60S ribosomal protein L6

Overview
Name60S ribosomal protein L6
Smed IDSMED30010969
Length (bp)1851
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 60S ribosomal protein L6 (SMED30010969) t-SNE clustered cells

Violin plots show distribution of expression levels for 60S ribosomal protein L6 (SMED30010969) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 60S ribosomal protein L6 (SMED30010969) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 60S ribosomal protein L6 (SMED30010969) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010969

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30010969SMESG000019835.1 SMESG000019834.1 SmedASXL_007005SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30010969SMESG000019835.1 dd_Smed_v4_839_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30010969SMESG000019835.1 dd_Smed_v4_839_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30010969SMESG000019835.1 dd_Smed_v4_839_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30010969SMESG000019835.1 dd_Smed_v4_839_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30010969SMESG000019835.1 dd_Smed_v4_839_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30010969SMESG000019835.1 dd_Smed_v4_839_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30010969SMESG000019835.1 dd_Smed_v4_839_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30010969SMESG000019835.1 dd_Smed_v4_839_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30010969SMESG000019835.1 dd_Smed_v4_839_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30010969SMESG000019835.1 dd_Smed_v4_839_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010969SMESG000019835.1 Contig49518newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010969SMESG000019835.1 Contig49518uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30010969SMESG000019835.1 dd_Smed_v6_839_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle progenitor cellSMED30010969SMESG000019835.1 dd_Smed_v6_839_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx progenitor cellSMED30010969SMESG000019835.1 dd_Smed_v6_839_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 60S ribosomal protein L6 vs. Ensembl Human
Match: RPL6 (ribosomal protein L6 [Source:HGNC Symbol;Acc:HGNC:10362])

HSP 1 Score: 170.629 bits (431), Expect = 9.873e-48
Identity = 99/209 (47.37%), Postives = 128/209 (61.24%), Query Frame = 2
Query:  155 LATESKTTSAVKKTTESKGKIRKS---YPVQS-QKKVSKNRKKPFSAHKKRLREKIKPGVVLILLSGIHRGKRVIFLKQLSSGLLLVTGPYKLNGCPIRRVHQKMVIATSTKLDIGELEIPDHLKDDYF----AREPQQDEKLSSDVNNIFAKSKKNYVVKEKRKEDQKKIDSQILKAIKKRDDKATFSKYLKTSFSLSSHDYPHKMEF 757
            LAT +K     K       K+RK    YP +   +K+  + KKPFS H ++LR  I PG +LI+L+G HRGKRV+FLKQL+SGLLLVTGP  LN  P+RR HQK VIATSTK+DI  ++IP HL D YF     R+P+  E        IF   K+ Y + E+RK DQK +DSQIL  IK          YL++ F+L++  YPHK+ F
Sbjct:   89 LATVTKPVGGDKNGGTRVVKLRKMPRYYPTEDVPRKLLSHGKKPFSQHVRKLRASITPGTILIILTGRHRGKRVVFLKQLASGLLLVTGPLVLNRVPLRRTHQKFVIATSTKIDISNVKIPKHLTDAYFKKKKLRKPRHQE------GEIFDTEKEKYEITEQRKIDQKAVDSQILPKIKAIPQ---LQGYLRSVFALTNGIYPHKLVF 288          
BLAST of 60S ribosomal protein L6 vs. Ensembl Human
Match: RPL6 (ribosomal protein L6 [Source:HGNC Symbol;Acc:HGNC:10362])

HSP 1 Score: 170.629 bits (431), Expect = 9.873e-48
Identity = 99/209 (47.37%), Postives = 128/209 (61.24%), Query Frame = 2
Query:  155 LATESKTTSAVKKTTESKGKIRKS---YPVQS-QKKVSKNRKKPFSAHKKRLREKIKPGVVLILLSGIHRGKRVIFLKQLSSGLLLVTGPYKLNGCPIRRVHQKMVIATSTKLDIGELEIPDHLKDDYF----AREPQQDEKLSSDVNNIFAKSKKNYVVKEKRKEDQKKIDSQILKAIKKRDDKATFSKYLKTSFSLSSHDYPHKMEF 757
            LAT +K     K       K+RK    YP +   +K+  + KKPFS H ++LR  I PG +LI+L+G HRGKRV+FLKQL+SGLLLVTGP  LN  P+RR HQK VIATSTK+DI  ++IP HL D YF     R+P+  E        IF   K+ Y + E+RK DQK +DSQIL  IK          YL++ F+L++  YPHK+ F
Sbjct:   89 LATVTKPVGGDKNGGTRVVKLRKMPRYYPTEDVPRKLLSHGKKPFSQHVRKLRASITPGTILIILTGRHRGKRVVFLKQLASGLLLVTGPLVLNRVPLRRTHQKFVIATSTKIDISNVKIPKHLTDAYFKKKKLRKPRHQE------GEIFDTEKEKYEITEQRKIDQKAVDSQILPKIKAIPQ---LQGYLRSVFALTNGIYPHKLVF 288          
BLAST of 60S ribosomal protein L6 vs. Ensembl Human
Match: RPL6 (ribosomal protein L6 [Source:HGNC Symbol;Acc:HGNC:10362])

HSP 1 Score: 70.0922 bits (170), Expect = 1.609e-14
Identity = 34/61 (55.74%), Postives = 46/61 (75.41%), Query Frame = 2
Query:  221 KSYPVQS-QKKVSKNRKKPFSAHKKRLREKIKPGVVLILLSGIHRGKRVIFLKQLSSGLLL 400
            + YP +   +K+  + KKPFS H ++LR  I PG +LI+L+G HRGKRV+FLKQL+SGLLL
Sbjct:    3 RYYPTEDVPRKLLSHGKKPFSQHVRKLRASITPGTILIILTGRHRGKRVVFLKQLASGLLL 63          
BLAST of 60S ribosomal protein L6 vs. Ensembl Human
Match: PSMD9 (proteasome 26S subunit, non-ATPase 9 [Source:HGNC Symbol;Acc:HGNC:9567])

HSP 1 Score: 41.5874 bits (96), Expect = 1.360e-7
Identity = 18/41 (43.90%), Postives = 28/41 (68.29%), Query Frame = -1
Query: 1690 NYFNCQV*QGVGVTGPLIDSEGFPLNNVDLFSIREARLKHN 1812
            NY   +  +G+G+  PL+D EG+P ++VDL+ +R AR  HN
Sbjct:   40 NYDVLESQKGIGMNEPLVDCEGYPRSDVDLYQVRTAR--HN 78          

HSP 2 Score: 34.6538 bits (78), Expect = 1.360e-7
Identity = 22/72 (30.56%), Postives = 37/72 (51.39%), Query Frame = -3
Query: 1430 LQNDLRAIMLDIESKLHEIHALNIRTEANNPIDNSGEIVHTETGNDGSAIFIARHPP--FARVSRVDQASVA 1639
            LQND +A+M  +E  LH++HA +   +A +  +   E +  + G   S     + PP  FA+V+ +   S A
Sbjct:   82 LQNDHKAVMKQVEEALHQLHARDKEKQARDMAEAHKEAMSRKLGQSES-----QGPPRAFAKVNSISPGSPA 148          
BLAST of 60S ribosomal protein L6 vs. Ensembl Human
Match: PSMD9 (proteasome 26S subunit, non-ATPase 9 [Source:HGNC Symbol;Acc:HGNC:9567])

HSP 1 Score: 41.5874 bits (96), Expect = 1.774e-7
Identity = 18/41 (43.90%), Postives = 28/41 (68.29%), Query Frame = -1
Query: 1690 NYFNCQV*QGVGVTGPLIDSEGFPLNNVDLFSIREARLKHN 1812
            NY   +  +G+G+  PL+D EG+P ++VDL+ +R AR  HN
Sbjct:   40 NYDVLESQKGIGMNEPLVDCEGYPRSDVDLYQVRTAR--HN 78          

HSP 2 Score: 34.6538 bits (78), Expect = 1.774e-7
Identity = 22/72 (30.56%), Postives = 37/72 (51.39%), Query Frame = -3
Query: 1430 LQNDLRAIMLDIESKLHEIHALNIRTEANNPIDNSGEIVHTETGNDGSAIFIARHPP--FARVSRVDQASVA 1639
            LQND +A+M  +E  LH++HA +   +A +  +   E +  + G   S     + PP  FA+V+ +   S A
Sbjct:   82 LQNDHKAVMKQVEEALHQLHARDKEKQARDMAEAHKEAMSRKLGQSES-----QGPPRAFAKVNSISPGSPA 148          
BLAST of 60S ribosomal protein L6 vs. Ensembl Celegans
Match: rpl-6 (60S ribosomal protein L6 [Source:UniProtKB/Swiss-Prot;Acc:P47991])

HSP 1 Score: 158.688 bits (400), Expect = 9.358e-45
Identity = 84/173 (48.55%), Postives = 113/173 (65.32%), Query Frame = 2
Query:  248 KVSKNRKKPFSAHKKR--LREKIKPGVVLILLSGIHRGKRVIFLKQL-SSGLLLVTGPYKLNGCPIRRVHQKMVIATSTKLDIGELEIPDHLKDDYFAREPQQDEKLSSDVNNIFAKSKKNYVVKEKRKEDQKKIDSQILKAIKKRDDKATFSKYLKTSFSLSSHDYPHKMEF 757
            K+ +N  K    H K   LR+ + PG VLI+L+G H+GKRV+FLKQL  SGLLLVTGP+K+NG P+RR+ Q  VIATS K+++  ++IP+H+ D+YF R+    +       NIFA  K  Y V E+RK+D K +D+ IL AIKK  +      YL T FSL  + YPHKM+F
Sbjct:   49 KLQRNGTKFALGHSKTVTLRKTLTPGTVLIVLAGRHKGKRVVFLKQLPQSGLLLVTGPHKINGFPLRRIGQAFVIATSLKVNVSGVKIPEHINDEYFKRKSTAQK----TGKNIFASGKTEYTVSEQRKKDIKTVDAPILAAIKKHPEHKFLFGYLGTRFSLGKNQYPHKMQF 217          
BLAST of 60S ribosomal protein L6 vs. Ensembl Celegans
Match: rpl-6 (60S ribosomal protein L6 [Source:UniProtKB/Swiss-Prot;Acc:P47991])

