Type II pantothenate kinase

Overview
NameType II pantothenate kinase
Smed IDSMED30010964
Length (bp)1183
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Type II pantothenate kinase (SMED30010964) t-SNE clustered cells

Violin plots show distribution of expression levels for Type II pantothenate kinase (SMED30010964) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Type II pantothenate kinase (SMED30010964) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Type II pantothenate kinase (SMED30010964) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010964

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30010964h1SMcG0016857 Contig5175GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Smed sexual biotypeSMED30010964h1SMcG0013262 Contig49235uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010964h1SMcG0013262 Contig49235newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010964h1SMcG0016857 Contig49235uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010964h1SMcG0016857 Contig49235newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30010964h1SMcG0016857 dd_Smed_v4_3794_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Type II pantothenate kinase vs. Ensembl Human
Match: PANK4 (pantothenate kinase 4 (inactive) [Source:HGNC Symbol;Acc:HGNC:19366])

HSP 1 Score: 73.559 bits (179), Expect = 1.767e-13
Identity = 67/257 (26.07%), Postives = 116/257 (45.14%), Query Frame = 1
Query:  199 FKNEDIEKALEWLKENAYIQEGTRYEIHCTGTGCLRNKKQIESTFELGLIFVQEGLALIAGHKIALEHCPLENLIHPPTSADELYEIDNNILKTMLTRMQKRINTDTNSNKTSLYPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGKFPPELPVFQFGKCAENNQDLKYYSKDDLAMSLICLESSQISS-NCRNAALTTKTKKIYLSG 966
            F+N  IE  L+++K++  +   T+  I  TG G  + K  IE    L +        LI G    L++ P E  ++   S  E              R Q        +N   ++P++L   GSG SI   + + + + +G    GG +F G+   L  +  +DE++  AS+G   N+D L++D+     ++        L    FGK A  +Q+   +SK+D+A SL+ + S+ I    C +A L +   ++Y  G
Sbjct:   96 FENTYIEACLDFIKDH-LVNTETKV-IQATGGGAYKFKDLIEEKLRLKVDKEDVMTCLIKGCNFVLKNIPHEAFVYQKDSDPEF-------------RFQ--------TNHPHIFPYLLVNIGSGVSIVKVETEDRFEWVGGSSIGGGTFWGLGALLTKTKKFDELLHLASRGQHSNVDMLVRDVYGGAHQTL--GLSGNLIASSFGKSATADQE---FSKEDMAKSLLHMISNDIGQLACLHARLHS-LDRVYFGG 323          
BLAST of Type II pantothenate kinase vs. Ensembl Human
Match: PANK4 (pantothenate kinase 4 (inactive) [Source:HGNC Symbol;Acc:HGNC:19366])

HSP 1 Score: 73.559 bits (179), Expect = 1.767e-13
Identity = 67/257 (26.07%), Postives = 116/257 (45.14%), Query Frame = 1
Query:  199 FKNEDIEKALEWLKENAYIQEGTRYEIHCTGTGCLRNKKQIESTFELGLIFVQEGLALIAGHKIALEHCPLENLIHPPTSADELYEIDNNILKTMLTRMQKRINTDTNSNKTSLYPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGKFPPELPVFQFGKCAENNQDLKYYSKDDLAMSLICLESSQISS-NCRNAALTTKTKKIYLSG 966
            F+N  IE  L+++K++  +   T+  I  TG G  + K  IE    L +        LI G    L++ P E  ++   S  E              R Q        +N   ++P++L   GSG SI   + + + + +G    GG +F G+   L  +  +DE++  AS+G   N+D L++D+     ++        L    FGK A  +Q+   +SK+D+A SL+ + S+ I    C +A L +   ++Y  G
Sbjct:   96 FENTYIEACLDFIKDH-LVNTETKV-IQATGGGAYKFKDLIEEKLRLKVDKEDVMTCLIKGCNFVLKNIPHEAFVYQKDSDPEF-------------RFQ--------TNHPHIFPYLLVNIGSGVSIVKVETEDRFEWVGGSSIGGGTFWGLGALLTKTKKFDELLHLASRGQHSNVDMLVRDVYGGAHQTL--GLSGNLIASSFGKSATADQE---FSKEDMAKSLLHMISNDIGQLACLHARLHS-LDRVYFGG 323          
BLAST of Type II pantothenate kinase vs. Ensembl Human
Match: PANK4 (pantothenate kinase 4 (inactive) [Source:HGNC Symbol;Acc:HGNC:19366])

