF+WNYE+G D+AY+DG  +TIL+V L+KPK+ +F   IH+LL+LA  V+++++G+S       +    +  ++LLP+PL+ I T+N ++ AI   + GRI L  K G + EI+Y +E   WF                   + C R +NHS   LS L+P+++      ++P+VQI  D SRN  YTRS+  ++  Y L  +  G+ R+  ++ ++ VS A    +++++  FK IV++  +     S  QL+A+T +GVRLYF  +                L L HVR+PP  S SS   K + V     ++G +LM    + D+  L+ I+ D+F   + L+E    S   G SW             L PL+++       PV+  QH  P ++F+++S +         P+D LR +L      +S  I+ +   +  E+    AL++     A D+  S  A+RA      E  + + + +                +   S+++  +       G P+               H  + +Y ARIL  +WD  +      SK  Q    + ST  S +L   L  L  L +F+  N                   + + +  MR   +    V   L+                 + +L+  + + + LW+++ +HQF  II  L  + Q +L     K  L++  R L   L+ +L+  Y  D AS + +   L  ICP LY  +D++CS+ANE+L +  S  I    E       KE  L  ++QLY+Q+    DL  V  + + V    G V LCL AA  +DPQ       K G     +V   A + R   YK + + +  L+  SK    S ++  + G  ++    N+  N +   H    L +       R  D + H  +Y+W+I+ DL +++L+ NS +LE  L   +  D   +   +LLW++YE      +AA VL  LA        L +RL  ISRAI+        + +G +  F    L ELE+K+++  +Q  I E +        + + +I  L+S L  I++L  +FA+ F L+  KL+I+  +G++ PI +  +W+E++EKE+ + +   P+   R +SLK  ++ +   +  +P YFPL+ ++  LE   ++C  + D     FT   I + + ++++ Y ++ K +D   ++    ++   CI   L       +R    + + F++  LD +   L+E+QS S P+++   ++  F+S +A LE+
Sbjct:   24 LIDRHLQEDRCFPDLSELLNVPSHNMPSLSGVSDMDYPLQGPGLISVPNLPELSAVRRVPLPPELVEQFSHMQCNCMMGVFPEISRAWLTIDNDLFMWNYEDGGDVAYFDGLSETILSVGLVKPKEGIFQPHIHFLLVLATPVDVVILGLSFPKAHTGLNDSMSGAMQLLPDPLYSIPTDNTYMLAITSTDLGRIFLAGKDGCLYEIAYQAEA-GWFS------------------QRC-RKINHSKSSLSFLIPSLLQFSFSEDDPVVQIAIDNSRNTLYTRSEKGVLQVYDLGADGQGMSRVAAMSLNAIVSAAGNIARTIDRSVFKPIVQIAVIDRSESSDCQLLAVTHAGVRLYFSTSPFAPPNARQTTARPSLLALVHVRLPPGFSASSTLQKPSKVHKALYNKGVLLMAASETEDSDILWCINHDSFPFKKPLMEAQMTSNIDGHSWALCSIDDAKSPRILTPLNKDFIPLTDSPVVVQQHNIPPQKFVLLSAQGSHIFHKLRPVDQLRHLLVSSGGGESEEIERFFKLHREEQACATALILACSSAACDREVSVWATRAFFRYGGEAQMRFPSAMSAPSNVGPLLGSPVPGMMQPSVSTPFIPATPMTPGGPVIPTMSSGPEVLFSGKHNGIGVYFARILGNIWDGSLAMERPISKGSQTVNIMESTASSSDLEAVLLELQGLKEFLDKNSQFSPTSLGSAGFSSPANLQQRLLGFMRPDGASSQQVQQELQRKYHTEAQAYEKASLQAIQQLVHRSFQTLALWKLLCDHQFSLIISELPKDFQEQLKAISFKD-LVIRGRELTGALVTALINVYIKDSASVDAISCHLREICPLLYSSDDSVCSKANELLQS--SRQIQNKLE-------KERTLKESLQLYQQISHNADLPLVCSQYRQVRFYEGVVELCLTAADKKDPQRLGPHFYKNGEPEEDAVGQQAFQDRLSCYKCITDTMQELVNQSKAAPQSPSVPKQPGPPVMTSDPNMLSNEDAAAHFEQMLGLA-----QRSQDELFHIALYNWLIQADLTDKLLEVNSPYLEDHLMHMIKQDQSKVRNMDLLWRYYEKSRSFGKAAHVLARLADMHSTEISLKQRLEYISRAILSAKSSSCISSMGADGEF----LHELEEKMEVVRIQVQIQETLSRQYSQHPSVQGAISQLDSELMDITKLYGEFADHFRLSECKLAIIHCAGHSDPILVHSLWQEILEKELSDSVVMSPADRMRALSLK--LVSLGKLYAGTPRYFPLEFLVKFLEQ--EVCKMNWDVGFVTFTMQEIGVQLPRLLEVYDQLFKSRDPCWQRLKKPLHLVECIHVLLSGYVDDPSRVPTYDRRRFTNVCLDNICGYLVELQSLS-PNAALQEIIRNFKSLQAKLEK 1368          
BLAST of nuclear pore complex protein Nup155 vs. Ensembl Cavefish
Match: nup155 (nucleoporin 155 [Source:NCBI gene;Acc:103030964])

HSP 1 Score: 261.922 bits (668), Expect = 5.712e-71
Identity = 177/567 (31.22%), Postives = 293/567 (51.68%), Query Frame = 1
Query:   79 ILESQLFKEKNIHNLVDQLHI-QQNHVSVSGHKDSDYPDVGINISSNIRISKTS-----EMPKELQERTRDMKQNCLIGVFKDIERIWVTVDTDLFIWNYENGSDLAYYDGCCDTILAVELIKPKQKVFNTCIHYLLILAGQVEILVMGVS-------IRGYKNNTLELLPEPLFKIATENEHITAIQDIN-GRIVLGTKSGNVLEISYWSEKPSWFKFGQSAVYSNIKYSHENDYKLCARLLNHSTWKLSVLLPNIIVNGLMINEPIVQITADPSRNVFYTRSDNSLIAQYQLLPN-DGLQRLNYVTEDSFVSKAYKSVKSVEKHQFKNIVELCPLGEGYGS-LQLMAITQSGVRLYFMDN----------------LQLCHVRMPP-ISQSSMFGKITNVRLCCESRGSVLMICGSSIDNQALYTISPDAFVLPE-LVETVSMSWAQGSSW------------FLMPLDRNDNKWHAHPVIQTQHLDPLRRFLMVSVENIIQLELPSPIDYLREILEKCSSPQSPAIKSWINHYGPEETIYAALVI-----ASDKRSSFVASRAI 1626
            +++  L +++   +L + L++   N  S+SG  D DYP  G  + S   + + S      +P EL E+   M+ NC++GVF +I R W+T+D DLF+WNYE+G D+AY+DG  +TIL+V L+KPK+ +F   IH+LL+LA  V+++++G+S       +    +  ++LLP+PL+ I T+N ++ AI   + GRI L  K G + EI+Y +E   WF                   + C R +NHS   LS L+P+++      ++P+VQI  D SRN  YTRS+  ++  Y L  +  G+ R+  ++ ++ VS A    +++++  FK IV++  +     S  QL+A+T +GVRLYF  +                L L HVR+PP  S SS   K + V     ++G +LM    + D+  L+ I+ D+F   + L+E    S   G SW             L PL+++       PV+  QH  P ++F+++S +         P+D LR +L      +S  I+ +   +  E+    AL++     A D+  S  A+RA 
Sbjct:   24 LIDRHLQEDRCFPDLSELLNVPSHNMPSLSGVSDMDYPLQGPGLISVPNLPELSAVRRVPLPPELVEQFSHMQCNCMMGVFPEISRAWLTIDNDLFMWNYEDGGDVAYFDGLSETILSVGLVKPKEGIFQPHIHFLLVLATPVDVVILGLSFPKAHTGLNDSMSGAMQLLPDPLYSIPTDNTYMLAITSTDLGRIFLAGKDGCLYEIAYQAEA-GWFS------------------QRC-RKINHSKSSLSFLIPSLLQFSFSEDDPVVQIAIDNSRNTLYTRSEKGVLQVYDLGADGQGMSRVAAMSLNAIVSAAGNIARTIDRSVFKPIVQIAVIDRSESSDCQLLAVTHAGVRLYFSTSPFAPPNARQTTARPSLLALVHVRLPPGFSASSTLQKPSKVHKALYNKGVLLMAASETEDSDILWCINHDSFPFKKPLMEAQMTSNIDGHSWALCSIDDAKSPRILTPLNKDFIPLTDSPVVVQQHNIPPQKFVLLSAQGSHIFHKLRPVDQLRHLLVSSGGGESEEIERFFKLHREEQACATALILACSSAACDREVSVWATRAF 570          

HSP 2 Score: 172.17 bits (435), Expect = 7.740e-43
Identity = 140/512 (27.34%), Postives = 253/512 (49.41%), Query Frame = 1
Query: 2338 KKEHLLINAIQLYEQVGPGIDLGSVIFRLKSVGCTWGAVHLCLHAAKLRDPQDYAIRALKEGLRPHASVEINAIEGRSDAYKYLLECLSNLLEMSKFNV-SNNISSKIG--IIRDIRNLFPNNEIRNHALTDLNVILKTIFDRKDDIMVHFEVYSWMIENDLINQILDFNSEHLESFLQQRLMTDPQNIDAKNLLWKHYEMQGRLLEAARVLDDLAVTECENFGLDERLGCISRAIV-----FVRAVIGGNEHFEVDYLKELEDKVDLFHLQKVIIEEIGN------TSEKSIIDLNSRLFKISQLLHDFAEPFDLTVSKLSILKVSGNNCPITIRMIWEELIEKEI-NRIGNIPSKETREVSLKQTIMQIACQFRDSPMYFPLDLILSHLESYCDMCDFSPDWAVCCFT--AIDIPIVKIIQAYFEVLKMKDQDSRKHVYRVYNSMCISFDLFLRTQKNNR----ECQIFSSQFLDIVSACLIEMQSKSDPHSS--SLVEKFRSYKALLEQ 3804