HSP 1 Score: 158.688 bits (400), Expect = 9.358e-45
Identity = 84/173 (48.55%), Postives = 113/173 (65.32%), Query Frame = 2
Query:  248 KVSKNRKKPFSAHKKR--LREKIKPGVVLILLSGIHRGKRVIFLKQL-SSGLLLVTGPYKLNGCPIRRVHQKMVIATSTKLDIGELEIPDHLKDDYFAREPQQDEKLSSDVNNIFAKSKKNYVVKEKRKEDQKKIDSQILKAIKKRDDKATFSKYLKTSFSLSSHDYPHKMEF 757
            K+ +N  K    H K   LR+ + PG VLI+L+G H+GKRV+FLKQL  SGLLLVTGP+K+NG P+RR+ Q  VIATS K+++  ++IP+H+ D+YF R+    +       NIFA  K  Y V E+RK+D K +D+ IL AIKK  +      YL T FSL  + YPHKM+F
Sbjct:   49 KLQRNGTKFALGHSKTVTLRKTLTPGTVLIVLAGRHKGKRVVFLKQLPQSGLLLVTGPHKINGFPLRRIGQAFVIATSLKVNVSGVKIPEHINDEYFKRKSTAQK----TGKNIFASGKTEYTVSEQRKKDIKTVDAPILAAIKKHPEHKFLFGYLGTRFSLGKNQYPHKMQF 217          
BLAST of 60S ribosomal protein L6 vs. Ensembl Celegans
Match: rpl-6 (60S ribosomal protein L6 [Source:UniProtKB/Swiss-Prot;Acc:P47991])

HSP 1 Score: 158.688 bits (400), Expect = 9.358e-45
Identity = 84/173 (48.55%), Postives = 113/173 (65.32%), Query Frame = 2
Query:  248 KVSKNRKKPFSAHKKR--LREKIKPGVVLILLSGIHRGKRVIFLKQL-SSGLLLVTGPYKLNGCPIRRVHQKMVIATSTKLDIGELEIPDHLKDDYFAREPQQDEKLSSDVNNIFAKSKKNYVVKEKRKEDQKKIDSQILKAIKKRDDKATFSKYLKTSFSLSSHDYPHKMEF 757
            K+ +N  K    H K   LR+ + PG VLI+L+G H+GKRV+FLKQL  SGLLLVTGP+K+NG P+RR+ Q  VIATS K+++  ++IP+H+ D+YF R+    +       NIFA  K  Y V E+RK+D K +D+ IL AIKK  +      YL T FSL  + YPHKM+F
Sbjct:   49 KLQRNGTKFALGHSKTVTLRKTLTPGTVLIVLAGRHKGKRVVFLKQLPQSGLLLVTGPHKINGFPLRRIGQAFVIATSLKVNVSGVKIPEHINDEYFKRKSTAQK----TGKNIFASGKTEYTVSEQRKKDIKTVDAPILAAIKKHPEHKFLFGYLGTRFSLGKNQYPHKMQF 217          
BLAST of 60S ribosomal protein L6 vs. Ensembl Celegans
Match: rpl-6 (60S ribosomal protein L6 [Source:UniProtKB/Swiss-Prot;Acc:P47991])

HSP 1 Score: 158.688 bits (400), Expect = 9.358e-45
Identity = 84/173 (48.55%), Postives = 113/173 (65.32%), Query Frame = 2
Query:  248 KVSKNRKKPFSAHKKR--LREKIKPGVVLILLSGIHRGKRVIFLKQL-SSGLLLVTGPYKLNGCPIRRVHQKMVIATSTKLDIGELEIPDHLKDDYFAREPQQDEKLSSDVNNIFAKSKKNYVVKEKRKEDQKKIDSQILKAIKKRDDKATFSKYLKTSFSLSSHDYPHKMEF 757
            K+ +N  K    H K   LR+ + PG VLI+L+G H+GKRV+FLKQL  SGLLLVTGP+K+NG P+RR+ Q  VIATS K+++  ++IP+H+ D+YF R+    +       NIFA  K  Y V E+RK+D K +D+ IL AIKK  +      YL T FSL  + YPHKM+F
Sbjct:   49 KLQRNGTKFALGHSKTVTLRKTLTPGTVLIVLAGRHKGKRVVFLKQLPQSGLLLVTGPHKINGFPLRRIGQAFVIATSLKVNVSGVKIPEHINDEYFKRKSTAQK----TGKNIFASGKTEYTVSEQRKKDIKTVDAPILAAIKKHPEHKFLFGYLGTRFSLGKNQYPHKMQF 217          
BLAST of 60S ribosomal protein L6 vs. Ensembl Fly
Match: RpL6 (gene:FBgn0039857 transcript:FBtr0085804)

HSP 1 Score: 176.022 bits (445), Expect = 1.118e-50
Identity = 90/196 (45.92%), Postives = 129/196 (65.82%), Query Frame = 2
Query:  170 KTTSAVKKTTESKGKIRKSYPVQSQKKVSKNRKKPFSAHKKRLREKIKPGVVLILLSGIHRGKRVIFLKQLSSGLLLVTGPYKLNGCPIRRVHQKMVIATSTKLDIGELEIPDHLKDDYFAREPQQDEKLSSDVNNIFAKSKKNYVVKEKRKEDQKKIDSQILKAIKKRDDKATFSKYLKTSFSLSSHDYPHKMEF 757
            K +  V+K      K + SYP ++  K  +  K  FS HK+  R  + PG VLILL+G H+GKRV+ LK L+SGLLLVTGP+ LN CP+RRV Q+ VI TS+K+D+G  ++P+HL D YF R   + +K + +  +IFA  K+ +V  E+RK+DQK++D+ +LK IK   +   F+KYL+  F+L S  YPH+M F
Sbjct:   50 KKSPVVEKAKVPIKKSKASYPTKTFVK-KRPSKANFSEHKRNTRRNLTPGTVLILLAGRHQGKRVVLLKVLASGLLLVTGPFALNSCPLRRVSQRYVIGTSSKVDLGAFKVPEHLNDAYFRRLKAKKDKKTGEA-DIFAAKKERFVPNEQRKKDQKEVDAALLKVIKAHPEGKFFAKYLQNMFALHSSQYPHRMRF 243          
BLAST of 60S ribosomal protein L6 vs. Ensembl Fly
Match: RpL6 (gene:FBgn0039857 transcript:FBtr0085805)

HSP 1 Score: 176.022 bits (445), Expect = 2.246e-50
Identity = 87/182 (47.80%), Postives = 124/182 (68.13%), Query Frame = 2
Query:  212 KIRKSYPVQSQKKVSKNRKKPFSAHKKRLREKIKPGVVLILLSGIHRGKRVIFLKQLSSGLLLVTGPYKLNGCPIRRVHQKMVIATSTKLDIGELEIPDHLKDDYFAREPQQDEKLSSDVNNIFAKSKKNYVVKEKRKEDQKKIDSQILKAIKKRDDKATFSKYLKTSFSLSSHDYPHKMEF 757
            K + SYP ++  K  +  K  FS HK+  R  + PG VLILL+G H+GKRV+ LK L+SGLLLVTGP+ LN CP+RRV Q+ VI TS+K+D+G  ++P+HL D YF R   + +K + +  +IFA  K+ +V  E+RK+DQK++D+ +LK IK   +   F+KYL+  F+L S  YPH+M F
Sbjct:   83 KSKASYPTKTFVK-KRPSKANFSEHKRNTRRNLTPGTVLILLAGRHQGKRVVLLKVLASGLLLVTGPFALNSCPLRRVSQRYVIGTSSKVDLGAFKVPEHLNDAYFRRLKAKKDKKTGEA-DIFAAKKERFVPNEQRKKDQKEVDAALLKVIKAHPEGKFFAKYLQNMFALHSSQYPHRMRF 262          
BLAST of 60S ribosomal protein L6 vs. Ensembl Zebrafish
Match: rpl6 (ribosomal protein L6 [Source:ZFIN;Acc:ZDB-GENE-030131-8671])

HSP 1 Score: 159.073 bits (401), Expect = 5.503e-44
Identity = 87/183 (47.54%), Postives = 119/183 (65.03%), Query Frame = 2
Query:  212 KIRKSYPVQS-QKKVSKNRKKPFSAHKKRLREKIKPGVVLILLSGIHRGKRVIFLKQLSSGLLLVTGPYKLNGCPIRRVHQKMVIATSTKLDIGELEIPDHLKDDYFAREPQQDEKLSSDVNNIFAKSKKNYVVKEKRKEDQKKIDSQILKAIKKRDDKATFSKYLKTSFSLSSHDYPHKMEF 757
            K+ + YP +  ++K+  +  K FS H+++LR+ I PG VLI+L+G HRGKRV+FLKQL SGLLLVTGP  +N  P+RR HQK  IAT+TK+DI  ++IP  L D YF +  ++  K       IF   K+ Y + E+RK DQK +DSQ+L  IKK         YL++ FSLS+  YPHK+ F
Sbjct:   88 KMPRYYPTEDVRRKLRSHGIKAFSQHRRKLRKTITPGTVLIMLTGRHRGKRVVFLKQLDSGLLLVTGPLAINRVPLRRAHQKFCIATNTKVDISGMKIPRTLTDSYFKK--KKLRKPKHQEGEIFDTEKEKYQLTEQRKADQKAVDSQLLPLIKKVPQ---LRGYLRSMFSLSNGVYPHKLVF 265          
BLAST of 60S ribosomal protein L6 vs. Ensembl Zebrafish
Match: rpl6 (ribosomal protein L6 [Source:ZFIN;Acc:ZDB-GENE-030131-8671])

HSP 1 Score: 159.073 bits (401), Expect = 5.503e-44
Identity = 87/183 (47.54%), Postives = 119/183 (65.03%), Query Frame = 2
Query:  212 KIRKSYPVQS-QKKVSKNRKKPFSAHKKRLREKIKPGVVLILLSGIHRGKRVIFLKQLSSGLLLVTGPYKLNGCPIRRVHQKMVIATSTKLDIGELEIPDHLKDDYFAREPQQDEKLSSDVNNIFAKSKKNYVVKEKRKEDQKKIDSQILKAIKKRDDKATFSKYLKTSFSLSSHDYPHKMEF 757
            K+ + YP +  ++K+  +  K FS H+++LR+ I PG VLI+L+G HRGKRV+FLKQL SGLLLVTGP  +N  P+RR HQK  IAT+TK+DI  ++IP  L D YF +  ++  K       IF   K+ Y + E+RK DQK +DSQ+L  IKK         YL++ FSLS+  YPHK+ F
Sbjct:   88 KMPRYYPTEDVRRKLRSHGIKAFSQHRRKLRKTITPGTVLIMLTGRHRGKRVVFLKQLDSGLLLVTGPLAINRVPLRRAHQKFCIATNTKVDISGMKIPRTLTDSYFKK--KKLRKPKHQEGEIFDTEKEKYQLTEQRKADQKAVDSQLLPLIKKVPQ---LRGYLRSMFSLSNGVYPHKLVF 265          
BLAST of 60S ribosomal protein L6 vs. Ensembl Zebrafish
Match: rpl6 (ribosomal protein L6 [Source:ZFIN;Acc:ZDB-GENE-030131-8671])