HSP 1 Score: 73.559 bits (179), Expect = 1.807e-13
Identity = 67/257 (26.07%), Postives = 116/257 (45.14%), Query Frame = 1
Query:  199 FKNEDIEKALEWLKENAYIQEGTRYEIHCTGTGCLRNKKQIESTFELGLIFVQEGLALIAGHKIALEHCPLENLIHPPTSADELYEIDNNILKTMLTRMQKRINTDTNSNKTSLYPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGKFPPELPVFQFGKCAENNQDLKYYSKDDLAMSLICLESSQISS-NCRNAALTTKTKKIYLSG 966
            F+N  IE  L+++K++  +   T+  I  TG G  + K  IE    L +        LI G    L++ P E  ++   S  E              R Q        +N   ++P++L   GSG SI   + + + + +G    GG +F G+   L  +  +DE++  AS+G   N+D L++D+     ++        L    FGK A  +Q+   +SK+D+A SL+ + S+ I    C +A L +   ++Y  G
Sbjct:  104 FENTYIEACLDFIKDH-LVNTETKV-IQATGGGAYKFKDLIEEKLRLKVDKEDVMTCLIKGCNFVLKNIPHEAFVYQKDSDPEF-------------RFQ--------TNHPHIFPYLLVNIGSGVSIVKVETEDRFEWVGGSSIGGGTFWGLGALLTKTKKFDELLHLASRGQHSNVDMLVRDVYGGAHQTL--GLSGNLIASSFGKSATADQE---FSKEDMAKSLLHMISNDIGQLACLHARLHS-LDRVYFGG 331          
BLAST of Type II pantothenate kinase vs. Ensembl Human
Match: PANK4 (pantothenate kinase 4 (inactive) [Source:HGNC Symbol;Acc:HGNC:19366])

HSP 1 Score: 65.855 bits (159), Expect = 5.328e-11
Identity = 42/150 (28.00%), Postives = 77/150 (51.33%), Query Frame = 1
Query:  520 NSNKTSLYPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGKFPPELPVFQFGKCAENNQDLKYYSKDDLAMSLICLESSQISS-NCRNAALTTKTKKIYLSG 966
             +N   ++P++L   GSG SI   + + + + +G    GG +F G+   L  +  +DE++  AS+G   N+D L++D+     ++        L    FGK A  +Q+   +SK+D+A SL+ + S+ I    C +A L +   ++Y  G
Sbjct:  141 QTNHPHIFPYLLVNIGSGVSIVKVETEDRFEWVGGSSIGGGTFWGLGALLTKTKKFDELLHLASRGQHSNVDMLVRDVYGGAHQTL--GLSGNLIASSFGKSATADQE---FSKEDMAKSLLHMISNDIGQLACLHARLHS-LDRVYFGG 284          
BLAST of Type II pantothenate kinase vs. Ensembl Human
Match: PANK4 (pantothenate kinase 4 (inactive) [Source:HGNC Symbol;Acc:HGNC:19366])

HSP 1 Score: 65.855 bits (159), Expect = 5.328e-11
Identity = 42/150 (28.00%), Postives = 77/150 (51.33%), Query Frame = 1
Query:  520 NSNKTSLYPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGKFPPELPVFQFGKCAENNQDLKYYSKDDLAMSLICLESSQISS-NCRNAALTTKTKKIYLSG 966
             +N   ++P++L   GSG SI   + + + + +G    GG +F G+   L  +  +DE++  AS+G   N+D L++D+     ++        L    FGK A  +Q+   +SK+D+A SL+ + S+ I    C +A L +   ++Y  G
Sbjct:  141 QTNHPHIFPYLLVNIGSGVSIVKVETEDRFEWVGGSSIGGGTFWGLGALLTKTKKFDELLHLASRGQHSNVDMLVRDVYGGAHQTL--GLSGNLIASSFGKSATADQE---FSKEDMAKSLLHMISNDIGQLACLHARLHS-LDRVYFGG 284          
BLAST of Type II pantothenate kinase vs. Ensembl Celegans
Match: pnk-1 (PaNtothenate Kinase [Source:UniProtKB/TrEMBL;Acc:H2KYP7])

HSP 1 Score: 66.2402 bits (160), Expect = 1.108e-11
Identity = 78/324 (24.07%), Postives = 133/324 (41.05%), Query Frame = 1
Query:  130 VNKQNRCQLYDESTHH-INFQYSIFKNEDIEKALEWLKENAYIQEGTRYEIHCTGTGCLRNKKQIESTFELGLIFVQEGLALIAGHKIALEHCPLENLIHPPTSADELYEIDNNILKTMLTRMQKR-INTDTNSNKTSLYPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDIL--ISDEKSPYGKFPPELPVFQFGKCA--ENNQDLKYYSKDDLAMSLICLESSQISSNCRNAALTTKTKKIYLSGNTFKSSLFHKEILNRNLRHPIGVEYTFLDLGYATALGAM 1083
            +N   R   Y++     +NF+    K  D+++ + +LKE  +        IHCTG G  +  + I     + L    E  +LI G    L            T+ DE +   ++ +     + Q R I  D       +YPF+L   G+G SI   D     +++G    GG +F+G+   L  + ++DE++  A++G+ +N+D L+ DI     DE         +L      KC   E     + +  +D+A SL+ + S+ I             K+IY  G   +        L+  + +    E   L L +   LGAM
Sbjct:   96 LNGHTRKYAYEDGKRVLVNFK----KFTDMDRFINFLKE-VWTDRKRGDVIHCTGGGSYKYSEIIMKELGVRLQRTDEMRSLIFGVNFLLS-----------TNVDESFTYHHDAIGR--NKFQYRPIAADL------IYPFLLVNIGTGISILKVDSPTSYERVGGSSMGGGTFMGLGSLLTPAQNFDELLEMANRGDHRNVDKLVCDIYGGAYDELG----LKADLIAGSMAKCNRFEETTKKQQHKPEDIAKSLLLMVSNNIGQMAYLYGTRYNLKRIYFGGYFIRQDPITMRTLSFAINYWSKGEIEALYLKHEGYLGAM 391          
BLAST of Type II pantothenate kinase vs. Ensembl Celegans
Match: pnk-1 (PaNtothenate Kinase [Source:UniProtKB/TrEMBL;Acc:H2KYP7])