            +KE  L  ++QLY+Q+    DL  V  + + V    G V LCL AA  +DPQ       K G     +V   A + R   YK + + +  L+  SK    S ++  + G  ++    N+  N +   H    L +       R  D + H  +Y+W+I+ DL +++L+ NS +LE  L   +  D   +   +LLW++YE      +AA VL  LA        L +RL  ISRAI+        + +G +  F    L ELE+K+++  +Q  I E +        + + +I  L+S L  I++L  +FA+ F L+  KL+I+  +G++ PI +  +W+E++EKE+ + +   P+   R +SLK  ++ +   +  +P YFPL+ ++  LE   ++C  + D     FT   I + + ++++ Y ++ K +D   ++    ++   CI   L       +R    + + F++  LD +   L+E+QS S P+++   ++  F+S +A LE+
Sbjct:  823 EKERTLKESLQLYQQISHNADLPLVCSQYRQVRFYEGVVELCLTAADKKDPQRLGPHFYKNGEPEEDAVGQQAFQDRLSCYKCITDTMQELVNQSKAAPQSPSVPKQPGPPVMTSDPNMLSNEDAAAHFEQMLGLA-----QRSQDELFHIALYNWLIQADLTDKLLEVNSPYLEDHLMHMIKQDQSKVRNMDLLWRYYEKSRSFGKAAHVLARLADMHSTEISLKQRLEYISRAILSAKSSSCISSMGADGEF----LHELEEKMEVVRIQVQIQETLSRQYSQHPSVQGAISQLDSELMDITKLYGEFADHFRLSECKLAIIHCAGHSDPILVHSLWQEILEKELSDSVVMSPADRMRALSLK--LVSLGKLYAGTPRYFPLEFLVKFLEQ--EVCKMNWDVGFVTFTMQEIGVQLPRLLEVYDQLFKSRDPCWQRLKKPLHLVECIHVLLSGYVDDPSRVPTYDRRRFTNVCLDNICGYLVELQSLS-PNAALQEIIRNFKSLQAKLEK 1320          
BLAST of nuclear pore complex protein Nup155 vs. Ensembl Cavefish
Match: nup155 (nucleoporin 155 [Source:NCBI gene;Acc:103030964])

HSP 1 Score: 261.922 bits (668), Expect = 6.356e-71
Identity = 177/567 (31.22%), Postives = 293/567 (51.68%), Query Frame = 1
Query:   79 ILESQLFKEKNIHNLVDQLHI-QQNHVSVSGHKDSDYPDVGINISSNIRISKTSE-----MPKELQERTRDMKQNCLIGVFKDIERIWVTVDTDLFIWNYENGSDLAYYDGCCDTILAVELIKPKQKVFNTCIHYLLILAGQVEILVMGVS-------IRGYKNNTLELLPEPLFKIATENEHITAIQDIN-GRIVLGTKSGNVLEISYWSEKPSWFKFGQSAVYSNIKYSHENDYKLCARLLNHSTWKLSVLLPNIIVNGLMINEPIVQITADPSRNVFYTRSDNSLIAQYQLLPND-GLQRLNYVTEDSFVSKAYKSVKSVEKHQFKNIVELCPLGEGYGS-LQLMAITQSGVRLYFMDN----------------LQLCHVRMPP-ISQSSMFGKITNVRLCCESRGSVLMICGSSIDNQALYTISPDAFVLPE-LVETVSMSWAQGSSW------------FLMPLDRNDNKWHAHPVIQTQHLDPLRRFLMVSVENIIQLELPSPIDYLREILEKCSSPQSPAIKSWINHYGPEETIYAALVI-----ASDKRSSFVASRAI 1626
            +++  L +++   +L + L++   N  S+SG  D DYP  G  + S   + + S      +P EL E+   M+ NC++GVF +I R W+T+D DLF+WNYE+G D+AY+DG  +TIL+V L+KPK+ +F   IH+LL+LA  V+++++G+S       +    +  ++LLP+PL+ I T+N ++ AI   + GRI L  K G + EI+Y +E   WF                   + C R +NHS   LS L+P+++      ++P+VQI  D SRN  YTRS+  ++  Y L  +  G+ R+  ++ ++ VS A    +++++  FK IV++  +     S  QL+A+T +GVRLYF  +                L L HVR+PP  S SS   K + V     ++G +LM    + D+  L+ I+ D+F   + L+E    S   G SW             L PL+++       PV+  QH  P ++F+++S +         P+D LR +L      +S  I+ +   +  E+    AL++     A D+  S  A+RA 
Sbjct:   24 LIDRHLQEDRCFPDLSELLNVPSHNMPSLSGVSDMDYPLQGPGLISVPNLPELSAVRRVPLPPELVEQFSHMQCNCMMGVFPEISRAWLTIDNDLFMWNYEDGGDVAYFDGLSETILSVGLVKPKEGIFQPHIHFLLVLATPVDVVILGLSFPKAHTGLNDSMSGAMQLLPDPLYSIPTDNTYMLAITSTDLGRIFLAGKDGCLYEIAYQAEA-GWFS------------------QRC-RKINHSKSSLSFLIPSLLQFSFSEDDPVVQIAIDNSRNTLYTRSEKGVLQVYDLGADGQGMSRVAAMSLNAIVSAAGNIARTIDRSVFKPIVQIAVIDRSESSDCQLLAVTHAGVRLYFSTSPFAPPNARQTTARPSLLALVHVRLPPGFSASSTLQKPSKVHKALYNKGVLLMAASETEDSDILWCINHDSFPFKKPLMEAQMTSNIDGHSWALCSIDDAKSPRILTPLNKDFIPLTDSPVVVQQHNIPPQKFVLLSAQGSHIFHKLRPVDQLRHLLVSSGGGESEEIERFFKLHREEQACATALILACSSAACDREVSVWATRAF 570          

HSP 2 Score: 209.534 bits (532), Expect = 1.981e-54
Identity = 197/754 (26.13%), Postives = 347/754 (46.02%), Query Frame = 1
Query: 1723 HQVLCMYAARILRPLWDNCIG---EYSKLIQQETHINSTHDSEELTWFLHHLNHLIDFIRDNYP-----------------RLKSIDLMRLSNSPVAPVSFALE-----------------LSELLKTTVEIVGLWRMITEHQFHQIIKLLSPEMQNELLRCPVKQXXXXXXXXXXXXXXXXXXQHYSDDGASTEMVIEALLRICPNLYRKEDAICSRANEILLNVDSLNISKSQEPEILEQKKEHLLINAIQLYEQVGPGIDLGSVIFRLKSVGCTWGAVHLCLHAAKLRDPQDYAIRALKEGLRPHASVEINAIEGRSDAYKYLLECLSNLLEMSKFNV-SNNISSKIG--IIRDIRNLFPNNEIRNHALTDLNVILKTIFDRKDDIMVHFEVYSWMIENDLINQILDFNSEHLESFLQQRLMTDPQNIDAKNLLWKHYEMQGRLLEAARVLDDLAVTECENFGLDERLGCISRAIV-----FVRAVIGGNEHFEVDYLKELEDKVDLFHLQKVIIEEIGN------TSEKSIIDLNSRLFKISQLLHDFAEPFDLTVSKLSILKVSGNNCPITIRMIWEELIEKEI-NRIGNIPSKETREVSLKQTIMQIACQFRDSPMYFPLDLILSHLESYCDMCDFSPDWAVCCFT--AIDIPIVKIIQAYFEVLKMKDQDSRKHVYRVYNSMCISFDLFLRTQKNNR----ECQIFSSQFLDIVSACLIEMQSKSDPHSS--SLVEKFRSYKALLEQ 3804
            H  + +Y ARIL  +WD  +      SK  Q    + ST  S +L   L  L  L +F+  N                   + + +  MR   +    V   L+                 + +L+  + + + LW+++ +HQF  II  L  + Q +L     K L++  +      +   +   Y  D AS + +   L  ICP LY  +D++CS+ANE+L +  S  I    E       KE  L  ++QLY+Q+    DL  V  + + V    G V LCL AA  +DPQ       K G     +V   A + R   YK + + +  L+  SK    S ++  + G  ++    N+  N +   H    L +       R  D + H  +Y+W+I+ DL +++L+ NS +LE  L   +  D   +   +LLW++YE      +AA VL  LA        L +RL  ISRAI+        + +G +  F    L ELE+K+++  +Q  I E +        + + +I  L+S L  I++L  +FA+ F L+  KL+I+  +G++ PI +  +W+E++EKE+ + +   P+   R +SLK  ++ +   +  +P YFPL+ ++  LE   ++C  + D     FT   I + + ++++ Y ++ K +D   ++    ++   CI   L       +R    + + F++  LD +   L+E+QS S P+++   ++  F+S +A LE+
Sbjct:  660 HNGIGVYFARILGNIWDGSLAMERPISKGSQTVNIMESTASSSDLEAVLLELQGLKEFLDKNSQFSPTSLGSAGFSSPANLQQRLLGFMRPDGASSQQVQQELQRKYHTEAQAYEKASLQAIQQLVHRSFQTLALWKLLCDHQFSLIISELPKDFQEQLKAISFKDLVIRGRELTGALVTALINV-YIKDSASVDAISCHLREICPLLYSSDDSVCSKANELLQS--SRQIQNKLE-------KERTLKESLQLYQQISHNADLPLVCSQYRQVRFYEGVVELCLTAADKKDPQRLGPHFYKNGEPEEDAVGQQAFQDRLSCYKCITDTMQELVNQSKAAPQSPSVPKQPGPPVMTSDPNMLSNEDAAAHFEQMLGLA-----QRSQDELFHIALYNWLIQADLTDKLLEVNSPYLEDHLMHMIKQDQSKVRNMDLLWRYYEKSRSFGKAAHVLARLADMHSTEISLKQRLEYISRAILSAKSSSCISSMGADGEF----LHELEEKMEVVRIQVQIQETLSRQYSQHPSVQGAISQLDSELMDITKLYGEFADHFRLSECKLAIIHCAGHSDPILVHSLWQEILEKELSDSVVMSPADRMRALSLK--LVSLGKLYAGTPRYFPLEFLVKFLEQ--EVCKMNWDVGFVTFTMQEIGVQLPRLLEVYDQLFKSRDPCWQRLKKPLHLVECIHVLLSGYVDDPSRVPTYDRRRFTNVCLDNICGYLVELQSLS-PNAALQEIIRNFKSLQAKLEK 1389          