HSP 1 Score: 159.073 bits (401), Expect = 5.503e-44
Identity = 87/183 (47.54%), Postives = 119/183 (65.03%), Query Frame = 2
Query:  212 KIRKSYPVQS-QKKVSKNRKKPFSAHKKRLREKIKPGVVLILLSGIHRGKRVIFLKQLSSGLLLVTGPYKLNGCPIRRVHQKMVIATSTKLDIGELEIPDHLKDDYFAREPQQDEKLSSDVNNIFAKSKKNYVVKEKRKEDQKKIDSQILKAIKKRDDKATFSKYLKTSFSLSSHDYPHKMEF 757
            K+ + YP +  ++K+  +  K FS H+++LR+ I PG VLI+L+G HRGKRV+FLKQL SGLLLVTGP  +N  P+RR HQK  IAT+TK+DI  ++IP  L D YF +  ++  K       IF   K+ Y + E+RK DQK +DSQ+L  IKK         YL++ FSLS+  YPHK+ F
Sbjct:   88 KMPRYYPTEDVRRKLRSHGIKAFSQHRRKLRKTITPGTVLIMLTGRHRGKRVVFLKQLDSGLLLVTGPLAINRVPLRRAHQKFCIATNTKVDISGMKIPRTLTDSYFKK--KKLRKPKHQEGEIFDTEKEKYQLTEQRKADQKAVDSQLLPLIKKVPQ---LRGYLRSMFSLSNGVYPHKLVF 265          
BLAST of 60S ribosomal protein L6 vs. Ensembl Zebrafish
Match: psmd9 (proteasome 26S subunit, non-ATPase 9 [Source:ZFIN;Acc:ZDB-GENE-030131-431])

HSP 1 Score: 44.2838 bits (103), Expect = 1.166e-9
Identity = 18/33 (54.55%), Postives = 24/33 (72.73%), Query Frame = -1
Query: 1687 GVGVTGPLIDSEGFPLNNVDLFSIREARLKHNC 1785
            GVG+ GPL+D EGFP  +VDL+ +R AR   +C
Sbjct:   32 GVGMDGPLVDVEGFPRADVDLYKVRTARHSISC 64          

HSP 2 Score: 38.891 bits (89), Expect = 1.166e-9
Identity = 27/74 (36.49%), Postives = 38/74 (51.35%), Query Frame = -3
Query: 1424 LQNDLRAIMLDIESKLHEIHALNIRT--EANNPIDNSGEIVHTETGNDGSAIFIARHPPFARVSRVDQASVADQ 1639
            LQND +AIM++IE  LH++HA    T  + +  +++SG+ V T              PPFA V  V   S A Q
Sbjct:   65 LQNDHKAIMVEIEEALHKLHATAKVTHEQDDTQMESSGQTVETP-------------PPFALVDAVTHGSPAAQ 125          
BLAST of 60S ribosomal protein L6 vs. Ensembl Zebrafish
Match: psmd9 (proteasome 26S subunit, non-ATPase 9 [Source:ZFIN;Acc:ZDB-GENE-030131-431])

HSP 1 Score: 44.2838 bits (103), Expect = 1.220e-9
Identity = 18/33 (54.55%), Postives = 24/33 (72.73%), Query Frame = -1
Query: 1687 GVGVTGPLIDSEGFPLNNVDLFSIREARLKHNC 1785
            GVG+ GPL+D EGFP  +VDL+ +R AR   +C
Sbjct:   45 GVGMDGPLVDVEGFPRADVDLYKVRTARHSISC 77          

HSP 2 Score: 38.891 bits (89), Expect = 1.220e-9
Identity = 27/74 (36.49%), Postives = 38/74 (51.35%), Query Frame = -3
Query: 1424 LQNDLRAIMLDIESKLHEIHALNIRT--EANNPIDNSGEIVHTETGNDGSAIFIARHPPFARVSRVDQASVADQ 1639
            LQND +AIM++IE  LH++HA    T  + +  +++SG+ V T              PPFA V  V   S A Q
Sbjct:   78 LQNDHKAIMVEIEEALHKLHATAKVTHEQDDTQMESSGQTVETP-------------PPFALVDAVTHGSPAAQ 138          
BLAST of 60S ribosomal protein L6 vs. Ensembl Xenopus
Match: mrrf (mitochondrial ribosome recycling factor [Source:Xenbase;Acc:XB-GENE-1008997])

HSP 1 Score: 132.109 bits (331), Expect = 2.548e-34
Identity = 70/129 (54.26%), Postives = 86/129 (66.67%), Query Frame = 2
Query:  155 LATESKTTSAVKKTTESKGKIRKS---YPVQS-QKKVSKNRKKPFSAHKKRLREKIKPGVVLILLSGIHRGKRVIFLKQLSSGLLLVTGPYKLNGCPIRRVHQKMVIATSTKLDIGELEIPDHLKDDYF 529
            L T +KT    K       K+RK    YP +   +K+  + KKPFS HK++LR  I PG VLILL+G HRGKRV+FLKQL +GLLLVTGP  +N  P+RR HQK  IATSTK+DI  ++IP HL D YF
Sbjct:   60 LVTVTKTVGGDKNGGTRVVKLRKMPRYYPTEDVPRKLLSHGKKPFSQHKRKLRSSITPGTVLILLNGRHRGKRVVFLKQLQTGLLLVTGPLAINRVPLRRAHQKFAIATSTKIDISSVKIPKHLTDSYF 188          
BLAST of 60S ribosomal protein L6 vs. Ensembl Mouse
Match: Rpl6 (ribosomal protein L6 [Source:MGI Symbol;Acc:MGI:108057])

HSP 1 Score: 174.481 bits (441), Expect = 3.114e-49
Identity = 101/209 (48.33%), Postives = 128/209 (61.24%), Query Frame = 2
Query:  155 LATESKTTSAVKKTTESKGKIRKS---YPVQS-QKKVSKNRKKPFSAHKKRLREKIKPGVVLILLSGIHRGKRVIFLKQLSSGLLLVTGPYKLNGCPIRRVHQKMVIATSTKLDIGELEIPDHLKDDYF----AREPQQDEKLSSDVNNIFAKSKKNYVVKEKRKEDQKKIDSQILKAIKKRDDKATFSKYLKTSFSLSSHDYPHKMEF 757
            LAT +KT    K       K+RK    YP +   +K+  + KKPFS H +RLR  I PG VLI+L+G HRGKRV+FLKQL SGLLLVTGP  +N  P+RR HQK VIATSTK+DI +++IP HL D YF     R+P+  E        IF   K+ Y + E+RK DQK +D QIL  IK          YL++ FSL++  YPHK+ F
Sbjct:   97 LATVTKTVGGDKNGGTRVVKLRKMPRYYPTEDVPRKLLSHGKKPFSQHVRRLRSSITPGTVLIILTGRHRGKRVVFLKQLDSGLLLVTGPLVINRVPLRRTHQKFVIATSTKVDISDVKIPKHLTDAYFKKKQLRKPRHQE------GEIFDTEKEKYEITEQRKADQKAVDLQILPKIKAVPQ---LQGYLRSQFSLTNGMYPHKLVF 296          
BLAST of 60S ribosomal protein L6 vs. Ensembl Mouse
Match: Rpl6 (ribosomal protein L6 [Source:MGI Symbol;Acc:MGI:108057])

HSP 1 Score: 70.0922 bits (170), Expect = 1.128e-14
Identity = 33/45 (73.33%), Postives = 37/45 (82.22%), Query Frame = 2
Query:  272 PFSAHKKRLREKIKPGVVLILLSGIHRGKRVIFLKQLSSGLLLVT 406
            PFS H +RLR  I PG VLI+L+G HRGKRV+FLKQL SGLLLVT
Sbjct:    1 PFSQHVRRLRSSITPGTVLIILTGRHRGKRVVFLKQLDSGLLLVT 45          
BLAST of 60S ribosomal protein L6 vs. Ensembl Mouse
Match: Psmd9 (proteasome (prosome, macropain) 26S subunit, non-ATPase, 9 [Source:MGI Symbol;Acc:MGI:1914401])

HSP 1 Score: 40.0466 bits (92), Expect = 3.233e-6
Identity = 18/41 (43.90%), Postives = 27/41 (65.85%), Query Frame = -1
Query: 1690 NYFNCQV*QGVGVTGPLIDSEGFPLNNVDLFSIREARLKHN 1812
            NY   +  +G+G+  PL+D EG+P  +VDL+ +R AR  HN
Sbjct:   40 NYDVLESQKGIGMNEPLVDCEGYPRADVDLYQVRTAR--HN 78          

HSP 2 Score: 31.187 bits (69), Expect = 3.233e-6
Identity = 20/72 (27.78%), Postives = 37/72 (51.39%), Query Frame = -3
Query: 1430 LGLQNDLRAIMLDIESKLHEIHALNIRTEANNPIDNSGEIVHTETGNDGSAIFIARHPPFARVSRVDQASVA 1645
            + LQND +A+M  +E  LH++HA +   +A +  +   E ++    ++   +  A    FARV+ +   S A
Sbjct:   80 ICLQNDHKALMKQVEEALHQLHARDKEKQARDMAEAREEAMNRRLASNSPVLPQA----FARVNSISPGSPA 147          
BLAST of 60S ribosomal protein L6 vs. Ensembl Mouse
Match: Psmd9 (proteasome (prosome, macropain) 26S subunit, non-ATPase, 9 [Source:MGI Symbol;Acc:MGI:1914401])

HSP 1 Score: 39.6614 bits (91), Expect = 4.263e-6
Identity = 16/33 (48.48%), Postives = 24/33 (72.73%), Query Frame = -1
Query: 1690 QGVGVTGPLIDSEGFPLNNVDLFSIREARLKHN 1788
            +G+G+  PL+D EG+P  +VDL+ +R AR  HN
Sbjct:    2 KGIGMNEPLVDCEGYPRADVDLYQVRTAR--HN 32          