HSP 1 Score: 66.2402 bits (160), Expect = 1.108e-11
Identity = 78/324 (24.07%), Postives = 133/324 (41.05%), Query Frame = 1
Query:  130 VNKQNRCQLYDESTHH-INFQYSIFKNEDIEKALEWLKENAYIQEGTRYEIHCTGTGCLRNKKQIESTFELGLIFVQEGLALIAGHKIALEHCPLENLIHPPTSADELYEIDNNILKTMLTRMQKR-INTDTNSNKTSLYPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDIL--ISDEKSPYGKFPPELPVFQFGKCA--ENNQDLKYYSKDDLAMSLICLESSQISSNCRNAALTTKTKKIYLSGNTFKSSLFHKEILNRNLRHPIGVEYTFLDLGYATALGAM 1083
            +N   R   Y++     +NF+    K  D+++ + +LKE  +        IHCTG G  +  + I     + L    E  +LI G    L            T+ DE +   ++ +     + Q R I  D       +YPF+L   G+G SI   D     +++G    GG +F+G+   L  + ++DE++  A++G+ +N+D L+ DI     DE         +L      KC   E     + +  +D+A SL+ + S+ I             K+IY  G   +        L+  + +    E   L L +   LGAM
Sbjct:   96 LNGHTRKYAYEDGKRVLVNFK----KFTDMDRFINFLKE-VWTDRKRGDVIHCTGGGSYKYSEIIMKELGVRLQRTDEMRSLIFGVNFLLS-----------TNVDESFTYHHDAIGR--NKFQYRPIAADL------IYPFLLVNIGTGISILKVDSPTSYERVGGSSMGGGTFMGLGSLLTPAQNFDELLEMANRGDHRNVDKLVCDIYGGAYDELG----LKADLIAGSMAKCNRFEETTKKQQHKPEDIAKSLLLMVSNNIGQMAYLYGTRYNLKRIYFGGYFIRQDPITMRTLSFAINYWSKGEIEALYLKHEGYLGAM 391          
BLAST of Type II pantothenate kinase vs. Ensembl Celegans
Match: pnk-1 (PaNtothenate Kinase [Source:UniProtKB/TrEMBL;Acc:H2KYP7])

HSP 1 Score: 65.855 bits (159), Expect = 1.510e-11
Identity = 78/328 (23.78%), Postives = 133/328 (40.55%), Query Frame = 1
Query:  130 VNKQNRCQLYDESTHH-INFQYSIFKNEDIEKALEWLKENAYIQEGTRYEIHCTGTGCLRNKKQIESTFELGLIFVQEGLALIAGHKIALEHCPLENLIHPPTSADELYEIDNNILKTMLTRMQKR-INTDTNSNKTSLYPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYG------KFPPELPVFQFGKCA--ENNQDLKYYSKDDLAMSLICLESSQISSNCRNAALTTKTKKIYLSGNTFKSSLFHKEILNRNLRHPIGVEYTFLDLGYATALGAM 1083
            +N   R   Y++     +NF+    K  D+++ + +LKE  +        IHCTG G  +  + I     + L    E  +LI G    L            T+ DE +   ++ +     + Q R I  D       +YPF+L   G+G SI   D     +++G    GG +F+G+   L  + ++DE++  A++G+ +N+D L+ DI        YG          +L      KC   E     + +  +D+A SL+ + S+ I             K+IY  G   +        L+  + +    E   L L +   LGAM
Sbjct:  142 LNGHTRKYAYEDGKRVLVNFK----KFTDMDRFINFLKE-VWTDRKRGDVIHCTGGGSYKYSEIIMKELGVRLQRTDEMRSLIFGVNFLLS-----------TNVDESFTYHHDAIGR--NKFQYRPIAADL------IYPFLLVNIGTGISILKVDSPTSYERVGGSSMGGGTFMGLGSLLTPAQNFDELLEMANRGDHRNVDKLVCDI--------YGGAYDELGLKADLIAGSMAKCNRFEETTKKQQHKPEDIAKSLLLMVSNNIGQMAYLYGTRYNLKRIYFGGYFIRQDPITMRTLSFAINYWSKGEIEALYLKHEGYLGAM 437          
BLAST of Type II pantothenate kinase vs. Ensembl Celegans
Match: pnk-1 (PaNtothenate Kinase [Source:UniProtKB/TrEMBL;Acc:H2KYP7])