BLAST of nuclear pore complex protein Nup155 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007485.1 (pep scaffold:Pmarinus_7.0:GL480651:1116:25131:-1 gene:ENSPMAG00000006720.1 transcript:ENSPMAT00000007485.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 166.007 bits (419), Expect = 1.145e-41
Identity = 122/398 (30.65%), Postives = 192/398 (48.24%), Query Frame = 1
Query:  358 YENGSDLAYYDGCCDTILAVELIKPKQKVFNTCIHYLLILAGQVEILVMGVSI-------RGYKNNTLELLPEPLFKIATENEHITAI-QDINGRIVLGTKSGNVLEISYWSEKPSWFKFGQSAVYSNIKYSHENDYKLCARLLNHSTWKLSVLLPNIIVNGLMINEPIVQITADPSRNVFYTRSDNSLIAQYQLLPND-GLQRLNYVTEDSFVSKAYKSVKSVEKHQFKNIVELCPLGEGYGSL--QLMAITQSGVRLYFM-----------DNLQLCHVRMPP-ISQSSMFGKITNVRLCCESR-GSVLMICGSSIDNQALYTISPDAFVL-PELVETVSMSWAQGSSWFL------------MPLDRNDNKWHAHPVIQTQHLDPLRRFLMVSVE 1440
            YE   DLAYYDG  + IL V L+KPK  +F   + YLL+LA  VEI+V+G+          G +   L LLPEP++ + T+N +  A+     GR+ L  + G + E+ Y +E   WF             SH        R +NHS   L  L+P+++  G    +P+VQI  D SR+V YTR++   +  + L  +  G+ R+  ++  S V+ A    +SV++  FK I+ +  + E   SL   L+A+T +GVRLYF              L L HVR+PP  S S++  +   V     SR G++L+    S D+  L+ I   ++    +L+E+     A+  +W L             PL+ +       P +  QH  P  RF+++S +
Sbjct:    1 YEQYGDLAYYDGMSEAILCVGLVKPKPGIFQPHVRYLLVLATPVEIVVLGMCAPSGAPGDGGAEGEGLLLLPEPIYSLPTDNTYFQAVCGTTTGRVFLAARDGCLYELDYQAEA-GWF-------------SHR------CRKINHSKSFLWGLMPSVLQFGFSEEDPVVQIAMDDSRHVLYTRTERGCLQVFDLGADGHGMTRVASLSHSSIVNNAAHVARSVDRSNFKPIIHISAI-EKSESLNCHLLAVTHTGVRLYFAVRPFQSTQDRPSGLSLVHVRLPPGFSASAVSQRPARVHRALYSRAGTLLLAAAESEDSDTLWCIDNASYPFRGQLMESQVTMGAEVRAWALECVGGAPPARGITPLNGDRVPHTEPPSVAVQHATPPPRFILLSAQ 377          

HSP 2 Score: 139.813 bits (351), Expect = 1.237e-33
Identity = 173/757 (22.85%), Postives = 338/757 (44.65%), Query Frame = 1
Query: 1723 HQVLCMYAARILRPLWD-NCIGEYS--KLIQQETHINSTHDSEELTWFLHHLNHLIDFIRDN------------------------YPRLKSI-------DLMRLSNSPVAPVSFA--LELSELLKTTVEIVGLWRMITEHQFHQIIKLLSPEMQNELLRCPVKQXXXXXXXXXXXXXXXXXXQHYSDDGASTEMVIEALLRICPNLYRKEDAICSRANEILLNVDSLNISKSQEPEILEQKKEHLLINAIQLYEQVGPGIDLGSVIFRLKSVGCTWGAVHLCLHAAKLRDPQDYAIRALKEGLRPHASVEINAIEGRSDAYKYLLECLSNLLEMSKFNV-SNNISSKIGIIRDIRNLFPNNEIRNHALTDLNVILKTIFDRKDDIMVHFEVYSWMIENDLINQILDFNSEHLESFLQQRLMTDPQNIDAKNLLWKHYEMQGRLLEAARVLDDLA-VTECENFGLDERLGCISRAIVFVRAVIGGNEHFEVDYLKELEDKVDL----------FHLQKVIIEEIGNTS--EKSIIDLNSRLFKISQLLHDFAEPFDLTVSKLSILKVSGNNCPITIRMIWEELIEKEINR-IGNIPSKETREVSLKQTIMQIACQFRDSPMYFPLDLILSHLESYCDMCDFSPDWAVCCFT----AIDIPIVKIIQAYFEVLKMKDQ---DSRKHVYRVYNSMCISFDLFLRTQKN--NRECQIFSSQFLDIVSACLIEMQS-KSDPHSSSLVEKFRSYKALLEQNL 3810
            H   C+Y ARIL   WD N + E++  +  +Q   ++S     +L   +  L  L++F+  +                        YPR+          ++ R  N+       A   ++  L+   ++ + LW+++ EH    +   L P++++ L +    Q L+L    +  GLI +L+  Y  D AST+ + + L   CP LY  +D  CS+ANE+L         KS++ ++   ++E  L  ++QLY  +   +DL  V  + + V    G + L L AA+  DPQ   +   K G     +    A   R + Y+ + + L  L++ S+  V S ++ S  G      +  P       A      +L+ +  R  D + H  +Y W++   L ++++  +S +L+ +L +        +   +LLW+ ++  G    AARVL  L+ ++ C       R  C    ++     +  +  FE    ++ E    +           H+QK + +  G      +++  L+S+L  +++L  DFA+P+ L+  KL+IL  + +     ++ +W +++EKE+   I   P+   R   L Q ++ +   +  +P YFPL+ ++  LE +  +C    D      T      D+P+  ++  Y +V + KD      R+ ++ +++   I  + +L+  +     E ++F++  LD+++  L+E+++ +        V  FRS +A LE+ L
Sbjct:  535 HDGTCLYLARILSNFWDGNVVLEHTIKEGNRQLITLDSAVAVAQLDDMITRLEGLVEFLDKDAQFAGPSLTSGFATSSAVPQRLLGYPRVDGGGGQHLQQEMQRKYNAEAQAHERASLQQVGSLVHHVIQTLALWKLLCEHGVPVLTAALPPDIRDTL-KAMSLQELVLRGDAVTGGLITALINRYIGDLASTDSISQHLRAACPLLYSVDDVTCSKANELL--------QKSRQ-QLGGAERERALRESLQLYRLISHQVDLPLVCSQYRHVRFYEGVLELSLGAAERLDPQGLGLHFYKNGEPSEDAQGRQAYMERLECYRCVTDMLQELVQASRAPVQSPSVPSHPGPPAAPADTSPLPST-EQAAQHYEQMLR-LAQRCTDELFHISLYEWLVAAGLPDKLVQVSSPYLQPYLVRMSSLQQDKLTYLDLLWRFHQKSGAFGAAARVLARLSDMSRCAR-----RHHCHVLLLLLPLLPLKLSA-FECSEGRDRERNAPIREHTQVARIQLHIQKTLGKSYGAYPGIAEALRQLDSQLMDVTKLYGDFADPYHLSECKLAILHCASHADTTLVQTLWRDIVEKELQESISRSPAD--RMQLLNQKLVSLGKSYSSTPQYFPLEFLVLTLEQH--VCTLGWDEGFVPHTLLQVGADLPL--LLHTYDKVFRTKDTCWYRLRQPLHLLHSIRSI-LNKYLQQPETVPPSERRLFTNTCLDLMADYLMELKAMEQSLELQQTVGSFRSLQAKLERLL 1266          
BLAST of nuclear pore complex protein Nup155 vs. Ensembl Yeast
Match: NUP157 (Subunit of the inner ring of the nuclear pore complex (NPC); contributes to NPC assembly and tethering of DNA to the nuclear periphery; both Nup170p and NUP157p are similar to human Nup155p; NUP157 has a paralog, NUP170, that arose from the whole genome duplication [Source:SGD;Acc:S000000907])

HSP 1 Score: 80.8777 bits (198), Expect = 1.018e-15
Identity = 102/464 (21.98%), Postives = 203/464 (43.75%), Query Frame = 1
Query: 2182 GASTEMVIEALLRICPNLYRKEDAICSRANEILLNVDSLNISKSQEPEILEQK-KEHLLINAIQLYEQVGPGIDL---GSVIFRLKSVGCTWGAVHLCLHAAKLRDPQDYAIRALKEGLRPHASVEINAIEGRSDAYKYLLECLSNLLEMSKFNVSNNISSKIGIIRDIRNLFPNNEIRNHALTDLNVILKTIFDRKDDIMVHFEVYSWMIENDLINQILDFNSEHLESFLQQRLMTDPQNIDAKNLLWKHYEMQGRLLEAARVLDDLAVTECENFGLDERLGCISRAIVFVRAVIGGNEHFEVDYLKE-LEDKVDLFHLQKVIIEEIGNTS-------EKSIIDLNSRLFKISQLLHDFAEPFDLTVSKLSILKVSGNNCPITIRMIWEELIEKEINRIGNIPSKETREV-------SLKQTIMQIACQFRDSPMYFPLDLILSH-LESYCDMCDFSPDWAVC 3513