HSP 2 Score: 31.187 bits (69), Expect = 4.263e-6
Identity = 20/72 (27.78%), Postives = 37/72 (51.39%), Query Frame = -3
Query: 1430 LGLQNDLRAIMLDIESKLHEIHALNIRTEANNPIDNSGEIVHTETGNDGSAIFIARHPPFARVSRVDQASVA 1645
            + LQND +A+M  +E  LH++HA +   +A +  +   E ++    ++   +  A    FARV+ +   S A
Sbjct:   34 ICLQNDHKALMKQVEEALHQLHARDKEKQARDMAEAREEAMNRRLASNSPVLPQA----FARVNSISPGSPA 101          
BLAST of 60S ribosomal protein L6 vs. UniProt/SwissProt
Match: sp|P21533|RL6_RAT (60S ribosomal protein L6 OS=Rattus norvegicus OX=10116 GN=Rpl6 PE=1 SV=5)

HSP 1 Score: 178.718 bits (452), Expect = 5.527e-50
Identity = 101/205 (49.27%), Postives = 129/205 (62.93%), Query Frame = 2
Query:  155 LATESKTTSAVKKTTESKGKIRKS---YPVQS-QKKVSKNRKKPFSAHKKRLREKIKPGVVLILLSGIHRGKRVIFLKQLSSGLLLVTGPYKLNGCPIRRVHQKMVIATSTKLDIGELEIPDHLKDDYFAREPQQDEKLSSDVNNIFAKSKKNYVVKEKRKEDQKKIDSQILKAIKKRDDKATFSKYLKTSFSLSSHDYPHKMEF 757
            LAT +KT    K       K+RK    YP +   +K+  + KKPFS H +RLR  I PG VLI+L+G HRGKRV+FLKQL SGLLLVTGP  LN  P+RR HQK VIATSTK+DI +++IP HL D YF ++P +  +       IF   K+ Y + E+RK DQK +DSQIL  IK          YL++ FSL++  YPHK+ F
Sbjct:   99 LATVTKTVGGDKNGGTRVVKLRKMPRYYPTEDVPRKLLSHGKKPFSQHVRRLRSSITPGTVLIILTGRHRGKRVVFLKQLGSGLLLVTGPLALNRVPLRRTHQKFVIATSTKVDISKVKIPKHLTDAYFKKKPLRKPRHQE--GEIFDTEKEKYEITEQRKADQKAVDSQILPKIKAVPQ---LQGYLRSQFSLTNGMYPHKLVF 298          
BLAST of 60S ribosomal protein L6 vs. UniProt/SwissProt
Match: sp|Q2YGT9|RL6_PIG (60S ribosomal protein L6 OS=Sus scrofa OX=9823 GN=RPL6 PE=1 SV=3)

HSP 1 Score: 174.866 bits (442), Expect = 8.714e-49
Identity = 101/209 (48.33%), Postives = 130/209 (62.20%), Query Frame = 2
Query:  155 LATESKTTSAVKKTTESKGKIRKS---YPVQS-QKKVSKNRKKPFSAHKKRLREKIKPGVVLILLSGIHRGKRVIFLKQLSSGLLLVTGPYKLNGCPIRRVHQKMVIATSTKLDIGELEIPDHLKDDYF----AREPQQDEKLSSDVNNIFAKSKKNYVVKEKRKEDQKKIDSQILKAIKKRDDKATFSKYLKTSFSLSSHDYPHKMEF 757
            LAT +K     K       K+RK    YP +   +K+  + KKPFS H ++LR  I PG +LI+L+G HRGKRVIFLKQLSSGLLLVTGP  LN  P+RR HQK VIATSTK+DI  ++IP+HL D YF     R+P+  E        IF   K+ Y + E+RK DQK +DSQIL+ IK          YL++ F+L++  YPHK+ F
Sbjct:   85 LATVTKPVGGDKNGGTRVVKLRKMPRYYPTEDVPRKLLSHGKKPFSKHVRKLRASITPGTILIILTGRHRGKRVIFLKQLSSGLLLVTGPLSLNRVPLRRTHQKFVIATSTKIDISGVKIPEHLTDAYFKKKKLRKPRHQE------GEIFDTEKEKYEISEQRKVDQKAVDSQILRRIKAVPQ---LQGYLRSVFALTNGIYPHKLVF 284          
BLAST of 60S ribosomal protein L6 vs. UniProt/SwissProt
Match: sp|P47911|RL6_MOUSE (60S ribosomal protein L6 OS=Mus musculus OX=10090 GN=Rpl6 PE=1 SV=3)

HSP 1 Score: 174.481 bits (441), Expect = 2.178e-48
Identity = 101/209 (48.33%), Postives = 128/209 (61.24%), Query Frame = 2
Query:  155 LATESKTTSAVKKTTESKGKIRKS---YPVQS-QKKVSKNRKKPFSAHKKRLREKIKPGVVLILLSGIHRGKRVIFLKQLSSGLLLVTGPYKLNGCPIRRVHQKMVIATSTKLDIGELEIPDHLKDDYF----AREPQQDEKLSSDVNNIFAKSKKNYVVKEKRKEDQKKIDSQILKAIKKRDDKATFSKYLKTSFSLSSHDYPHKMEF 757
            LAT +KT    K       K+RK    YP +   +K+  + KKPFS H +RLR  I PG VLI+L+G HRGKRV+FLKQL SGLLLVTGP  +N  P+RR HQK VIATSTK+DI +++IP HL D YF     R+P+  E        IF   K+ Y + E+RK DQK +D QIL  IK          YL++ FSL++  YPHK+ F
Sbjct:   97 LATVTKTVGGDKNGGTRVVKLRKMPRYYPTEDVPRKLLSHGKKPFSQHVRRLRSSITPGTVLIILTGRHRGKRVVFLKQLDSGLLLVTGPLVINRVPLRRTHQKFVIATSTKVDISDVKIPKHLTDAYFKKKQLRKPRHQE------GEIFDTEKEKYEITEQRKADQKAVDLQILPKIKAVPQ---LQGYLRSQFSLTNGMYPHKLVF 296          
BLAST of 60S ribosomal protein L6 vs. UniProt/SwissProt
Match: sp|Q6QMZ4|RL6_CHILA (60S ribosomal protein L6 OS=Chinchilla lanigera OX=34839 GN=RPL6 PE=2 SV=3)

HSP 1 Score: 172.94 bits (437), Expect = 6.175e-48
Identity = 100/209 (47.85%), Postives = 128/209 (61.24%), Query Frame = 2
Query:  155 LATESKTTSAVKKTTESKGKIRKS---YPVQS-QKKVSKNRKKPFSAHKKRLREKIKPGVVLILLSGIHRGKRVIFLKQLSSGLLLVTGPYKLNGCPIRRVHQKMVIATSTKLDIGELEIPDHLKDDYF----AREPQQDEKLSSDVNNIFAKSKKNYVVKEKRKEDQKKIDSQILKAIKKRDDKATFSKYLKTSFSLSSHDYPHKMEF 757
            LAT +K     K       K+RK    YP +   +K+  + KKPFS H ++LR  I PG VLI+L+G HRGKRV+FLKQL+SGLLLVTGP  LN  P+RR HQK VIATSTK+DI  ++IP HL D YF     R+P+  E        IF   K+ Y + E+RK DQK +DSQIL  IK          YL++ F+L++  YPHK+ F
Sbjct:   89 LATVTKPVGGDKNGGTRVVKLRKMPRYYPTEDVPRKLLSHGKKPFSQHVRKLRASITPGTVLIILTGRHRGKRVVFLKQLASGLLLVTGPLNLNRVPLRRTHQKFVIATSTKIDISNVKIPKHLTDAYFKKKKLRKPRHQE------GEIFDTEKERYQISEQRKVDQKAVDSQILPKIKAVPQ---LRGYLRSVFALTNGIYPHKLVF 288          
BLAST of 60S ribosomal protein L6 vs. UniProt/SwissProt
Match: sp|Q58DQ3|RL6_BOVIN (60S ribosomal protein L6 OS=Bos taurus OX=9913 GN=RPL6 PE=2 SV=3)