HSP 1 Score: 62.3882 bits (150), Expect = 1.863e-10
Identity = 63/252 (25.00%), Postives = 109/252 (43.25%), Query Frame = 1
Query:  178 INFQYSIFKNEDIEKALEWLKENAYIQEGTRYEIHCTGTGCLRNKKQIESTFELGLIFVQEGLALIAGHKIALEHCPLENLIHPPTSADELYEIDNNILKTMLTRMQKR-INTDTNSNKTSLYPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYG------KFPPELPVFQFGKCA--ENNQDLKYYSKDDLAMSLICLESSQI 906
            +NF+    K  D+++ + +LKE  +        IHCTG G  +  + I     + L    E  +LI G    L            T+ DE +   ++ +     + Q R I  D       +YPF+L   G+G SI   D     +++G    GG +F+G+   L  + ++DE++  A++G+ +N+D L+ DI        YG          +L      KC   E     + +  +D+A SL+ + S+ I
Sbjct:  159 VNFK----KFTDMDRFINFLKE-VWTDRKRGDVIHCTGGGSYKYSEIIMKELGVRLQRTDEMRSLIFGVNFLLS-----------TNVDESFTYHHDAIGR--NKFQYRPIAADL------IYPFLLVNIGTGISILKVDSPTSYERVGGSSMGGGTFMGLGSLLTPAQNFDELLEMANRGDHRNVDKLVCDI--------YGGAYDELGLKADLIAGSMAKCNRFEETTKKQQHKPEDIAKSLLLMVSNNI 378          
BLAST of Type II pantothenate kinase vs. Ensembl Fly
Match: fbl (gene:FBgn0011205 transcript:FBtr0307392)

HSP 1 Score: 67.781 bits (164), Expect = 3.387e-12
Identity = 56/194 (28.87%), Postives = 89/194 (45.88%), Query Frame = 1
Query:  541 YPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGKF--PPELPVFQFGKCAENNQDLKYYSKDDLAMSLICLESSQISSNCRNAALTTKTKKIYLSGNTFKSSLFHKEILNRNLRHPIGVEYTFLDL---GYATALGAMFCVNQERA 1107
            +PF+L   GSG SI         ++I     GG +FLG+   L     ++E I  A+KG+ + +D L+KDI   D    Y +F  P +L    FG+   N++ +   S++DLA + +   ++ I S  R  AL  K  ++   GN  + +    ++L   +          L L   GY  ALG +   N E A
Sbjct:  111 FPFILVNVGSGVSILAVYGPDNYKRISGTSLGGGTFLGLCCLLTGCTSFEEAIQLATKGDNRKVDKLVKDIYGGD----YNRFGLPGDLVASSFGQMHLNDKRVS-VSREDLANATLVTITNNIGSIARMCALNEKIDRVVFVGNFLRVNPISMKLLAYAMEFWSNGTMKGLFLEHEGYFGALGCLLQFNGELA 299          
BLAST of Type II pantothenate kinase vs. Ensembl Fly
Match: fbl (gene:FBgn0011205 transcript:FBtr0078188)

HSP 1 Score: 67.781 bits (164), Expect = 4.199e-12
Identity = 57/199 (28.64%), Postives = 91/199 (45.73%), Query Frame = 1
Query:  526 NKTSLYPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGKF--PPELPVFQFGKCAENNQDLKYYSKDDLAMSLICLESSQISSNCRNAALTTKTKKIYLSGNTFKSSLFHKEILNRNLRHPIGVEYTFLDL---GYATALGAMFCVNQERA 1107
            N +  +PF+L   GSG SI         ++I     GG +FLG+   L     ++E I  A+KG+ + +D L+KDI   D    Y +F  P +L    FG+   N++ +   S++DLA + +   ++ I S  R  AL  K  ++   GN  + +    ++L   +          L L   GY  ALG +   N E A
Sbjct:  183 NFSQPFPFILVNVGSGVSILAVYGPDNYKRISGTSLGGGTFLGLCCLLTGCTSFEEAIQLATKGDNRKVDKLVKDIYGGD----YNRFGLPGDLVASSFGQMHLNDKRVS-VSREDLANATLVTITNNIGSIARMCALNEKIDRVVFVGNFLRVNPISMKLLAYAMEFWSNGTMKGLFLEHEGYFGALGCLLQFNGELA 376          
BLAST of Type II pantothenate kinase vs. Ensembl Fly
Match: fbl (gene:FBgn0011205 transcript:FBtr0078186)