            G S + ++  L     +     D +C RA E        ++  +Q+ E+++ K   + L  AI LYE+    I+L     V+  +  +      V   L  A   D  + A   +  G       ++   + R + Y  + E + ++ + +    S +I+       +I    P + ++    +   VI+ +     ++   H+  Y W++ N   + +L  +S+ +  +L++R     ++++  NLLW +   +   LEAA VL  LA ++ +   L ER+ C++RA     +    ++   +  L E + +  D+  +Q  ++  + N +       ++  + LN R+  +S L +D A+P D    KL I KVS       I+  W  L++     + N PS +   V       S+  T+++I    RD+ + FP+  +++  LES+ D    + D +VC
Sbjct:  878 GTSADYIVNVLKERFGSFCHSADILCYRAGE--------HLEAAQKFEMIDSKISRNHLDTAIDLYERCAENIELCELRRVVDIMVKLNYQPKTVGFLLRFADKIDKGNQAQEYVSRGCNTADPRKV-FYDKRINVYTLIFEIVKSVDDYTSIEQSPSIA-------NISIFSPASSLKKRVYS---VIMNS-----NNRFFHYCFYDWLVANKRQDYLLRLDSQFVLPYLKERA---EKSLEISNLLWFYLFKEEHFLEAADVLYALASSDFD-LKLSERIECLARANGLCDSSTSFDQKPALVQLSENIHELFDIASIQDDLLNLVRNETRIDEDYRKQLTLKLNGRVLPLSDLFNDCADPLDYYEIKLRIFKVSQFKDEKVIQGEWNRLLDS----MKNAPSPDVGSVGQESFLSSISNTLIRIGKTTRDTDVVFPVHFLMNKILESFIDKSS-AADGSVC 1308          

HSP 2 Score: 74.3294 bits (181), Expect = 9.019e-14
Identity = 88/359 (24.51%), Postives = 149/359 (41.50%), Query Frame = 1
Query:  196 GINISSNIRISKTSEMPKELQERTRDMKQNCLIGVFKDIERIWVTVDTDLFIWNYENGSDLAYYDGCCDTILAVELIKPKQKVFNTCIHYLLILAGQVEILVMGVSIRGYKNNTLEL-LPEPLFKIATENEHITAI--QDINGRIVL-GTKSG-NVLEISYWSEKPSWFKFGQSAVYSNIKYSHENDYKLCARLLNHSTWKLSVLLPNIIVNGLMIN----------EPIVQITADPSRNVFYTRSDNSLIAQYQLLPND--------------GLQRLNYVTEDSFVSKAYKSVKSVEKHQFKNIVELCPLGEGYGSLQLMAITQSGVRLYF--------MDNLQLCHVRMPPISQSS 1161
            G+   +  +  + + +P E+  +  + +    +G+F ++   W+T D  L +WN  N S+    D    TIL V+L+KP    F + +  LLI+A   +I ++ +S   + + T EL +     K+     +++ I   +  G+I   G   G NV E+ Y   +             N+  S  N  K+C    N +    + L+P+I    L+            E I Q+  D SR V +T S  S++  Y +  N               G+  L         ++A+K  K V        + +C   +    L L  IT +GVRLYF        + +L+L  V+ PP S SS
Sbjct:  131 GLGAFTPFQRQQVTNIPDEVLSQVSNTEIKSDMGIFLELNYCWITSDNKLILWNINNSSEYHCIDEIEHTILKVKLVKPSPNTFVSSVENLLIVATLFDIYILTIS---FNDRTHELNIFNTGLKVNVTGFNVSNIISYERTGQIFFTGATDGVNVWELQYNCSE-------------NLFNSKSN--KICLTKSNLANLLPTKLIPSIPGGKLIQKVLEGDAGTEEETISQLEVDQSRGVLHTLSTKSIVRSYLITSNGLVGPVLIDAAHIRRGMNALGVKNSPLLSNRAFKIAKIVS-------ISMCENND----LFLAVITTTGVRLYFKGSISRRSIGSLKLDSVKFPPTSISS 460          
BLAST of nuclear pore complex protein Nup155 vs. Ensembl Yeast
Match: NUP170 (Subunit of inner ring of nuclear pore complex (NPC); contributes to NPC assembly and nucleocytoplasmic transport; interacts with genomic regions that contain ribosomal protein and subtelomeric genes, where it functions in nucleosome positioning and as a repressor of transcription; both Nup170p and NUP157p are similar to human Nup155p; NUP170 has a paralog, NUP157, that arose from the whole genome duplication [Source:SGD;Acc:S000000175])

HSP 1 Score: 78.1814 bits (191), Expect = 7.414e-15
Identity = 80/346 (23.12%), Postives = 141/346 (40.75%), Query Frame = 1
Query:  241 MPKELQERTRDMKQNCLIGVFKDIERIWVTVDTDLFIWNYENGSDLAYYDGCCDTILAVELIKPKQKVFNTCIHYLLILAGQVEILVMGVSIRGYKNNTLELLPEPLFKIATENEHITA-IQDIN----------GRIVL-GTKSG-NVLEISYWSEKPSWFKFGQSAVYSNIKYSHENDYKLCARLLNHSTWKLSVLLPNIIV------------------NGLMINEPIVQITADPSRNVFYTRSDNSLIAQYQLLPN--DGLQRLNYVTEDSFVSKAYKSVKSVEKHQFKNIVELCPLG-EGYGSLQLMAITQSGVRLYF--------MDNLQLCHVRMPPIS 1152
            +P E+       +    +G+F ++ R W+T+D  L +WN  N ++    D    TI  V L++PK   F   + +LL+++  +E+ +  +S+    N           +++  N H++  +Q I+          GRI   G  SG N+ E+ Y S    WF         N K         C+++    +  LS+L  N++                   NG    E I Q+T D  R + Y+ S  S I  Y +     +G   +        +         +   ++  IV++  +  E   +L L+A+T  GVRLYF        ++ L+L  ++ PP S
Sbjct:  156 IPDEILHEFSTSQTKTDMGIFPELNRCWITIDNKLILWNINNDNEYQVVDDMKHTIQKVALVRPKPNTFVPAVKHLLLISTTMELFMFAISLDKATN-----------ELSVFNTHLSVPVQGIDVIDIVSHERSGRIFFAGQASGLNIWELHY-SGSDDWF---------NSK---------CSKVCLTKSALLSLLPTNMLSQIPGVDFIQALFEDNSNGNGGFSQETITQLTIDQQRGIIYSLSSKSTIRAYVITEKSLEGPMSIEPAYISRIIGTTTARAAPILGPKYLKIVKISSVAPEENNNLFLVALTVGGVRLYFNGSMGRFNIEALRLESIKFPPSS 471          

HSP 2 Score: 62.3882 bits (150), Expect = 4.691e-10
Identity = 94/456 (20.61%), Postives = 183/456 (40.13%), Query Frame = 1
Query: 2182 GASTEMVIEALLRICPNLYRKEDAI-------CSRANEI-LLNVDSLNISKSQEPEILEQKKEHLLINAIQLYEQVGPGIDLGSVIFRLKSVGCTWGAVHLCLHAAKLRDPQDYAIRALKEGLRPHASVEINAIEGRSDAYKYLLECLSNLLEMSKFNVSNNISSKIGIIRDIRNLFPNNEIRNHALTDLNVILKTIFDRKDDIMVHFEVYSWMIENDLINQILDFNSEHLESFLQQRLMTDPQNIDAKNLLWKHYEMQGRLLEAARVLDDLAVTECENFGLDERLGCISRAIVFVRAVIGGNEHFEVDYL-KELEDKVDLFHLQKVIIEEIGNTS-------EKSIIDLNSRLFKISQLLHDFAEPFDLTVSKLSILKVSGNNCPITIRMIWEELIEK---EINRIGNIPSKETREVSLKQTIMQIACQFRDSPMYFPLDLILSHLESYCDMCDF 3492
            GAS E    AL   C +     D +         RA EI L N DSLN        +LEQ  + L I  ++              +  + SV     ++   L+ A   D    A + +  G   +   +    + R   Y  + + L  + E+++   S+   ++I I  D       +E++    +    +      + +D + H+ +Y W++  +   ++LD  +  +  +L ++  +   ++   N+LW +Y  + +  E+A +L  LA +  +   L ER+  +SRA  F  +V   ++   +  L   ++D  ++  +Q  I+  +   +       ++ I  L+ ++   S+L +DFA P       L I K++       I   W+EL +    E N  G           L   +++I    +DS   FP+       E +  +C+F
Sbjct:  978 GASIEYTATALQERCGSFCSASDILGFRAIEHLRRAKEIGLRNYDSLNYHLKNATALLEQIVDDLSIEKLK------------EAVSMMLSVNYYPKSIEFLLNIANSMDKGKLACQYVANGFLENDDRK-QYYDKRILVYDLVFDTLIKVDELAEKKQSSKTQNQISISND-------DEVKLRQKSYEAAL------KYNDRLFHYHMYDWLVSQNREEKLLDIETPFILPYLMEKAGS---SLKISNILWVYYSRRSKFFESAEILYRLATSNFD-ITLFERIEFLSRANGFCNSVSPLSQKQRIVQLASRIQDACEVAGIQGDILSLVYTDARIDSAIKDELIKTLDGKILSTSELFNDFAVPLSYHEIALFIFKIADFRDHEVIMAKWDELFQSLRMEFNNTGKKEDSMNFINLLSNVLIKIGKNVQDSEFIFPI------FELFPIVCNF 1397          
BLAST of nuclear pore complex protein Nup155 vs. Ensembl Nematostella