HSP 1 Score: 171.785 bits (434), Expect = 1.283e-47
Identity = 98/209 (46.89%), Postives = 129/209 (61.72%), Query Frame = 2
Query:  155 LATESKTTSAVKKTTESKGKIRKS---YPVQS-QKKVSKNRKKPFSAHKKRLREKIKPGVVLILLSGIHRGKRVIFLKQLSSGLLLVTGPYKLNGCPIRRVHQKMVIATSTKLDIGELEIPDHLKDDYF----AREPQQDEKLSSDVNNIFAKSKKNYVVKEKRKEDQKKIDSQILKAIKKRDDKATFSKYLKTSFSLSSHDYPHKMEF 757
            LAT +K     K       K+RK    YP +   +K+  + KKPFS H ++LR  I PG +LI+L+G HRGKRV+FLKQL SGLLLVTGP  LN  P+RR HQK VIATSTK+DI  ++IP+HL D YF     R+P+  E        IF   ++ Y + E+RK DQK +DSQIL+ IK          YL++ F+L++  YPHK+ F
Sbjct:   88 LATVTKPVGGDKNGGTRVVKLRKMPRYYPTEDVPRKLLSHGKKPFSKHVRKLRASITPGTILIILTGRHRGKRVVFLKQLGSGLLLVTGPLSLNRVPLRRTHQKFVIATSTKIDISGVKIPEHLTDTYFKKKKLRKPRHQE------GEIFDTEREKYEITEQRKVDQKAVDSQILRRIKAVPQ---LQGYLRSVFALTNGIYPHKVVF 287          
BLAST of 60S ribosomal protein L6 vs. TrEMBL
Match: A0A2I9LPM6 (60S ribosomal protein L6 OS=Centruroides hentzi OX=88313 PE=3 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 3.744e-53
Identity = 99/183 (54.10%), Postives = 130/183 (71.04%), Query Frame = 2
Query:  212 KIRKSYPVQSQKKVSKNRKK-PFSAHKKRLREKIKPGVVLILLSGIHRGKRVIFLKQLSSGLLLVTGPYKLNGCPIRRVHQKMVIATSTKLDIGELEIPDHLKDDYFAREPQQDEKLSSDVNNIFAKSKKNYVVKEKRKEDQKKIDSQILKAIKKRDDKATFSKYLKTSFSLSSHDYPHKMEF 757
            K R+ YP + + K+ K+RK   FS HK+ LR++I PG VLILL+G HRGKRV+FLKQL SGLLLVTGP+K+NGCP+RR++Q  VIATSTKLDI E++IP HL D YF R+  + EK   D   IF    + Y V EKRK+DQ ++D Q+++AIKK  +K     YL + F L +  YPH+M+F
Sbjct:   82 KQRRYYPTEDRPKLKKSRKMVSFSKHKRYLRKRITPGTVLILLAGRHRGKRVVFLKQLQSGLLLVTGPFKVNGCPLRRINQIYVIATSTKLDISEVKIPAHLNDKYFNRKHSKKEK--KDEGEIFELKSEEYTVNEKRKKDQIEVDRQLIEAIKKNPEKKMLFSYLASVFQLRNKMYPHRMKF 262          
BLAST of 60S ribosomal protein L6 vs. TrEMBL
Match: A0A0B6XXD3 (Uncharacterized protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF4434 PE=4 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 1.298e-52
Identity = 92/182 (50.55%), Postives = 127/182 (69.78%), Query Frame = 2
Query:  212 KIRKSYPVQSQKKVSKNRKKPFSAHKKRLREKIKPGVVLILLSGIHRGKRVIFLKQLSSGLLLVTGPYKLNGCPIRRVHQKMVIATSTKLDIGELEIPDHLKDDYFAREPQQDEKLSSDVNNIFAKSKKNYVVKEKRKEDQKKIDSQILKAIKKRDDKATFSKYLKTSFSLSSHDYPHKMEF 757
            ++ + YP + + +   +RKKPFS H++ LR  IKPG VLILL+G H+GKRV+FLKQL +GLLLVTGPY LNGCP+RR++Q  VIAT T++DI +++IP+ + DDYF R+  +  K +    +IF   K+ Y V  +RKEDQ  +D QIL AI++  +K     YL   FSLS+H +PHKM F
Sbjct:   35 RLSRFYPTEDKPRKLLSRKKPFSQHRRHLRSSIKPGTVLILLAGRHKGKRVVFLKQLKTGLLLVTGPYHLNGCPLRRINQIYVIATKTRIDIKDVKIPERVNDDYFRRQKLRKPKHAE--GDIFNTKKEVYAVSNERKEDQTAVDRQILDAIRQNPEKKLLFGYLGALFSLSNHQFPHKMVF 214          
BLAST of 60S ribosomal protein L6 vs. TrEMBL
Match: A0A1W7R9Q1 (60S ribosomal protein L6 OS=Hadrurus spadix OX=141984 PE=3 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 1.568e-52
Identity = 98/183 (53.55%), Postives = 129/183 (70.49%), Query Frame = 2
Query:  212 KIRKSYPVQSQKKVSKNRKK-PFSAHKKRLREKIKPGVVLILLSGIHRGKRVIFLKQLSSGLLLVTGPYKLNGCPIRRVHQKMVIATSTKLDIGELEIPDHLKDDYFAREPQQDEKLSSDVNNIFAKSKKNYVVKEKRKEDQKKIDSQILKAIKKRDDKATFSKYLKTSFSLSSHDYPHKMEF 757
            K R+ YP + + K+ K+RK  PF+ HK+ LR++I PG VLILL+G HRGKRVIFLKQL SGLLLVTGP+K+NGCP+RR++Q  VIATSTKLD+ ++ IP HL D YF R+  + EK   D   IF    + Y V E+RK+DQ ++D QIL+ IKK  +K     YL + F L +  YPH+M+F
Sbjct:   78 KQRRYYPTEDRPKLKKSRKMIPFAKHKRYLRKRITPGTVLILLAGRHRGKRVIFLKQLPSGLLLVTGPFKINGCPLRRINQIYVIATSTKLDLTDINIPAHLNDRYFNRKHAKKEK---DEAEIFETKSEEYAVTEQRKKDQIEVDKQILETIKKHPEKKMMLAYLGSVFQLRNKMYPHRMKF 257          
BLAST of 60S ribosomal protein L6 vs. TrEMBL
Match: A0A1Z5LG56 (60S ribosomal protein L6 (Fragment) OS=Ornithodoros moubata OX=6938 PE=4 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 2.861e-52
Identity = 95/183 (51.91%), Postives = 130/183 (71.04%), Query Frame = 2
Query:  212 KIRKSYPVQSQKKVSKNRK-KPFSAHKKRLREKIKPGVVLILLSGIHRGKRVIFLKQLSSGLLLVTGPYKLNGCPIRRVHQKMVIATSTKLDIGELEIPDHLKDDYFAREPQQDEKLSSDVNNIFAKSKKNYVVKEKRKEDQKKIDSQILKAIKKRDDKATFSKYLKTSFSLSSHDYPHKMEF 757
            K R+SYP + + ++ K RK KP   H   LR++I PG VLILL+G+HRGKRV+FLKQL +GLLLVTGPY +NGCP+RRV+Q  VIATSTK+DI  +++P+HL D YF R+P+  +K   D  +IF    +   V E+RK+DQ ++D Q+L AIK   +K     YL ++FSL +H YPHK++F
Sbjct:   97 KERRSYPTEDKPRLMKTRKMKPSCLHPISLRKRITPGTVLILLAGVHRGKRVVFLKQLKTGLLLVTGPYTVNGCPMRRVNQTYVIATSTKIDISAVKVPEHLNDKYF-RKPRH-KKQRKDDGDIFESKPEEPAVSEQRKKDQLEVDKQVLAAIKAHPEKGMMRHYLASTFSLRNHMYPHKLKF 277          
BLAST of 60S ribosomal protein L6 vs. TrEMBL
Match: A0A3S1BKF4 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_006356 PE=4 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 2.896e-52
Identity = 90/182 (49.45%), Postives = 130/182 (71.43%), Query Frame = 2
Query:  212 KIRKSYPVQSQKKVSKNRKKPFSAHKKRLREKIKPGVVLILLSGIHRGKRVIFLKQLSSGLLLVTGPYKLNGCPIRRVHQKMVIATSTKLDIGELEIPDHLKDDYFAREPQQDEKLSSDVNNIFAKSKKNYVVKEKRKEDQKKIDSQILKAIKKRDDKATFSKYLKTSFSLSSHDYPHKMEF 757
            ++ + YP + + +  KN K  F+ HK++LRE I PG +LIL++G H+GKRV+FLKQL++GLLLVTGPY LNGCP+RR++Q+ VIAT TKLDI  +++PD + D+YF R  Q+ +K      +IF+  K+ Y V ++RKEDQ  +D QIL  I+K+ +K     YL + FSLS++ +PHKM F
Sbjct:   29 RMPRWYPTEDKPRKLKNHKIAFNQHKRKLRESITPGTILILVAGRHKGKRVVFLKQLNTGLLLVTGPYHLNGCPLRRINQRYVIATKTKLDIKGVKVPDRVNDEYFKR--QKSKKPKHTEGDIFSTEKEVYTVSDERKEDQANVDRQILDVIRKQKEKKLLFGYLGSMFSLSNNQFPHKMVF 208          
BLAST of 60S ribosomal protein L6 vs. Ensembl Cavefish
Match: rpl6 (ribosomal protein L6 [Source:NCBI gene;Acc:103032571])

HSP 1 Score: 160.229 bits (404), Expect = 1.369e-44
Identity = 87/183 (47.54%), Postives = 119/183 (65.03%), Query Frame = 2
Query:  212 KIRKSYPVQSQ-KKVSKNRKKPFSAHKKRLREKIKPGVVLILLSGIHRGKRVIFLKQLSSGLLLVTGPYKLNGCPIRRVHQKMVIATSTKLDIGELEIPDHLKDDYFAREPQQDEKLSSDVNNIFAKSKKNYVVKEKRKEDQKKIDSQILKAIKKRDDKATFSKYLKTSFSLSSHDYPHKMEF 757
            K+ + YP ++  +K+  +  KPFS H+++LR  I PG VLI+L+G HRGKRV+FLKQL SGLLLVTGP  +N  P+RR HQK  IATSTKLDI  ++IP +L D YF +  ++  K       IF   K+ Y + E+RKEDQK +D Q+L  I+   +      YL++ F LS+  YPHK+ F
Sbjct:   83 KMPRYYPTENPPRKLRSHGIKPFSQHRRKLRSSISPGTVLIMLTGRHRGKRVVFLKQLGSGLLLVTGPLAINRVPLRRAHQKFCIATSTKLDISGVKIPKNLNDAYFKK--KKLRKPKHQEGEIFDTEKEKYQLTEQRKEDQKAVDKQLLPLIR---NFPHLKGYLRSQFFLSNGVYPHKLIF 260          
BLAST of 60S ribosomal protein L6 vs. Ensembl Cavefish
Match: psmd9 (proteasome 26S subunit, non-ATPase 9 [Source:NCBI gene;Acc:103022112])

HSP 1 Score: 41.9726 bits (97), Expect = 3.276e-9
Identity = 20/42 (47.62%), Postives = 27/42 (64.29%), Query Frame = -1
Query: 1687 YFNCQV*QG-VGVTGPLIDSEGFPLNNVDLFSIREARLKHNC 1809
            Y++    QG VG+  PL+D EG+P  +VDLF IR AR   +C
Sbjct:   36 YYDVLEDQGDVGMDAPLVDVEGYPRADVDLFQIRTARHSISC 77          

HSP 2 Score: 39.2762 bits (90), Expect = 3.276e-9
Identity = 29/72 (40.28%), Postives = 39/72 (54.17%), Query Frame = -3
Query: 1424 LQNDLRAIMLDIESKLHEIHALNIRTEANNPIDNSGEIVHTETGNDGSAIFIARHPPFARVSRVDQASVADQ 1639
            LQND +AIM++IE  LH++HA   R +A +  D +     TE      ++     PPFARV  V Q S A Q
Sbjct:   78 LQNDHKAIMVEIEEALHKLHA---REKAKHDQDQAE--AQTERMEQEPSL----PPPFARVDAVTQGSPAYQ 140          
BLAST of 60S ribosomal protein L6 vs. Ensembl Yeast
Match: RPL6A (Ribosomal 60S subunit protein L6A; N-terminally acetylated; binds 5.8S rRNA; homologous to mammalian ribosomal protein L6, no bacterial homolog; RPL6A has a paralog, RPL6B, that arose from the whole genome duplication [Source:SGD;Acc:S000004538])

HSP 1 Score: 119.013 bits (297), Expect = 1.519e-31
Identity = 72/185 (38.92%), Postives = 110/185 (59.46%), Query Frame = 2
Query:  203 SKGKIRKSYPVQSQKKVSKNRKKPFSAHKKRLREKIKPGVVLILLSGIHRGKRVIFLKQLSSGLLLVTGPYKLNGCPIRRVHQKMVIATSTKLDIGELEIPDHLKDDYFAREPQQDEKLSSDVNNIFAKSKKNYVVKEKRKEDQKKIDSQILKAIKKRDDKATFSKYLKTSFSLSSHDYPHKMEF 757
            S  K  K YP +    + K RK   +A  ++LR  + PG VLILL+G  RGKRV++LK L    LL++GP+K+NG P+RRV+ + VIATSTK+ +  + + +    +YFA+  ++  K      N+F + ++N  +K +R EDQK +D  ++  IKK        +YL  SFSL + D PH ++F
Sbjct:    2 SAQKAPKWYPSEDVAALKKTRK---AARPQKLRASLVPGTVLILLAGRFRGKRVVYLKHLEDNTLLISGPFKVNGVPLRRVNARYVIATSTKVSVEGVNV-EKFNVEYFAK--EKLTKKEKKEANLFPE-QQNKEIKAERVEDQKVVDKALIAEIKK---TPLLKQYLSASFSLKNGDKPHMLKF 176          
BLAST of 60S ribosomal protein L6 vs. Ensembl Yeast
Match: RPL6B (Ribosomal 60S subunit protein L6B; binds 5.8S rRNA; homologous to mammalian ribosomal protein L6, no bacterial homolog; RPL6B has a paralog, RPL6A, that arose from the whole genome duplication [Source:SGD;Acc:S000004440])