HSP 1 Score: 67.781 bits (164), Expect = 4.365e-12
Identity = 57/199 (28.64%), Postives = 91/199 (45.73%), Query Frame = 1
Query:  526 NKTSLYPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGKF--PPELPVFQFGKCAENNQDLKYYSKDDLAMSLICLESSQISSNCRNAALTTKTKKIYLSGNTFKSSLFHKEILNRNLRHPIGVEYTFLDL---GYATALGAMFCVNQERA 1107
            N +  +PF+L   GSG SI         ++I     GG +FLG+   L     ++E I  A+KG+ + +D L+KDI   D    Y +F  P +L    FG+   N++ +   S++DLA + +   ++ I S  R  AL  K  ++   GN  + +    ++L   +          L L   GY  ALG +   N E A
Sbjct:  181 NFSQPFPFILVNVGSGVSILAVYGPDNYKRISGTSLGGGTFLGLCCLLTGCTSFEEAIQLATKGDNRKVDKLVKDIYGGD----YNRFGLPGDLVASSFGQMHLNDKRVS-VSREDLANATLVTITNNIGSIARMCALNEKIDRVVFVGNFLRVNPISMKLLAYAMEFWSNGTMKGLFLEHEGYFGALGCLLQFNGELA 374          
BLAST of Type II pantothenate kinase vs. Ensembl Fly
Match: fbl (gene:FBgn0011205 transcript:FBtr0078190)

HSP 1 Score: 67.781 bits (164), Expect = 4.565e-12
Identity = 57/199 (28.64%), Postives = 91/199 (45.73%), Query Frame = 1
Query:  526 NKTSLYPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGKF--PPELPVFQFGKCAENNQDLKYYSKDDLAMSLICLESSQISSNCRNAALTTKTKKIYLSGNTFKSSLFHKEILNRNLRHPIGVEYTFLDL---GYATALGAMFCVNQERA 1107
            N +  +PF+L   GSG SI         ++I     GG +FLG+   L     ++E I  A+KG+ + +D L+KDI   D    Y +F  P +L    FG+   N++ +   S++DLA + +   ++ I S  R  AL  K  ++   GN  + +    ++L   +          L L   GY  ALG +   N E A
Sbjct:  165 NFSQPFPFILVNVGSGVSILAVYGPDNYKRISGTSLGGGTFLGLCCLLTGCTSFEEAIQLATKGDNRKVDKLVKDIYGGD----YNRFGLPGDLVASSFGQMHLNDKRVS-VSREDLANATLVTITNNIGSIARMCALNEKIDRVVFVGNFLRVNPISMKLLAYAMEFWSNGTMKGLFLEHEGYFGALGCLLQFNGELA 358          
BLAST of Type II pantothenate kinase vs. Ensembl Fly
Match: fbl (gene:FBgn0011205 transcript:FBtr0078189)

HSP 1 Score: 67.781 bits (164), Expect = 4.565e-12
Identity = 57/199 (28.64%), Postives = 91/199 (45.73%), Query Frame = 1
Query:  526 NKTSLYPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGKF--PPELPVFQFGKCAENNQDLKYYSKDDLAMSLICLESSQISSNCRNAALTTKTKKIYLSGNTFKSSLFHKEILNRNLRHPIGVEYTFLDL---GYATALGAMFCVNQERA 1107
            N +  +PF+L   GSG SI         ++I     GG +FLG+   L     ++E I  A+KG+ + +D L+KDI   D    Y +F  P +L    FG+   N++ +   S++DLA + +   ++ I S  R  AL  K  ++   GN  + +    ++L   +          L L   GY  ALG +   N E A
Sbjct:  165 NFSQPFPFILVNVGSGVSILAVYGPDNYKRISGTSLGGGTFLGLCCLLTGCTSFEEAIQLATKGDNRKVDKLVKDIYGGD----YNRFGLPGDLVASSFGQMHLNDKRVS-VSREDLANATLVTITNNIGSIARMCALNEKIDRVVFVGNFLRVNPISMKLLAYAMEFWSNGTMKGLFLEHEGYFGALGCLLQFNGELA 358          
BLAST of Type II pantothenate kinase vs. Ensembl Zebrafish
Match: pank4 (pantothenate kinase 4 (inactive) [Source:ZFIN;Acc:ZDB-GENE-040426-1592])

HSP 1 Score: 70.8626 bits (172), Expect = 6.127e-13
Identity = 84/300 (28.00%), Postives = 132/300 (44.00%), Query Frame = 1
Query:  133 NKQNRCQLYDESTHHINFQ-------YSIFKNEDIEKALEWLK-ENAYIQEGTRY-----------EIHCTGTGCLRNKKQIESTFELGLIFVQEGLALIAGHKIALEHCPLENLIHPPTSADELYEIDNNILKTMLTRMQKRINTDTNSNKTSLYPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGK--FPPELPVFQFGKCAENNQDLKYYSKDDLAMSLICLESSQISS-NCRNAALTTKTKKIYLSG 966
            +K  + + +D S   ++FQ       Y I   E+I   L ++K ENAYI+    +            I  TG G  + K  IE   +L +    E   LI G    L++ P E  ++   +  E              R Q   NT  +     ++P++L   GSG SI   + + K ++IG    GG +F G+   L  +  +DE++  ASKG   N+D L+KDI        YG      +L    FGK A  +++   +SK+D+A SL+ + S+ I    C  A L   T ++Y  G
Sbjct:   54 HKVAKVRSFDHSAK-VSFQETDGDPLYEISVQEEITARLHFIKFENAYIETCLDFIKDHLVNTETKVIKATGGGAYKFKDLIEKKLKLKVDKEDEMTCLIKGCNFVLKNIPHEAFVYAKHADSEF-------------RFQ---NTHPD-----IFPYLLINIGSGVSIVKVESEDKFERIGGSSIGGGTFWGLGALLTKTKRFDELLQLASKGQHTNVDMLVKDIY----GGAYGSLGLTGDLIASSFGKSATTDKE---FSKEDMAKSLLHMISNDIGQLACLYAKLHNLT-RVYFGG 323          
BLAST of Type II pantothenate kinase vs. Ensembl Zebrafish
Match: pank4 (pantothenate kinase 4 (inactive) [Source:ZFIN;Acc:ZDB-GENE-040426-1592])