Match: EDO30041 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1X3])

HSP 1 Score: 206.838 bits (525), Expect = 1.112e-56
Identity = 165/561 (29.41%), Postives = 278/561 (49.55%), Query Frame = 1
Query: 1975 LSELLKTTVEIVGLWRMITEHQFHQIIKLLSPEMQNELLRCPVKQXXXXXXXXXXXXXXXXXXQHYSDDGASTEMVIEALLRICPNLYRKEDAICSRANEILLNVDSLNISKSQEPEILEQKKEHLLINAIQLYEQVGPGIDLGSVIFRLKSVGCTWGAVHLCLHAAKLRDPQDYAIRALKEGLRPHASVEINAIEGRSDAYKYLLECLSNLLEMSKFNVSNNISSKIGIIRDIRNLFPNNEIRNHALTDLNV-----ILKTIFDRKDDIMVHFEVYSWMIENDLINQILDFNSEHLESFLQQRLMTD-PQNIDAKNLLWKHYEMQGRLLEAARVLDDLAVTECENFGLDERLGCISRAIVFVRAV-IGGNEHFEVDYLKELEDKVDLFHLQKVIIEEIGNTS--------EKSIIDLNSRLFKISQLLHDFAEPFDLTVSKLSILKVSGNNCPITIRMIWEELIEKEI---------NRIGNIPSKETREVSLKQTIMQIACQFRDSPMYFPLDLILSHLESYCDMCDFSPDWAVCCFTAIDIPIVKIIQAYFEVLKMKD 3585
            L  L+  + E++GLW++I E  F   +  + P +Q + +R    + L++N   +  GLI +L+  Y +D +ST+ + E L ++CP+LY  +DA+C++A E LL +    ++K+++         HLL +A+Q Y QV   I+L  +   L+SV    G V L L+AA  RDPQ +A+   K G  P       A+  R   YK + +CL  LL + +   S+  S  +            N     ALT ++      +  T+     D + H  +Y W+I+N L +++L+  S HLE++L+ +     P ++   +LLW+HYE       AAR+L  LA  E  +  L +RL  +SRAI+  ++  +  +   E ++L ELE+K+++  +Q  + E +            + ++  LN+RL  ++ L  ++A+ F L   KL+I+  +G+  P  I  +W E+I+KE+         +RI  I SK    V+L +T +        S  YFPL  ++  LE Y    D+ P W       I IP   +   Y  + K KD
Sbjct:   13 LKHLVDRSYEVIGLWQIICESGFESSVDQMDP-VQKDRMRYMKFKDLVINGHEVCSGLISALMNCYLEDSSSTDAISERLRQLCPSLYSSDDAVCTKAGE-LLTLAKKTVNKAEQT--------HLLKDALQCYRQVTHQINLELICSILESVRFYEGVVELALYAAHRRDPQGHALHFYKNGESPGDVQGQEAMIARHQCYKCITDCLQRLLAIRQ---SSAQSPSLPSRPGPPPTPDPN-----ALTPIDAEKYMELTLTLALSSGDELWHVSLYQWLIDNALTDRLLEIKSVHLEAYLKHKTAAQYPNDLKMLDLLWRHYEKTKNYAAAARILSKLAERESGDVSLVQRLEYLSRAIMSAKSSNLRTSSSKEGEFLHELEEKLEVARIQSQVYEALSRRHASRPSPHLQDALNQLNNRLVDVTTLYGEYADLFSLAECKLAIVHCAGHYEPTLIETLWREIIDKELKESSSSSPSDRIALISSK---MVALGRTYVH-------SERYFPLGALVLILERYSAELDWDPTWVFMTMLEIGIPFPVLHGIYDRMFKAKD 545          
BLAST of nuclear pore complex protein Nup155 vs. Ensembl Medaka
Match: nup155 (nucleoporin 155 [Source:NCBI gene;Acc:101163262])

HSP 1 Score: 440.654 bits (1132), Expect = 2.533e-132
Identity = 370/1356 (27.29%), Postives = 636/1356 (46.90%), Query Frame = 1
Query:  148 NHVSVSGHKDSDYPDVGINISSNIRISKTSEM-----PKELQERTRDMKQNCLIGVFKDIERIWVTVDTDLFIWNYENGSDLAYYDGCCDTILAVELIKPKQKVFNTCIHYLLILAGQVEILVMGVSIRGYK-------NNTLELLPEPLFKIATENEHITAIQDIN-GRIVLGTKSGNVLEISYWSEKPSWFKFGQSAVYSNIKYSHENDYKLCARLLNHSTWKLSVLLPNIIVNGLMINEPIVQITADPSRNVFYTRSDNSLIAQYQLLPN-DGLQRLNYVTEDSFVSKAYKSVKSVEKHQFKNIVELCPLGEGYGS-LQLMAITQSGVRLYFMDN----------------LQLCHVRMPP-ISQSSMFGKITNVRLCCESRGSVLMICGSSIDNQALYTISPDAFVLPE-LVETVSMSWAQGSSWFL------------MPLDRNDNKWHAHPVIQTQHLDPLRRFLMVSVENIIQLELPSPIDYLREILEKCSSPQSPAIKSWINHYGPEETIYAALVI-----ASDKRSSFVASRAI-----EVVLYYLNEIIKARS----MASQSLNRASYDIGNPL------------------------HQVLCMYAARILRPLWDNCIGEYSKLIQQETHIN---STHDSEELTWFLHHLNHLIDFIRDNYPRLKS-----------------IDLMRLSNSPVAPVSFALE-----------------LSELLKTTVEIVGLWRMITEHQFHQIIKLLSPEMQNELLRCPVKQXXXXXXXXXXXXXXXXXXQHYSDDGASTEMVIEALLRICPNLYRKEDAICSRANEILLNVDSLNISKSQEPEILEQKKEHLLINAIQLYEQVGPGIDLGSVIFRLKSVGCTWGAVHLCLHAAKLRDPQDYAIRALKEGLRPHASVEINAIEGRSDAYKYLLECLSNLLEMSKFNV-SNNISSKIG--IIRDIRNLFPNNEIRNHALTDLNVILKTIFDRKDDIMVHFEVYSWMIENDLINQILDFNSEHLESFLQQRLMTDPQNIDAKNLLWKHYEMQGRLLEAARVLDDLAVTECENFGLDERLGCISR-AIVFVRAVIGGNEHFEVDYLKELEDKVDLFHLQKVIIEEI-----GNTSEKSIID-LNSRLFKISQLLHDFAEPFDLTVSKLSILKVSGNNCPITIRMIWEELIEKEI-NRIGNIPSKETREVSLKQTIMQIACQFRDSPMYFPLDLILSHLESYCDMCDFSPDWAVCCFTAIDIPIVKIIQAYFEVLKMKDQDSRKHVYRVYNSMCISFDLFLRTQKNNR----ECQIFSSQFLDIVSACLIEMQSKSDPHSS--SLVEKFRSYKALLEQ 3804
            N  S+SG  D DYP  G  + S   + + S +     P EL E+   M+ NC++GVF +I R W+T+D D+F+WNYE+G D+AY+DG  +TILAV L+KPKQ +    IHYLL+LA  V+++++G+S    +       +  ++LLP+PLF I T+N +I +I   + GRI +  K G + EI+Y +E   W                    + C R +NHS   LS L+P+++      ++PIVQI  D SRN+ +TRS+  ++  Y L  +  G+ R+  +++ + V+ A    +++++  FK IV++  +G    S   L+A+T +GVRLYF                   L L HVR+PP  S SS   K + V     S+G +LM    + D+  L+ I+ D+F   + L+ET  MS   G SW L             PL+R        P++  QH  P ++F+++S +     +   P+D LR +L  C   +S  I+ +   +  E+    AL++     ASD+  S  A+RA      E  + +   +    +    M+S +       +  P                         H  +C+Y ARIL  +WD  +   + + +    ++   S+ D+ EL   L  LN L +F+  N     S                 +  MR   +    V   L+                 +  L+  + + + LW+++ +HQF  I+  L  E Q ++     K +++  K      + G +   Y  D AS + +   L  +CP LY  +D+ICS+ANE+L +  S  I    E       KE  L  +++ Y+Q+    DL  V  + + V    G + LCL AA  +DPQ       K G      V   A + R   YK + + +  L+  SK    S ++  + G  ++    N+  N E   H    L +       R  D + H  +Y+W+I+ DL +++L+ NS +LE  L   +  D   +   +LLW++YE      +AA VL  LA     +  L +RL  I+R  +    +        + ++L ELE+K++L  +Q  I E +      + S K++I  L+S L  I++L  +FA+ F L+  KL+I+  +G+  PI +  +W+E++EKE+ + +   P+   R ++LK  ++ +   +  +P YFPL+ ++  LE      ++   +       I + + ++++ Y ++ K +D   ++    ++   CI   L       +R    + + F++  LD +   L+E+QS S P+++   ++  F+S +A LE+