HSP 1 Score: 115.546 bits (288), Expect = 2.198e-30
Identity = 71/179 (39.66%), Postives = 104/179 (58.10%), Query Frame = 2
Query:  221 KSYPVQSQKKVSKNRKKPFSAHKKRLREKIKPGVVLILLSGIHRGKRVIFLKQLSSGLLLVTGPYKLNGCPIRRVHQKMVIATSTKLDIGELEIPDHLKDDYFAREPQQDEKLSSDVNNIFAKSKKNYVVKEKRKEDQKKIDSQILKAIKKRDDKATFSKYLKTSFSLSSHDYPHKMEF 757
            K YP +      K RK   +   ++LR  + PG VLILL+G  RGKRV++LK L    LLVTGP+K+NG P+RRV+ + VIATSTK+ +  + + +    +YFA+  ++  K      N+F + +    +K +R EDQK +D  +L  IKK        +YL  SFSL + D PH ++F
Sbjct:    8 KWYPSEDVAAPKKTRK---AVRPQKLRASLVPGTVLILLAGRFRGKRVVYLKHLEDNTLLVTGPFKVNGVPLRRVNARYVIATSTKVSVEGVNV-EKFNVEYFAK--EKLTKKEKKEANLFPEQQTKE-IKTERVEDQKVVDKALLAEIKK---TPLLKQYLSASFSLKNGDKPHLLKF 176          
BLAST of 60S ribosomal protein L6 vs. Ensembl Nematostella
Match: EDO41373 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4S4])

HSP 1 Score: 149.443 bits (376), Expect = 2.965e-41
Identity = 86/179 (48.04%), Postives = 114/179 (63.69%), Query Frame = 2
Query:  227 YPVQSQKKVSKNRKKPFSAHKKRLREKIKPGVVLILLSGIHRGKRVIFLKQLSSGLLLVTGPYKLNGCPIRRVHQKMVIATSTKLDIGELEIPDHLKDD--YFAREPQQDEKLSSDVNNIFAKSKKNYVVKEKRKEDQKKIDSQILKAIKKRDDKATFSKYLKTSFSLSSHDYPHKMEF 757
            YP +  ++   NRKKP  A   +LR  I PG VLILL+G HRGKRV+FLKQL+SGLLLVTGP+K+NG P+RR+ Q  VIATST +D+ ++++P+H   D  YF  EP++ +K S D+    A+ KK     E+R  DQK +D QIL  I    +     KYL + FSL    +PH M F
Sbjct:   76 YPTEDVRRRLANRKKPGMA---KLRSSITPGTVLILLAGAHRGKRVVFLKQLNSGLLLVTGPFKINGVPLRRIPQSYVIATSTHIDVSDVKLPEHAFADESYFKGEPKK-KKRSEDMFEEAAEEKKP---SEQRIADQKAVDDQILPKISAVPN---MKKYLSSLFSLRKGQFPHDMVF 244          
BLAST of 60S ribosomal protein L6 vs. Ensembl Medaka
Match: rpl6 (ribosomal protein L6 [Source:NCBI gene;Acc:101172170])

HSP 1 Score: 167.933 bits (424), Expect = 2.127e-47
Identity = 100/208 (48.08%), Postives = 127/208 (61.06%), Query Frame = 2
Query:  158 ATESKTTSAVKKTTESKGKIRKS---YPVQS-QKKVSKNRKKPFSAHKKRLREKIKPGVVLILLSGIHRGKRVIFLKQLSSGLLLVTGPYKLNGCPIRRVHQKMVIATSTKLDIGELEIPDHLKDDYF----AREPQQDEKLSSDVNNIFAKSKKNYVVKEKRKEDQKKIDSQILKAIKKRDDKATFSKYLKTSFSLSSHDYPHKMEF 757
            AT  KT    K       K+RK    YP +   +K+  + KKPF  HK++LR  I PG VLILL+G HRGKRV+FLKQLSSGLLLVTGP  LN  P+RR HQK VIAT+TK+DI  ++IP  L D YF     R P+  E        IF   K+ Y + E+RKE QK++DS++L  IKK         YL++SF L++  YPHK+ F
Sbjct:   62 ATVVKTVGGDKNGGTRVVKLRKMPRYYPTEDVPRKLKSHGKKPFCQHKRKLRASITPGTVLILLTGRHRGKRVVFLKQLSSGLLLVTGPLALNRVPLRRAHQKFVIATNTKVDITGMKIPKTLNDAYFKKKKLRRPRHQE------GEIFDTEKEKYQLTEERKEIQKEVDSKLLPLIKKVPQ---LKGYLRSSFYLTNGVYPHKLVF 260          
BLAST of 60S ribosomal protein L6 vs. Ensembl Medaka
Match: ENSORLT00000027450.1 (pep primary_assembly:ASM223467v1:10:1314901:1318310:-1 gene:ENSORLG00000020235.2 transcript:ENSORLT00000027450.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.2478 bits (173), Expect = 1.642e-13
Identity = 67/208 (32.21%), Postives = 91/208 (43.75%), Query Frame = 2
Query:  158 ATESKTTSAVKKTTESKGKIRKS---YPVQS-QKKVSKNRKKPFSAHKKRLREKIKPGVVLILLSGIHRGKRVIFLKQLSSGLLLVTGPYKLNGCPIRRVHQKMVIATSTKLDIGELEIPDHLKDDYF----AREPQQDEKLSSDVNNIFAKSKKNYVVKEKRKEDQKKIDSQILKAIKKRDDKATFSKYLKTSFSLSSHDYPHKMEF 757
            AT  KT    K       K+RK    YP +   +K+  + KKP   HK++LR                   RV+FLKQLSS  LL                           DI  ++IP  L D YF     R P+Q E        IF   KK Y + E+RKE QK+++S++L  IKK        +YL++SF L++  YPHK+ F
Sbjct:   59 ATVWKTVGGDKNGGTRVVKLRKMPRYYPTEDVPRKLKSHGKKPVCQHKRKLR-------------------RVVFLKQLSSVPLL---------------------------DITGMKIPKTLNDAYFKKKKLRGPRQQE------GEIFHTEKKKYQLTEQRKEIQKEVNSKLLPLIKKVPQ---LKEYLRSSFYLTNGVYPHKLVF 211          
BLAST of 60S ribosomal protein L6 vs. Ensembl Medaka
Match: ENSORLT00000027419.1 (pep primary_assembly:ASM223467v1:10:1314901:1317268:-1 gene:ENSORLG00000020235.2 transcript:ENSORLT00000027419.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.2478 bits (173), Expect = 2.118e-13
Identity = 67/208 (32.21%), Postives = 91/208 (43.75%), Query Frame = 2
Query:  158 ATESKTTSAVKKTTESKGKIRKS---YPVQS-QKKVSKNRKKPFSAHKKRLREKIKPGVVLILLSGIHRGKRVIFLKQLSSGLLLVTGPYKLNGCPIRRVHQKMVIATSTKLDIGELEIPDHLKDDYF----AREPQQDEKLSSDVNNIFAKSKKNYVVKEKRKEDQKKIDSQILKAIKKRDDKATFSKYLKTSFSLSSHDYPHKMEF 757
            AT  KT    K       K+RK    YP +   +K+  + KKP   HK++LR                   RV+FLKQLSS  LL                           DI  ++IP  L D YF     R P+Q E        IF   KK Y + E+RKE QK+++S++L  IKK        +YL++SF L++  YPHK+ F
Sbjct:   64 ATVWKTVGGDKNGGTRVVKLRKMPRYYPTEDVPRKLKSHGKKPVCQHKRKLR-------------------RVVFLKQLSSVPLL---------------------------DITGMKIPKTLNDAYFKKKKLRGPRQQE------GEIFHTEKKKYQLTEQRKEIQKEVNSKLLPLIKKVPQ---LKEYLRSSFYLTNGVYPHKLVF 216          
BLAST of 60S ribosomal protein L6 vs. Ensembl Medaka
Match: ENSORLT00000041303.1 (pep primary_assembly:ASM223467v1:10:1314901:1316465:-1 gene:ENSORLG00000020235.2 transcript:ENSORLT00000041303.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.8626 bits (172), Expect = 2.713e-13
Identity = 67/208 (32.21%), Postives = 91/208 (43.75%), Query Frame = 2
Query:  158 ATESKTTSAVKKTTESKGKIRKS---YPVQS-QKKVSKNRKKPFSAHKKRLREKIKPGVVLILLSGIHRGKRVIFLKQLSSGLLLVTGPYKLNGCPIRRVHQKMVIATSTKLDIGELEIPDHLKDDYF----AREPQQDEKLSSDVNNIFAKSKKNYVVKEKRKEDQKKIDSQILKAIKKRDDKATFSKYLKTSFSLSSHDYPHKMEF 757
            AT  KT    K       K+RK    YP +   +K+  + KKP   HK++LR                   RV+FLKQLSS  LL                           DI  ++IP  L D YF     R P+Q E        IF   KK Y + E+RKE QK+++S++L  IKK        +YL++SF L++  YPHK+ F
Sbjct:   63 ATVWKTVGGDKNGGTRVVKLRKMPRYYPTEDVPRKLKSHGKKPVCQHKRKLR-------------------RVVFLKQLSSVPLL---------------------------DITGMKIPKTLNDAYFKKKKLRGPRQQE------GEIFHTEKKKYQLTEQRKEIQKEVNSKLLPLIKKVPQ---LKEYLRSSFYLTNGVYPHKLVF 215          
BLAST of 60S ribosomal protein L6 vs. Ensembl Medaka
Match: ENSORLT00000045286.1 (pep primary_assembly:ASM223467v1:10:1314901:1319647:-1 gene:ENSORLG00000020235.2 transcript:ENSORLT00000045286.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.8626 bits (172), Expect = 2.817e-13
Identity = 67/208 (32.21%), Postives = 91/208 (43.75%), Query Frame = 2
Query:  158 ATESKTTSAVKKTTESKGKIRKS---YPVQS-QKKVSKNRKKPFSAHKKRLREKIKPGVVLILLSGIHRGKRVIFLKQLSSGLLLVTGPYKLNGCPIRRVHQKMVIATSTKLDIGELEIPDHLKDDYF----AREPQQDEKLSSDVNNIFAKSKKNYVVKEKRKEDQKKIDSQILKAIKKRDDKATFSKYLKTSFSLSSHDYPHKMEF 757
            AT  KT    K       K+RK    YP +   +K+  + KKP   HK++LR                   RV+FLKQLSS  LL                           DI  ++IP  L D YF     R P+Q E        IF   KK Y + E+RKE QK+++S++L  IKK        +YL++SF L++  YPHK+ F
Sbjct:   70 ATVWKTVGGDKNGGTRVVKLRKMPRYYPTEDVPRKLKSHGKKPVCQHKRKLR-------------------RVVFLKQLSSVPLL---------------------------DITGMKIPKTLNDAYFKKKKLRGPRQQE------GEIFHTEKKKYQLTEQRKEIQKEVNSKLLPLIKKVPQ---LKEYLRSSFYLTNGVYPHKLVF 222          
BLAST of 60S ribosomal protein L6 vs. Planmine SMEST
Match: SMESG000019835.1 (SMESG000019835.1)