HSP 1 Score: 70.8626 bits (172), Expect = 6.127e-13
Identity = 84/300 (28.00%), Postives = 132/300 (44.00%), Query Frame = 1
Query:  133 NKQNRCQLYDESTHHINFQ-------YSIFKNEDIEKALEWLK-ENAYIQEGTRY-----------EIHCTGTGCLRNKKQIESTFELGLIFVQEGLALIAGHKIALEHCPLENLIHPPTSADELYEIDNNILKTMLTRMQKRINTDTNSNKTSLYPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGK--FPPELPVFQFGKCAENNQDLKYYSKDDLAMSLICLESSQISS-NCRNAALTTKTKKIYLSG 966
            +K  + + +D S   ++FQ       Y I   E+I   L ++K ENAYI+    +            I  TG G  + K  IE   +L +    E   LI G    L++ P E  ++   +  E              R Q   NT  +     ++P++L   GSG SI   + + K ++IG    GG +F G+   L  +  +DE++  ASKG   N+D L+KDI        YG      +L    FGK A  +++   +SK+D+A SL+ + S+ I    C  A L   T ++Y  G
Sbjct:   54 HKVAKVRSFDHSAK-VSFQETDGDPLYEISVQEEITARLHFIKFENAYIETCLDFIKDHLVNTETKVIKATGGGAYKFKDLIEKKLKLKVDKEDEMTCLIKGCNFVLKNIPHEAFVYAKHADSEF-------------RFQ---NTHPD-----IFPYLLINIGSGVSIVKVESEDKFERIGGSSIGGGTFWGLGALLTKTKRFDELLQLASKGQHTNVDMLVKDIY----GGAYGSLGLTGDLIASSFGKSATTDKE---FSKEDMAKSLLHMISNDIGQLACLYAKLHNLT-RVYFGG 323          
BLAST of Type II pantothenate kinase vs. Ensembl Zebrafish
Match: pank4 (pantothenate kinase 4 (inactive) [Source:ZFIN;Acc:ZDB-GENE-040426-1592])

HSP 1 Score: 68.9366 bits (167), Expect = 1.368e-12
Identity = 73/253 (28.85%), Postives = 113/253 (44.66%), Query Frame = 1
Query:  190 YSIFKNEDIEKALEWLK-ENAYIQEGTRY-----------EIHCTGTGCLRNKKQIESTFELGLIFVQEGLALIAGHKIALEHCPLENLIHPPTSADELYEIDNNILKTMLTRMQKRINTDTNSNKTSLYPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGK--FPPELPVFQFGKCAENNQDLKYYSKDDLAMSLICLESSQI 906
            Y I   E+I   L ++K ENAYI+    +            I  TG G  + K  IE   +L +    E   LI G    L++ P E  ++   +  E              R Q   NT  +     ++P++L   GSG SI   + + K ++IG    GG +F G+   L  +  +DE++  ASKG   N+D L+KDI        YG      +L    FGK A  +++   +SK+D+A SL+ + S+ I
Sbjct:   65 YEISVQEEITARLHFIKFENAYIETCLDFIKDHLVNTETKVIKATGGGAYKFKDLIEKKLKLKVDKEDEMTCLIKGCNFVLKNIPHEAFVYAKHADSEF-------------RFQ---NTHPD-----IFPYLLINIGSGVSIVKVESEDKFERIGGSSIGGGTFWGLGALLTKTKRFDELLQLASKGQHTNVDMLVKDIY----GGAYGSLGLTGDLIASSFGKSATTDKE---FSKEDMAKSLLHMISNDI 289          
BLAST of Type II pantothenate kinase vs. Ensembl Zebrafish
Match: pank4 (pantothenate kinase 4 (inactive) [Source:ZFIN;Acc:ZDB-GENE-040426-1592])