Sbjct:   49 NMPSLSGVSDMDYPLQGPGLLSVPNLPELSALRRVPLPPELVEQFSHMQFNCMMGVFPEISRAWLTIDNDIFMWNYEDGGDVAYFDGLIETILAVGLVKPKQGILQPHIHYLLVLATSVDVVILGLSFPKSQTGLNDSMSGGMQLLPDPLFSIPTDNTYILSITSTDLGRIFMAGKDGCLYEIAYQAEA-GWLS------------------QRC-RKINHSKSTLSFLVPSVLQFSFSEDDPIVQIAIDDSRNILFTRSEKGVLQVYDLGADGQGMGRVATMSQSAIVAAAGSIARTIDRSVFKPIVQISVIGRSESSDCHLLAVTHAGVRLYFTTAPFALQHQKHIAVRPSLLALVHVRLPPGFSASSTLQKPSKVHKALYSKGVLLMAASETEDSDILWCINHDSFPFKKPLMETQMMSNVDGHSWALCTISEERPQKIFTPLNREQIPITDSPLVVQQHNIPSQKFVLLSAKGSHIFQKLRPVDQLRHLLVSCVGGESEEIERFFKLHREEQACATALILACSSAASDREVSQWATRAFFRYGGEAQMRFPAAMTAPSTVGPIMSSPAPGIVPPALATPFTPMHSGSAPITPMSAGPEVIFSGKHNGICIYFARILGNIWDGSLAVENTIKKGNQAVSILVSSVDTLELESVLLELNGLQEFLDKNSQLSPSSLDAASFSSPANLQQRLLGFMRPDGASSQQVQQELQRKFHSKAQVFEKVSLQSIQHLVHRSFQTLALWKLLCDHQFSLIMAELPKEFQEQMKGASFKDVVIRGKELSGALITGLINV-YIKDNASVDAISNHLRDLCPLLYSSDDSICSKANEMLQS--SKQIQNKME-------KERTLRESLRRYQQISQHTDLALVCSQYRQVRFYEGVLELCLTAADKKDPQRLGPHFYKNGEPEEDRVGQQAFQERLLCYKCITDTMQELVNQSKAAPQSPSVPKQPGPPVMTSDPNMLSNEEATAHFEQMLGLA-----QRSQDELFHIALYNWLIQADLTDKLLEVNSPYLEEHLMHMIKQDQSKVHNMDLLWRYYEKNRNFGKAAHVLARLADMHSTDISLKQRLEYIARAILSAKSSSSISAHASDGEFLHELEEKMELVRIQVQIQETLIKQYSHHPSVKNVISQLDSELMDITKLYGEFADHFKLSECKLAIIHCAGHADPILVHSLWQEILEKELGDSVAMSPADRMRSLNLK--LVSLGKIYAGTPRYFPLEFLVKFLEQEVCRLNWDVGFVTSTMLEIGVQLPRLLEVYDQLFKTRDPCWQRLKKPLHLVECIHVLLSGYVDDPSRVPTYDRRRFTNVCLDNICGYLVELQSLS-PNATLQHIIGNFKSLQAKLEK 1366          
BLAST of nuclear pore complex protein Nup155 vs. Planmine SMEST
Match: SMESG000035494.1 (SMESG000035494.1)

HSP 1 Score: 2378.21 bits (6162), Expect = 0.000e+0
Identity = 1173/1179 (99.49%), Postives = 1175/1179 (99.66%), Query Frame = 1
Query:  274 MKQNCLIGVFKDIERIWVTVDTDLFIWNYENGSDLAYYDGCCDTILAVELIKPKQKVFNTCIHYLLILAGQVEILVMGVSIRGYKNNTLELLPEPLFKIATENEHITAIQDINGRIVLGTKSGNVLEISYWSEKPSWFKFGQSAVYSNIKYSHENDYKLCARLLNHSTWKLSVLLPNIIVNGLMINEPIVQITADPSRNVFYTRSDNSLIAQYQLLPNDGLQRLNYVTEDSFVSKAYKSVKSVEKHQFKNIVELCPLGEGYGSLQLMAITQSGVRLYFMDNLQLCHVRMPPISQSSMFGKITNVRLCCESRGSVLMICGSSIDNQALYTISPDAFVLPELVETVSMSWAQGSSWFLMPLDRNDNKWHAHPVIQTQHLDPLRRFLMVSVENIIQLELPSPIDYLREILEKCSSPQSPAIKSWINHYGPEETIYAALVIASDKRSSFVASRAIEVVLYYLNEIIKARSMASQSLNRASYDIGNPLHQVLCMYAARILRPLWDNCIGEYSKLIQQETHINSTHDSEELTWFLHHLNHLIDFIRDNYPRLKSIDLMRLSNSPVAPVSFALELSELLKTTVEIVGLWRMITEHQFHQIIKLLSPEMQNELLRCPVKQXXXXXXXXXXXXXXXXXXQHYSDDGASTEMVIEALLRICPNLYRKEDAICSRANEILLNVDSLNISKSQEPEILEQKKEHLLINAIQLYEQVGPGIDLGSVIFRLKSVGCTWGAVHLCLHAAKLRDPQDYAIRALKEGLRPHASVEINAIEGRSDAYKYLLECLSNLLEMSKFNVSNNISSKIGIIRDIRNLFPNNEIRNHALTDLNVILKTIFDRKDDIMVHFEVYSWMIENDLINQILDFNSEHLESFLQQRLMTDPQNIDAKNLLWKHYEMQGRLLEAARVLDDLAVTECENFGLDERLGCISRAIVFVRAVIGGNEHFEVDYLKELEDKVDLFHLQKVIIEEIGNTSEKSIIDLNSRLFKISQLLHDFAEPFDLTVSKLSILKVSGNNCPITIRMIWEELIEKEINRIGNIPSKETREVSLKQTIMQIACQFRDSPMYFPLDLILSHLESYCDMCDFSPDWAVCCFTAIDIPIVKIIQAYFEVLKMKDQDSRKHVYRVYNSMCISFDLFLRTQKNNRECQIFSSQFLDIVSACLIEMQSKSDPHSSSLVEKFRSYKALLEQNL 3810
            MKQNCLIGVFKDIERIWVTVDTDLFIWNYENGSDLAYYDGCCDTILAVELIKPKQ VFNTCIHYLLILAGQVEILVMGVSIRGYKNNTLELLPEPLFKIATENEHITAIQDINGRIVLGTKSGNVLEISYWSEKPSWFKFGQSAVYSNIKYSHENDYKLCARLLNHSTWKLSVLLPNIIVNGLMINEPIVQITADPSRNVFYTRSDNSLIAQYQLLPNDGLQRLNYVTEDSFVSKAYKSVKSVEKHQFKNIVELCPLGEGYGSLQLMAITQSGVRLYFMDNLQLCHVRMPPISQSSMFGKITNVRLCCESRGSVLMICGSSIDNQALYTISPDAFVLPELVETVSMSWAQGSSWFLMPLDRNDNKWHAHPVIQTQHLDPLRRFLMVSVENIIQLELPSPIDYLREILEKCSSPQSPAIKSWINHYGPEETIYAALVIASDKRSSFVASRAIEVVLYYLNEIIKARSMASQSLNRASYDIGNPLHQVLCMYAARILRPLWDNCIGEYSK IQQETHINSTHDSEELTWFLHHLNHLIDFIRDNYPRLKSIDLMRLSNSPVAPVSFALELSELLKTTVEIVGLWRMITEHQFHQIIKLLSPEMQNELLRCPVKQLLLLNKRPLLLGLIGSLLQHYSDDGASTEMVIEALLRICPNLYRKEDAICSRANEILLNVDSLN SKSQEPEILEQKKEHLLINAIQLYEQVGPGIDLGSVIFRLK+VGCTWGAVHLCLHAAKLRDPQDYAIRALKEGLRPHASVEINAIEGRSDAYKYLLECLSNLLEMSKFNVSNNISSKIGIIRDIRNLFPNNEIRNHALTDLNVILKTIFDRKDDIMVHFEVYSWMIENDLINQILDFNSEHLESFLQQRLMTDPQNIDAKNLLWKHYEMQGRLLEAARVLDDLAVTECENFGLDERLGCISRAIVFVRAVIGGNEHFEVDYLKELEDKVDLFHLQKVIIEEIGNTSEKSIIDLNSRLFKISQLLHDFAEPFDLTVSKLSILKVSGNNCPITIRMIWEELIEKEINRI NIPSKETREVSLKQTIMQIACQF+DSPMYFPLDLILSHLESYCDMCDFSPDWAVCCFTAIDIPIVKIIQAYFEVLKMKDQDSRKHVYRVYNSMCISFDLFLRTQKNNRECQIFSSQFLDIVSACLIEMQSKSDPHSSSLVEKFRSYKALLEQNL
Sbjct:    1 MKQNCLIGVFKDIERIWVTVDTDLFIWNYENGSDLAYYDGCCDTILAVELIKPKQNVFNTCIHYLLILAGQVEILVMGVSIRGYKNNTLELLPEPLFKIATENEHITAIQDINGRIVLGTKSGNVLEISYWSEKPSWFKFGQSAVYSNIKYSHENDYKLCARLLNHSTWKLSVLLPNIIVNGLMINEPIVQITADPSRNVFYTRSDNSLIAQYQLLPNDGLQRLNYVTEDSFVSKAYKSVKSVEKHQFKNIVELCPLGEGYGSLQLMAITQSGVRLYFMDNLQLCHVRMPPISQSSMFGKITNVRLCCESRGSVLMICGSSIDNQALYTISPDAFVLPELVETVSMSWAQGSSWFLMPLDRNDNKWHAHPVIQTQHLDPLRRFLMVSVENIIQLELPSPIDYLREILEKCSSPQSPAIKSWINHYGPEETIYAALVIASDKRSSFVASRAIEVVLYYLNEIIKARSMASQSLNRASYDIGNPLHQVLCMYAARILRPLWDNCIGEYSKPIQQETHINSTHDSEELTWFLHHLNHLIDFIRDNYPRLKSIDLMRLSNSPVAPVSFALELSELLKTTVEIVGLWRMITEHQFHQIIKLLSPEMQNELLRCPVKQLLLLNKRPLLLGLIGSLLQHYSDDGASTEMVIEALLRICPNLYRKEDAICSRANEILLNVDSLNNSKSQEPEILEQKKEHLLINAIQLYEQVGPGIDLGSVIFRLKAVGCTWGAVHLCLHAAKLRDPQDYAIRALKEGLRPHASVEINAIEGRSDAYKYLLECLSNLLEMSKFNVSNNISSKIGIIRDIRNLFPNNEIRNHALTDLNVILKTIFDRKDDIMVHFEVYSWMIENDLINQILDFNSEHLESFLQQRLMTDPQNIDAKNLLWKHYEMQGRLLEAARVLDDLAVTECENFGLDERLGCISRAIVFVRAVIGGNEHFEVDYLKELEDKVDLFHLQKVIIEEIGNTSEKSIIDLNSRLFKISQLLHDFAEPFDLTVSKLSILKVSGNNCPITIRMIWEELIEKEINRIDNIPSKETREVSLKQTIMQIACQFKDSPMYFPLDLILSHLESYCDMCDFSPDWAVCCFTAIDIPIVKIIQAYFEVLKMKDQDSRKHVYRVYNSMCISFDLFLRTQKNNRECQIFSSQFLDIVSACLIEMQSKSDPHSSSLVEKFRSYKALLEQNL 1179          
The following BLAST results are available for this feature:
BLAST of nuclear pore complex protein Nup155 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
NUP1551.156e-7131.70nucleoporin 155 [Source:HGNC Symbol;Acc:HGNC:8063][more]
NUP1551.200e-7131.70nucleoporin 155 [Source:HGNC Symbol;Acc:HGNC:8063][more]
NUP1554.474e-6932.27nucleoporin 155 [Source:HGNC Symbol;Acc:HGNC:8063][more]
back to top
BLAST of nuclear pore complex protein Nup155 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
npp-85.247e-3023.45Nuclear Pore complex Protein [Source:UniProtKB/Tr... [more]