HSP 1 Score: 417.157 bits (1071), Expect = 4.628e-143
Identity = 208/208 (100.00%), Postives = 208/208 (100.00%), Query Frame = 2
Query:  134 EMIEPVKLATESKTTSAVKKTTESKGKIRKSYPVQSQKKVSKNRKKPFSAHKKRLREKIKPGVVLILLSGIHRGKRVIFLKQLSSGLLLVTGPYKLNGCPIRRVHQKMVIATSTKLDIGELEIPDHLKDDYFAREPQQDEKLSSDVNNIFAKSKKNYVVKEKRKEDQKKIDSQILKAIKKRDDKATFSKYLKTSFSLSSHDYPHKMEF 757
            EMIEPVKLATESKTTSAVKKTTESKGKIRKSYPVQSQKKVSKNRKKPFSAHKKRLREKIKPGVVLILLSGIHRGKRVIFLKQLSSGLLLVTGPYKLNGCPIRRVHQKMVIATSTKLDIGELEIPDHLKDDYFAREPQQDEKLSSDVNNIFAKSKKNYVVKEKRKEDQKKIDSQILKAIKKRDDKATFSKYLKTSFSLSSHDYPHKMEF
Sbjct:   84 EMIEPVKLATESKTTSAVKKTTESKGKIRKSYPVQSQKKVSKNRKKPFSAHKKRLREKIKPGVVLILLSGIHRGKRVIFLKQLSSGLLLVTGPYKLNGCPIRRVHQKMVIATSTKLDIGELEIPDHLKDDYFAREPQQDEKLSSDVNNIFAKSKKNYVVKEKRKEDQKKIDSQILKAIKKRDDKATFSKYLKTSFSLSSHDYPHKMEF 291          
BLAST of 60S ribosomal protein L6 vs. Planmine SMEST
Match: SMESG000019834.1 (SMESG000019834.1)

HSP 1 Score: 199.519 bits (506), Expect = 1.019e-66
Identity = 111/176 (63.07%), Postives = 117/176 (66.48%), Query Frame = -3
Query: 1121 LQNDLRAIMLDIESKLHEIHALNIRTEANNPIDNSGEIVHTETGNDGSAIFIARHPPFARVSRVDQASVADQCVSISIN*HG*IEMCSXXXXXXXXXXXX**RYQRNVYGSASNYGIVALSCQCKSTFFNWN*SLFIV---F*KMVLVCVKRCNKRVHLTIVPPLTGPIGCMLVPI 1639
            LQNDLRAIMLDIESKLHEIHALNIRTEANNPIDNSGEIVHTETGNDGSAIFIARHPPFARVSRVDQASVADQC                                    G      ++ L    K TF +    + ++     KMVLVCVKRCNKRVHLTIVPPLTGPIGCMLVPI
Sbjct:   55 LQNDLRAIMLDIESKLHEIHALNIRTEANNPIDNSGEIVHTETGNDGSAIFIARHPPFARVSRVDQASVADQC------------------------------------GLRVGDELLQLDSVTKETFTDLPAIMELLRSRANKMVLVCVKRCNKRVHLTIVPPLTGPIGCMLVPI 194          

HSP 2 Score: 74.3294 bits (181), Expect = 1.019e-66
Identity = 34/34 (100.00%), Postives = 34/34 (100.00%), Query Frame = -1
Query: 1687 QGVGVTGPLIDSEGFPLNNVDLFSIREARLKHNC 1788
            QGVGVTGPLIDSEGFPLNNVDLFSIREARLKHNC
Sbjct:   21 QGVGVTGPLIDSEGFPLNNVDLFSIREARLKHNC 54          

HSP 3 Score: 69.707 bits (169), Expect = 2.007e-13
Identity = 34/34 (100.00%), Postives = 34/34 (100.00%), Query Frame = -1
Query: 1270 GLRVGDELLQLDSVTKETFTDLPAIMELLRSRAN 1371
            GLRVGDELLQLDSVTKETFTDLPAIMELLRSRAN
Sbjct:  128 GLRVGDELLQLDSVTKETFTDLPAIMELLRSRAN 161          
BLAST of 60S ribosomal protein L6 vs. Planmine SMEST
Match: SMESG000019834.1 (SMESG000019834.1)

HSP 1 Score: 199.519 bits (506), Expect = 1.202e-66
Identity = 111/176 (63.07%), Postives = 117/176 (66.48%), Query Frame = -3
Query: 1121 LQNDLRAIMLDIESKLHEIHALNIRTEANNPIDNSGEIVHTETGNDGSAIFIARHPPFARVSRVDQASVADQCVSISIN*HG*IEMCSXXXXXXXXXXXX**RYQRNVYGSASNYGIVALSCQCKSTFFNWN*SLFIV---F*KMVLVCVKRCNKRVHLTIVPPLTGPIGCMLVPI 1639
            LQNDLRAIMLDIESKLHEIHALNIRTEANNPIDNSGEIVHTETGNDGSAIFIARHPPFARVSRVDQASVADQC                                    G      ++ L    K TF +    + ++     KMVLVCVKRCNKRVHLTIVPPLTGPIGCMLVPI
Sbjct:   65 LQNDLRAIMLDIESKLHEIHALNIRTEANNPIDNSGEIVHTETGNDGSAIFIARHPPFARVSRVDQASVADQC------------------------------------GLRVGDELLQLDSVTKETFTDLPAIMELLRSRANKMVLVCVKRCNKRVHLTIVPPLTGPIGCMLVPI 204          

HSP 2 Score: 74.3294 bits (181), Expect = 1.202e-66
Identity = 34/34 (100.00%), Postives = 34/34 (100.00%), Query Frame = -1
Query: 1687 QGVGVTGPLIDSEGFPLNNVDLFSIREARLKHNC 1788
            QGVGVTGPLIDSEGFPLNNVDLFSIREARLKHNC
Sbjct:   31 QGVGVTGPLIDSEGFPLNNVDLFSIREARLKHNC 64          

HSP 3 Score: 69.707 bits (169), Expect = 2.256e-13
Identity = 34/34 (100.00%), Postives = 34/34 (100.00%), Query Frame = -1
Query: 1270 GLRVGDELLQLDSVTKETFTDLPAIMELLRSRAN 1371
            GLRVGDELLQLDSVTKETFTDLPAIMELLRSRAN
Sbjct:  138 GLRVGDELLQLDSVTKETFTDLPAIMELLRSRAN 171          
BLAST of 60S ribosomal protein L6 vs. Planmine SMEST
Match: SMESG000076172.1 (SMESG000076172.1)