HSP 1 Score: 59.3066 bits (142), Expect = 1.761e-9
Identity = 65/231 (28.14%), Postives = 98/231 (42.42%), Query Frame = 1
Query:  190 YSIFKNEDIEKALEWLK-ENAYIQEGTRY-----------EIHCTGTGCLRNKKQIESTFELGLIFVQEGLALIAGHKIALEHCPLENLIHPPTSADELYEIDNNILKTMLTRMQKRINTDTNSNKTSLYPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGK--FPPELPVFQFGKCAENNQ 840
            Y I   E+I   L ++K ENAYI+    +            I  TG G  + K  IE   +L +    E   LI G    L++ P E  ++   +  E              R Q   NT  +     ++P++L   GSG SI   + + K ++IG    GG +F G+   L  +  +DE++  ASKG   N+D L+KDI        YG      +L    FGK A  ++
Sbjct:   75 YEISVQEEITARLHFIKFENAYIETCLDFIKDHLVNTETKVIKATGGGAYKFKDLIEKKLKLKVDKEDEMTCLIKGCNFVLKNIPHEAFVYAKHADSEF-------------RFQ---NTHPD-----IFPYLLINIGSGVSIVKVESEDKFERIGGSSIGGGTFWGLGALLTKTKRFDELLQLASKGQHTNVDMLVKDIY----GGAYGSLGLTGDLIASSFGKSATTDK 280          
BLAST of Type II pantothenate kinase vs. Ensembl Zebrafish
Match: pank2 (pantothenate kinase 2 [Source:ZFIN;Acc:ZDB-GENE-070112-1952])

HSP 1 Score: 59.3066 bits (142), Expect = 3.477e-9
Identity = 51/189 (26.98%), Postives = 85/189 (44.97%), Query Frame = 1
Query:  541 YPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGKF--PPELPVFQFGK--CAENNQDLKYYSKDDLAMSLICLESSQISSNCRNAALTTKTKKIYLSGNTFKSSLFHKEILNRNLRHPIGVEYTFLDL---GYATALGAMF 1086
            YP +L   GSG SI         +++     GG +FLG+   L   + ++E +A A++G    +D L+++I   D    Y +F  P       FG   C E  + +   SK+DLA + +   ++ I S  R  AL    K++   GN  + +    ++L   L +    +   L L   GY  A+GA+ 
Sbjct:  250 YPLLLVNIGSGVSILAVYSKDNYKRVTGTSLGGGTFLGLCCLLTGCSTFEEALAMATEGESTRVDKLVREIYGGD----YERFGLPGWAVASSFGNMMCKEKRESV---SKEDLARATLVTITNNIGSITRMCALNENIKRVVFVGNFLRVNTLSMKLLAYALDYWSKGQLKALFLRHEGYFGAVGALL 431          
BLAST of Type II pantothenate kinase vs. Ensembl Xenopus
Match: ca1 (carbonic anhydrase I [Source:Xenbase;Acc:XB-GENE-957160])

HSP 1 Score: 62.7734 bits (151), Expect = 5.627e-10
Identity = 75/282 (26.60%), Postives = 124/282 (43.97%), Query Frame = 1
Query:  151 QLYDESTHH---INFQYSIFKNEDIEKALEWLKENAYIQEGTRYEIHCTGTGCLRNKKQIESTFELGLIFVQEGLA-LIAGHKIALEHCPLENLIHPPTSADELYEIDNNILKTMLTRMQKRINTDTNSNKTSLYPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYG------KFPPELPVFQFGKCAENNQDLKYYSKDDLAMSLICLESSQISSNCRNAALTTKTKKIYLSG 966
            QLY+ S          +  F+N  IE  L+++K++    E     I  TG G  + K  IE   +LGL + ++ +  LI G    L++ P E  ++   +  E              R Q        +   +++P++L   GSG SI   + + K ++IG    GG +F G+   L  +  +DE++  A+KG+  N+D L+KDI        YG           L    FGK A  ++D   +SK+D+A SL+ + S+ I       A      ++Y  G
Sbjct:   73 QLYEISVQEEITARLHFIKFENAYIEICLDFIKDHLVNTETKV--IKATGGGAYKFKDLIEK--KLGLKYDEDEMTCLIKGCNFVLKNIPHEAFVYVKHADPEF-------------RFQ--------TTHPNIFPYLLVNIGSGVSIVKVEAEDKFERIGGSSIGGGTFWGLGALLTKTKRFDELLQLAAKGHHTNVDMLVKDI--------YGGAYQILGLTGNLIASSFGKSATIDKD---FSKEDMAKSLLHMISNDIGQLACLYAKQHNLSQVYFGG 318          
BLAST of Type II pantothenate kinase vs. Ensembl Xenopus
Match: ca1 (carbonic anhydrase I [Source:Xenbase;Acc:XB-GENE-957160])