npp-82.663e-1725.00Nuclear Pore complex Protein [Source:UniProtKB/Tr... [more]
npp-81.391e-1626.97Nuclear Pore complex Protein [Source:UniProtKB/Tr... [more]
back to top
BLAST of nuclear pore complex protein Nup155 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Nup1541.699e-10225.25gene:FBgn0021761 transcript:FBtr0089881[more]
Nup1541.699e-10225.25gene:FBgn0021761 transcript:FBtr0340225[more]
Nup1541.699e-10225.25gene:FBgn0021761 transcript:FBtr0340224[more]
back to top
BLAST of nuclear pore complex protein Nup155 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nup1551.377e-13227.16nucleoporin 155 [Source:ZFIN;Acc:ZDB-GENE-040426-7... [more]
nup1556.446e-8125.09nucleoporin 155 [Source:ZFIN;Acc:ZDB-GENE-040426-7... [more]
back to top
BLAST of nuclear pore complex protein Nup155 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NUP1555.625e-13627.89nucleoporin 155kDa [Source:NCBI gene;Acc:100379911... [more]
NUP1551.379e-13228.73nucleoporin 155kDa [Source:NCBI gene;Acc:100379911... [more]
NUP1556.945e-6927.19nucleoporin 155kDa [Source:NCBI gene;Acc:100379911... [more]
NUP1553.225e-6832.65nucleoporin 155kDa [Source:NCBI gene;Acc:100379911... [more]
NUP1553.846e-6832.65nucleoporin 155kDa [Source:NCBI gene;Acc:100379911... [more]
back to top
BLAST of nuclear pore complex protein Nup155 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Nup1551.185e-7131.35nucleoporin 155 [Source:MGI Symbol;Acc:MGI:2181182... [more]
Nup1551.328e-7131.35nucleoporin 155 [Source:MGI Symbol;Acc:MGI:2181182... [more]
back to top
BLAST of nuclear pore complex protein Nup155 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P37199|NU155_RAT8.695e-12726.85Nuclear pore complex protein Nup155 OS=Rattus norv... [more]
sp|Q9V463|NU154_DROME1.703e-10125.25Nuclear pore complex protein Nup154 OS=Drosophila ... [more]
sp|O75694|NU155_HUMAN5.761e-7131.70Nuclear pore complex protein Nup155 OS=Homo sapien... [more]
sp|Q99P88|NU155_MOUSE8.286e-7131.35Nuclear pore complex protein Nup155 OS=Mus musculu... [more]
sp|G0S7B6|NU170_CHATD2.206e-3821.29Nucleoporin NUP170 OS=Chaetomium thermophilum (str... [more]
back to top
BLAST of nuclear pore complex protein Nup155 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267G6972.357e-17630.21Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267FDV43.125e-17630.34Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8IEQ31.542e-16531.66Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DGY11.025e-14932.06Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1A8HN611.869e-13828.43Nucleoporin 155 OS=Nothobranchius kuhntae OX=32140... [more]
back to top
BLAST of nuclear pore complex protein Nup155 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nup1554.440e-13527.50nucleoporin 155 [Source:NCBI gene;Acc:103030964][more]
nup1555.712e-7131.22nucleoporin 155 [Source:NCBI gene;Acc:103030964][more]
nup1556.356e-7131.22nucleoporin 155 [Source:NCBI gene;Acc:103030964][more]
back to top
BLAST of nuclear pore complex protein Nup155 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000007485.11.145e-4130.65pep scaffold:Pmarinus_7.0:GL480651:1116:25131:-1 g... [more]
back to top
BLAST of nuclear pore complex protein Nup155 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
NUP1571.018e-1521.98Subunit of the inner ring of the nuclear pore comp... [more]
NUP1707.414e-1523.12Subunit of inner ring of nuclear pore complex (NPC... [more]
back to top
BLAST of nuclear pore complex protein Nup155 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO300411.112e-5629.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of nuclear pore complex protein Nup155 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nup1552.533e-13227.29nucleoporin 155 [Source:NCBI gene;Acc:101163262][more]
back to top
BLAST of nuclear pore complex protein Nup155 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000035494.10.000e+099.49SMESG000035494.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010978 ID=SMED30010978|Name=nuclear pore complex protein Nup155|organism=Schmidtea mediterranea sexual|type=transcript|length=3827bp
ATTCAATTAATTTTTCGTTCAAAGTATTTTGAAAAGATGGATGATTATAG
TAATTATTCAAATGAAAAAATTCTTAATATACTCGAAAGCCAACTTTTCA
AAGAAAAAAATATTCATAATTTAGTAGATCAGTTACATATACAACAAAAC
CATGTTTCCGTTAGTGGACATAAAGACAGTGATTACCCTGATGTGGGTAT
TAATATTAGCAGCAATATAAGAATTTCTAAAACTTCGGAAATGCCGAAAG
AACTCCAAGAAAGGACTAGAGACATGAAGCAAAATTGTTTAATAGGAGTT
TTCAAAGATATTGAGCGAATTTGGGTTACTGTTGATACAGATTTATTCAT
ATGGAATTATGAAAATGGATCTGATTTGGCATATTATGATGGCTGTTGTG
ACACTATATTAGCTGTTGAGCTAATAAAACCAAAACAAAAAGTTTTTAAT
ACTTGTATACATTACCTTCTAATTTTAGCCGGACAAGTTGAAATTCTTGT
TATGGGTGTCTCGATTCGCGGTTATAAAAATAATACATTAGAACTGCTAC
CAGAACCACTTTTCAAAATAGCAACTGAAAACGAACACATTACGGCTATT
CAAGATATAAATGGAAGAATTGTATTAGGCACCAAATCAGGAAATGTTCT
TGAAATATCTTATTGGTCCGAAAAGCCTTCTTGGTTTAAATTTGGCCAAT
CTGCTGTTTATAGCAATATCAAATATTCACATGAAAATGATTATAAACTT
TGTGCAAGGCTTCTTAATCATTCTACATGGAAATTATCAGTTTTATTACC
GAATATCATTGTTAATGGATTAATGATAAATGAGCCTATCGTTCAAATAA
CTGCTGATCCTAGTAGGAATGTTTTCTACACTCGATCAGACAATTCATTG
ATCGCACAATACCAGTTGTTACCAAATGATGGATTACAAAGACTGAATTA
TGTTACGGAAGATTCATTTGTTTCTAAGGCGTACAAAAGTGTAAAATCTG
TAGAAAAACATCAATTTAAAAACATTGTTGAATTGTGCCCTTTGGGAGAA
GGATATGGATCGCTACAATTGATGGCAATCACTCAGAGCGGAGTGCGATT
GTATTTCATGGACAACCTGCAATTGTGTCACGTGAGGATGCCACCAATCA
GTCAATCGAGCATGTTTGGCAAAATAACTAATGTCAGACTGTGCTGTGAG
AGCCGGGGCTCAGTGTTAATGATTTGCGGTTCATCAATCGATAACCAAGC
TCTGTACACTATCAGTCCTGATGCGTTTGTGCTTCCAGAGTTGGTTGAGA