HSP 1 Score: 204.527 bits (519), Expect = 3.020e-62
Identity = 103/179 (57.54%), Postives = 129/179 (72.07%), Query Frame = 2
Query:  221 KSYPVQSQKKVSKNRKKPFSAHKKRLREKIKPGVVLILLSGIHRGKRVIFLKQLSSGLLLVTGPYKLNGCPIRRVHQKMVIATSTKLDIGELEIPDHLKDDYFAREPQQDEKLSSDVNNIFAKSKKNYVVKEKRKEDQKKIDSQILKAIKKRDDKATFSKYLKTSFSLSSHDYPHKMEF 757
            +SYP+ +  K   NR K FS HK+RLR  I PG VLILL+G +RG RV+FLKQLSSGLLLV GP+KLN  P+RRVHQ  VIAT TK+DI  +EIP+ ++D YF    Q+ EK  +  ++IFA  K+ YV+ ++RK DQK IDS I+KAIK+R+DK    KYL+T FSLS  D PHKM F
Sbjct:   13 RSYPLNAVMKKKANRTKLFSEHKRRLRSTITPGTVLILLTGRYRGTRVVFLKQLSSGLLLVNGPFKLNKVPMRRVHQNYVIATGTKIDISSIEIPERIEDAYF----QKAEKSKTKSDDIFAAKKQEYVLSDERKADQKLIDSAIVKAIKEREDKGVLVKYLRTPFSLSHGDKPHKMTF 187          
The following BLAST results are available for this feature:
BLAST of 60S ribosomal protein L6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RPL69.873e-4847.37ribosomal protein L6 [Source:HGNC Symbol;Acc:HGNC:... [more]
RPL69.873e-4847.37ribosomal protein L6 [Source:HGNC Symbol;Acc:HGNC:... [more]
RPL61.609e-1455.74ribosomal protein L6 [Source:HGNC Symbol;Acc:HGNC:... [more]
PSMD91.360e-743.90proteasome 26S subunit, non-ATPase 9 [Source:HGNC ... [more]
PSMD91.774e-743.90proteasome 26S subunit, non-ATPase 9 [Source:HGNC ... [more]
back to top
BLAST of 60S ribosomal protein L6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
rpl-69.358e-4548.5560S ribosomal protein L6 [Source:UniProtKB/Swiss-... [more]
rpl-69.358e-4548.5560S ribosomal protein L6 [Source:UniProtKB/Swiss-... [more]
rpl-69.358e-4548.5560S ribosomal protein L6 [Source:UniProtKB/Swiss-... [more]
rpl-69.358e-4548.5560S ribosomal protein L6 [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of 60S ribosomal protein L6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
RpL61.118e-5045.92gene:FBgn0039857 transcript:FBtr0085804[more]
RpL62.246e-5047.80gene:FBgn0039857 transcript:FBtr0085805[more]
back to top
BLAST of 60S ribosomal protein L6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rpl65.503e-4447.54ribosomal protein L6 [Source:ZFIN;Acc:ZDB-GENE-030... [more]
rpl65.503e-4447.54ribosomal protein L6 [Source:ZFIN;Acc:ZDB-GENE-030... [more]
rpl65.503e-4447.54ribosomal protein L6 [Source:ZFIN;Acc:ZDB-GENE-030... [more]
psmd91.166e-954.55proteasome 26S subunit, non-ATPase 9 [Source:ZFIN;... [more]
psmd91.220e-954.55proteasome 26S subunit, non-ATPase 9 [Source:ZFIN;... [more]
back to top
BLAST of 60S ribosomal protein L6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mrrf2.548e-3454.26mitochondrial ribosome recycling factor [Source:Xe... [more]
back to top
BLAST of 60S ribosomal protein L6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Rpl63.114e-4948.33ribosomal protein L6 [Source:MGI Symbol;Acc:MGI:10... [more]
Rpl61.128e-1473.33ribosomal protein L6 [Source:MGI Symbol;Acc:MGI:10... [more]
Psmd93.233e-643.90proteasome (prosome, macropain) 26S subunit, non-A... [more]
Psmd94.263e-648.48proteasome (prosome, macropain) 26S subunit, non-A... [more]
back to top
BLAST of 60S ribosomal protein L6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P21533|RL6_RAT5.527e-5049.2760S ribosomal protein L6 OS=Rattus norvegicus OX=1... [more]
sp|Q2YGT9|RL6_PIG8.714e-4948.3360S ribosomal protein L6 OS=Sus scrofa OX=9823 GN=... [more]
sp|P47911|RL6_MOUSE2.178e-4848.3360S ribosomal protein L6 OS=Mus musculus OX=10090 ... [more]
sp|Q6QMZ4|RL6_CHILA6.175e-4847.8560S ribosomal protein L6 OS=Chinchilla lanigera OX... [more]
sp|Q58DQ3|RL6_BOVIN1.283e-4746.8960S ribosomal protein L6 OS=Bos taurus OX=9913 GN=... [more]
back to top
BLAST of 60S ribosomal protein L6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2I9LPM63.744e-5354.1060S ribosomal protein L6 OS=Centruroides hentzi OX... [more]
A0A0B6XXD31.298e-5250.55Uncharacterized protein (Fragment) OS=Arion vulgar... [more]
A0A1W7R9Q11.568e-5253.5560S ribosomal protein L6 OS=Hadrurus spadix OX=141... [more]
A0A1Z5LG562.861e-5251.9160S ribosomal protein L6 (Fragment) OS=Ornithodoro... [more]
A0A3S1BKF42.896e-5249.45Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
back to top
BLAST of 60S ribosomal protein L6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rpl61.369e-4447.54ribosomal protein L6 [Source:NCBI gene;Acc:1030325... [more]
psmd93.276e-947.62proteasome 26S subunit, non-ATPase 9 [Source:NCBI ... [more]
back to top
BLAST of 60S ribosomal protein L6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 60S ribosomal protein L6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
RPL6A1.519e-3138.92Ribosomal 60S subunit protein L6A; N-terminally ac... [more]
RPL6B2.198e-3039.66Ribosomal 60S subunit protein L6B; binds 5.8S rRNA... [more]
back to top
BLAST of 60S ribosomal protein L6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO413732.965e-4148.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 60S ribosomal protein L6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rpl62.127e-4748.08ribosomal protein L6 [Source:NCBI gene;Acc:1011721... [more]
ENSORLT00000027450.11.642e-1332.21pep primary_assembly:ASM223467v1:10:1314901:131831... [more]
ENSORLT00000027419.12.118e-1332.21pep primary_assembly:ASM223467v1:10:1314901:131726... [more]
ENSORLT00000041303.12.713e-1332.21pep primary_assembly:ASM223467v1:10:1314901:131646... [more]
ENSORLT00000045286.12.817e-1332.21pep primary_assembly:ASM223467v1:10:1314901:131964... [more]
back to top
BLAST of 60S ribosomal protein L6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000019835.14.628e-143100.00SMESG000019835.1[more]
SMESG000019834.11.019e-6663.07SMESG000019834.1[more]
SMESG000019834.11.202e-6663.07SMESG000019834.1[more]
SMESG000076172.13.020e-6257.54SMESG000076172.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010969 ID=SMED30010969|Name=60S ribosomal protein L6|organism=Schmidtea mediterranea sexual|type=transcript|length=1851bp
CTGCTGTAAAGGAAATTGATGAGTAATTTTAAATATTTTTTATAATCAAT
ATTTAATTTCTATTGAGTAATATCCATTTTGCATTTATAAAGTTGCATAA
TTATCATTATTTTGTTGATACTGTAAATTTAGGGAAATGATTGAACCCGT
GAAGCTTGCTACGGAAAGTAAGACAACTAGTGCTGTTAAAAAGACAACTG
AATCCAAAGGAAAGATTCGAAAATCATATCCTGTCCAAAGTCAAAAGAAG
GTGTCCAAAAATCGGAAAAAGCCATTTTCTGCGCATAAAAAACGGTTACG
AGAGAAAATTAAACCTGGAGTTGTATTGATTTTGCTATCGGGAATTCATC
GTGGCAAACGAGTCATCTTCCTTAAGCAGTTGTCATCCGGATTGCTGCTC
GTAACTGGACCATACAAACTGAATGGCTGTCCAATTCGTCGTGTCCACCA
AAAAATGGTCATTGCTACGTCGACTAAACTCGACATCGGTGAACTAGAAA
TTCCGGATCATTTGAAAGACGATTATTTCGCTCGAGAACCCCAACAAGAC
GAGAAGTTAAGTTCCGATGTAAATAACATTTTCGCAAAATCGAAAAAGAA
TTATGTTGTCAAGGAGAAGCGTAAAGAAGATCAGAAAAAGATTGATTCGC
AAATTCTCAAAGCGATCAAAAAGCGGGATGACAAAGCGACATTTAGTAAA
TATTTGAAAACGTCGTTCTCGCTGTCGTCTCATGATTATCCGCATAAAAT
GGAATTTTGATGTGCAATAAATGTTGGAGTGTTGTAAATGTTGTTTTTTT
TAAAAATAAATTATCATGGCTCTGCATGTTCTTTCAGCTGTTGCTTTATG
AATCTATGAAAAATGCAATGTCGCTATGGATATGGTTTTGGCGAATGAAT
CGTTTTTACTGATTGAAATTATTTGCGCGGTATCTGCTGTCTGACAAATC
AACGGAACATATAGACTAAGTGTATACGAGACATGTCACAACAGCTTATT
CTGTAATCGTTGCAGCTGCCAGAAACTCCTCAATAAAATATTTCAAACAA
TCAATAACGTTCCAAAATACAAATGAAGTCAAAGCAAAATTTATTCAAAA
TATTGATCCCATCAGTCCTAGATCGGCACGAGCATGCATCCGATGGGGCC
CGTCAAGGGTGGAACAATAGTCAAATGAACTCGCTTGTTGCACCGCTTGA
CACAGACAAGCACCATTTTCTAGAATACAATAAATAAACTTTAATTCCAA
TTGAAAAATGTCGACTTACATTGGCACGAGAGCGCAACAATTCCATAATT
GCTGGCAGATCCGTAAACGTTTCTTTGGTAACGCTATCAAGTTGTAGCAA
TTCGTCACCCACGCGCAGCCCCTGCGGAACACATTTCAATTTACCCATGT
CAATTGATTGATATACTCACGCATTGATCCGCCACTGAAGCTTGATCTAC
CCGACTCACTCTCGCAAATGGTGGGTGGCGAGCAATAAATATTGCTGATC
CGTCATTGCCAGTTTCTGTATGCACAATTTCTCCTGAATTGTCAATTGGA
TTATTGGCCTCCGTCCTAATATTCAATGCGTGAATTTCATGCAATTTGCT
TTCAATATCCAACATGATCGCTCTCAAATCATTTTGCAAGCCTAAACATC
ACAGTTTTATTAACCTCTACACTAAATATTTAAATTACAATTATGCTTCA
ATCTCGCTTCTCTAATAGAAAATAGATCAACATTATTAAGTGGAAAACCT
TCTGAGTCGATTAATGGCCCTGTTACACCAACTCCTTGCTAAACTTGACA
ATTAAAATAATTGAATTTAAATAAAAATTGAATTTACCGAAAAAAAAAGA
T
back to top

protein sequence of SMED30010969-orf-1

>SMED30010969-orf-1 ID=SMED30010969-orf-1|Name=SMED30010969-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=208bp
MIEPVKLATESKTTSAVKKTTESKGKIRKSYPVQSQKKVSKNRKKPFSAH
KKRLREKIKPGVVLILLSGIHRGKRVIFLKQLSSGLLLVTGPYKLNGCPI
RRVHQKMVIATSTKLDIGELEIPDHLKDDYFAREPQQDEKLSSDVNNIFA
KSKKNYVVKEKRKEDQKKIDSQILKAIKKRDDKATFSKYLKTSFSLSSHD
YPHKMEF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000019muscle progenitor cell
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000110pharynx progenitor cell
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR041997KOW_RPL6
IPR014722Rib_L2_dom2
IPR00091560S_ribosomal_L6E
IPR008991Translation_prot_SH3-like_sf
Vocabulary: biological process
TermDefinition
GO:0006412translation
Vocabulary: molecular function
TermDefinition
GO:0003735structural constituent of ribosome
Vocabulary: cellular component
TermDefinition
GO:0005840ribosome
GO:0005622intracellular
GO:0030529intracellular ribonucleoprotein complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR00091560S ribosomal protein L6EPFAMPF01159Ribosomal_L6ecoord: 95..207
e-value: 2.8E-36
score: 124.4
IPR00091560S ribosomal protein L6EPANTHERPTHR1071560S RIBOSOMAL PROTEIN L6coord: 11..207
IPR014722Ribosomal protein L2, domain 2GENE3DG3DSA:2.30.30.30coord: 56..134
e-value: 3.4E-9
score: 38.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..50
NoneNo IPR availablePANTHERPTHR10715:SF060S RIBOSOMAL PROTEIN L6coord: 11..207
IPR041997Ribosomal Protein L6, KOW domainCDDcd13156KOW_RPL6coord: 50..207
e-value: 6.7246E-70
score: 208.171
IPR008991Translation protein SH3-like domain superfamilySUPERFAMILYSSF50104Translation proteins SH3-like domaincoord: 56..132