CGGTCTCAATGTCTTGGGCTCAAGGCAGTTCTTGGTTTCTAATGCCATTG
GACAGGAATGACAACAAATGGCATGCTCATCCCGTGATACAGACCCAACA
TCTCGATCCGCTAAGGAGGTTCCTCATGGTTTCTGTAGAAAACATTATAC
AGCTTGAATTGCCAAGTCCAATTGATTATTTGCGGGAAATTCTCGAGAAA
TGTTCATCGCCTCAATCGCCAGCAATTAAGTCGTGGATCAATCACTACGG
ACCGGAGGAAACGATTTATGCTGCTTTGGTAATTGCCAGTGATAAAAGAA
GTTCTTTCGTTGCTTCTAGGGCTATTGAAGTCGTGCTTTATTATCTCAAT
GAGATCATTAAAGCCAGATCAATGGCATCGCAAAGCTTGAATAGAGCGAG
TTATGATATAGGCAATCCTCTCCATCAAGTGCTTTGCATGTATGCAGCAC
GGATTTTACGGCCGCTCTGGGACAATTGTATCGGTGAATATTCTAAACTC
ATTCAGCAAGAGACACATATCAATAGTACGCATGACAGTGAAGAGTTGAC
ATGGTTTCTACACCATTTAAACCACCTGATTGATTTCATTCGTGATAATT
ACCCAAGACTAAAATCTATCGATTTGATGAGGTTATCCAATTCACCGGTT
GCTCCTGTTTCTTTTGCACTGGAATTGTCAGAGCTGCTCAAAACCACCGT
AGAAATCGTCGGATTATGGAGAATGATTACCGAGCATCAGTTTCACCAGA
TAATCAAATTACTGAGTCCAGAAATGCAGAATGAACTATTGCGTTGTCCC
GTCAAACAGTTGCTTTTGCTAAACAAAAGACCTTTGCTGTTGGGATTGAT
TGGCTCTCTGTTGCAGCATTACAGTGATGATGGTGCATCAACTGAAATGG
TGATTGAAGCCCTGTTAAGGATCTGTCCCAATCTCTACCGAAAAGAGGAT
GCCATATGTTCTCGAGCCAATGAGATATTGTTAAATGTCGATAGTCTAAA
TATTTCCAAATCACAAGAACCGGAAATACTCGAACAGAAAAAAGAACACC
TACTAATTAACGCAATCCAACTTTATGAGCAAGTCGGTCCTGGAATCGAT
TTAGGAAGTGTTATATTCCGATTGAAATCCGTCGGTTGCACCTGGGGAGC
TGTCCATTTATGCTTGCATGCTGCCAAGCTACGGGATCCACAAGATTATG
CAATTAGAGCATTGAAAGAAGGCCTGAGGCCGCACGCATCAGTGGAAATA
AACGCTATTGAAGGAAGGAGTGACGCTTACAAATACTTGCTTGAATGCCT
GTCTAATCTCCTTGAGATGAGTAAATTTAACGTTTCGAATAATATCTCCT
CGAAAATCGGCATTATTCGAGATATTCGCAATTTATTCCCAAACAATGAA
ATTAGAAATCACGCATTGACCGATCTTAATGTTATTCTTAAAACGATTTT
CGATCGAAAAGATGACATTATGGTCCATTTTGAAGTTTACTCGTGGATGA
TTGAAAACGATTTAATCAATCAAATTCTCGACTTCAACAGTGAACACTTG
GAATCGTTTTTGCAACAACGGCTTATGACAGATCCACAGAATATTGACGC
AAAGAATCTATTATGGAAACATTATGAAATGCAAGGTCGACTATTGGAAG
CTGCCCGAGTGTTGGATGATTTAGCGGTTACAGAATGCGAAAATTTCGGT
TTAGACGAAAGATTGGGTTGTATTAGTCGTGCAATTGTATTTGTTCGAGC
AGTAATTGGCGGAAATGAGCATTTCGAAGTCGACTACTTGAAGGAATTAG
AAGACAAAGTCGATTTATTCCATTTGCAGAAAGTGATTATTGAAGAAATT
GGGAATACTAGTGAAAAATCGATTATTGATTTGAACAGTCGTTTGTTTAA
AATCTCTCAGTTGTTGCACGACTTCGCTGAGCCGTTCGATTTGACGGTTT
CGAAATTGTCCATACTAAAAGTCAGCGGCAACAATTGTCCGATTACAATC
AGAATGATATGGGAGGAATTGATCGAGAAAGAAATCAATAGAATAGGCAA
TATTCCCTCTAAAGAAACTCGAGAGGTCAGCTTGAAGCAAACAATAATGC
AAATCGCGTGTCAGTTCAGGGATTCACCGATGTATTTTCCTCTCGATTTA
ATTTTAAGCCATTTGGAGTCGTATTGTGACATGTGTGACTTCTCACCGGA
TTGGGCGGTTTGTTGTTTCACTGCAATTGATATTCCTATTGTTAAAATCA
TCCAAGCATACTTTGAGGTCCTTAAAATGAAGGATCAGGATTCTCGGAAA
CACGTCTATCGAGTCTATAATTCCATGTGCATTTCATTTGATCTGTTTCT
GCGCACCCAGAAGAACAATCGAGAATGCCAAATTTTTTCCAGTCAATTTC
TCGATATCGTTTCTGCATGTTTGATTGAAATGCAAAGCAAGTCAGATCCG
CATTCGAGTTCCCTGGTGGAGAAATTTAGATCATATAAAGCATTGCTGGA
GCAAAATTTATAAATGAAAATATATGT
back to top

protein sequence of SMED30010978-orf-1

>SMED30010978-orf-1 ID=SMED30010978-orf-1|Name=SMED30010978-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1271bp
IQLIFRSKYFEKMDDYSNYSNEKILNILESQLFKEKNIHNLVDQLHIQQN
HVSVSGHKDSDYPDVGINISSNIRISKTSEMPKELQERTRDMKQNCLIGV
FKDIERIWVTVDTDLFIWNYENGSDLAYYDGCCDTILAVELIKPKQKVFN
TCIHYLLILAGQVEILVMGVSIRGYKNNTLELLPEPLFKIATENEHITAI
QDINGRIVLGTKSGNVLEISYWSEKPSWFKFGQSAVYSNIKYSHENDYKL
CARLLNHSTWKLSVLLPNIIVNGLMINEPIVQITADPSRNVFYTRSDNSL
IAQYQLLPNDGLQRLNYVTEDSFVSKAYKSVKSVEKHQFKNIVELCPLGE
GYGSLQLMAITQSGVRLYFMDNLQLCHVRMPPISQSSMFGKITNVRLCCE
SRGSVLMICGSSIDNQALYTISPDAFVLPELVETVSMSWAQGSSWFLMPL
DRNDNKWHAHPVIQTQHLDPLRRFLMVSVENIIQLELPSPIDYLREILEK
CSSPQSPAIKSWINHYGPEETIYAALVIASDKRSSFVASRAIEVVLYYLN
EIIKARSMASQSLNRASYDIGNPLHQVLCMYAARILRPLWDNCIGEYSKL
IQQETHINSTHDSEELTWFLHHLNHLIDFIRDNYPRLKSIDLMRLSNSPV
APVSFALELSELLKTTVEIVGLWRMITEHQFHQIIKLLSPEMQNELLRCP
VKQLLLLNKRPLLLGLIGSLLQHYSDDGASTEMVIEALLRICPNLYRKED
AICSRANEILLNVDSLNISKSQEPEILEQKKEHLLINAIQLYEQVGPGID
LGSVIFRLKSVGCTWGAVHLCLHAAKLRDPQDYAIRALKEGLRPHASVEI
NAIEGRSDAYKYLLECLSNLLEMSKFNVSNNISSKIGIIRDIRNLFPNNE
IRNHALTDLNVILKTIFDRKDDIMVHFEVYSWMIENDLINQILDFNSEHL
ESFLQQRLMTDPQNIDAKNLLWKHYEMQGRLLEAARVLDDLAVTECENFG
LDERLGCISRAIVFVRAVIGGNEHFEVDYLKELEDKVDLFHLQKVIIEEI
GNTSEKSIIDLNSRLFKISQLLHDFAEPFDLTVSKLSILKVSGNNCPITI
RMIWEELIEKEINRIGNIPSKETREVSLKQTIMQIACQFRDSPMYFPLDL
ILSHLESYCDMCDFSPDWAVCCFTAIDIPIVKIIQAYFEVLKMKDQDSRK
HVYRVYNSMCISFDLFLRTQKNNRECQIFSSQFLDIVSACLIEMQSKSDP
HSSSLVEKFRSYKALLEQNL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR042533Nucleoporin_Nup155_C_1
IPR042537Nucleoporin_Nup155_C_2
IPR042538Nucleoporin_Nup155_C_3
IPR004870Nucleoporin_Nup155
IPR014908Nucleoporin_Nup133/Nup155_N
IPR007187Nucleoporin_Nup133/Nup155_C
Vocabulary: cellular component
TermDefinition
GO:0005643nuclear pore
Vocabulary: biological process
TermDefinition
GO:0006913nucleocytoplasmic transport
Vocabulary: molecular function
TermDefinition
GO:0017056structural constituent of nuclear pore
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.58.1780coord: 456..709
e-value: 5.8E-18
score: 67.5
IPR014908Nucleoporin, Nup133/Nup155-like, N-terminalPFAMPF08801Nucleoporin_Ncoord: 61..421
e-value: 1.5E-43
score: 149.2
IPR042533Nucleoporin, Nup155-like, C-terminal, subdomain 1GENE3DG3DSA:1.25.40.450coord: 750..925
e-value: 2.6E-8
score: 35.9
IPR042537Nucleoporin, Nup155-like, C-terminal, subdomain 2GENE3DG3DSA:1.25.40.440coord: 927..1002
e-value: 9.7E-12
score: 46.8
IPR042538Nucleoporin, Nup155-like, C-terminal, subdomain 3GENE3DG3DSA:1.20.120.1880coord: 1018..1245
e-value: 4.5E-17
score: 63.8
IPR007187Nucleoporin, Nup133/Nup155-like, C-terminalPFAMPF03177Nucleoporin_Ccoord: 605..1046
e-value: 3.0E-13
score: 49.4
IPR004870Nucleoporin, Nup155-likePANTHERPTHR10350NUCLEAR PORE COMPLEX PROTEIN NUP155coord: 27..1254