HSP 1 Score: 62.7734 bits (151), Expect = 5.758e-10
Identity = 75/282 (26.60%), Postives = 126/282 (44.68%), Query Frame = 1
Query:  151 QLYDESTHH---INFQYSIFKNEDIEKALEWLKENAYIQEGTRYEIHCTGTGCLRNKKQIESTFELGLIFVQEGLA-LIAGHKIALEHCPLENLIHPPTSADELYEIDNNILKTMLTRMQKRINTDTNSNKTSLYPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYG------KFPPELPVFQFGKCAENNQDLKYYSKDDLAMSLICLESSQISSNCRNAALTTKTKKIYLSG 966
            QLY+ S          +  F+N  IE  L+++K++  +   T+  I  TG G  + K  IE   +LGL + ++ +  LI G    L++ P E  ++   +  E              R Q        +   +++P++L   GSG SI   + + K ++IG    GG +F G+   L  +  +DE++  A+KG+  N+D L+KDI        YG           L    FGK A  ++D   +SK+D+A SL+ + S+ I       A      ++Y  G
Sbjct:   76 QLYEISVQEEITARLHFIKFENAYIEICLDFIKDH-LVNTETKV-IKATGGGAYKFKDLIEK--KLGLKYDEDEMTCLIKGCNFVLKNIPHEAFVYVKHADPEF-------------RFQ--------TTHPNIFPYLLVNIGSGVSIVKVEAEDKFERIGGSSIGGGTFWGLGALLTKTKRFDELLQLAAKGHHTNVDMLVKDI--------YGGAYQILGLTGNLIASSFGKSATIDKD---FSKEDMAKSLLHMISNDIGQLACLYAKQHNLSQVYFGG 321          
BLAST of Type II pantothenate kinase vs. Ensembl Xenopus
Match: ca1 (carbonic anhydrase I [Source:Xenbase;Acc:XB-GENE-957160])

HSP 1 Score: 59.6918 bits (143), Expect = 4.791e-9
Identity = 76/285 (26.67%), Postives = 124/285 (43.51%), Query Frame = 1
Query:  151 QLYDESTHH---INFQYSIFKNEDIEKALEWLKENAYIQEGTRYEIHCTGTGCLRNKKQIESTFELGLIFVQEG----LALIAGHKIALEHCPLENLIHPPTSADELYEIDNNILKTMLTRMQKRINTDTNSNKTSLYPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYG------KFPPELPVFQFGKCAENNQDLKYYSKDDLAMSLICLESSQISSNCRNAALTTKTKKIYLSG 966
            QLY+ S          +  F+N  IE  L+++K++  +   T+  I  TG G  + K  IE   +LGL   +E       LI G    L++ P E  ++   +  E              R Q        +   +++P++L   GSG SI   + + K ++IG    GG +F G+   L  +  +DE++  A+KG+  N+D L+KDI        YG           L    FGK A  ++D   +SK+D+A SL+ + S+ I       A      ++Y  G
Sbjct:   77 QLYEISVQEEITARLHFIKFENAYIEICLDFIKDH-LVNTETKV-IKATGGGAYKFKDLIEK--KLGLKVDKEDEDEMTCLIKGCNFVLKNIPHEAFVYVKHADPEF-------------RFQ--------TTHPNIFPYLLVNIGSGVSIVKVEAEDKFERIGGSSIGGGTFWGLGALLTKTKRFDELLQLAAKGHHTNVDMLVKDI--------YGGAYQILGLTGNLIASSFGKSATIDKD---FSKEDMAKSLLHMISNDIGQLACLYAKQHNLSQVYFGG 325          
BLAST of Type II pantothenate kinase vs. Ensembl Xenopus
Match: pank3 (pantothenate kinase 3 [Source:NCBI gene;Acc:100135204])

HSP 1 Score: 58.5362 bits (140), Expect = 6.295e-9
Identity = 50/187 (26.74%), Postives = 84/187 (44.92%), Query Frame = 1
Query:  541 YPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGKF--PPELPVFQFGKCAENNQDLKYYSKDDLAMSLICLESSQISSNCRNAALTTKTKKIYLSGNTFKSSLFHKEILNRNLRHPIGVEYTFLDL---GYATALGAMF 1086
            YP ++   GSG SI   +     +++     GG +FLG+   L     ++E +  AS G+  N D L++DI   D    Y +F  P       FG     ++  +  SK+DLA + +   ++ I S  R +A+  K  K+   GN  + +    ++L   L +    +   L L   GY  A+GA+ 
Sbjct:  183 YPLLVVNIGSGVSILAVNSKDSYKRVCGTSLGGGTFLGLCSLLTGCESFEEALEMASAGDSTNADKLVRDIYGGD----YERFGLPGWAVASSFGNMIYKDKR-ESVSKEDLARATLVTITNNIGSIARMSAVNEKINKVIFVGNFLRVNTLSMKLLAYALDYWSNGQLKALFLEHEGYFGAVGALL 364          
BLAST of Type II pantothenate kinase vs. Ensembl Xenopus
Match: cidea (cell death inducing DFFA like effector a [Source:Xenbase;Acc:XB-GENE-953574])

HSP 1 Score: 55.4546 bits (132), Expect = 7.081e-8
Identity = 42/158 (26.58%), Postives = 72/158 (45.57%), Query Frame = 1
Query:  541 YPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGKFPPELPVF--QFGKCAENNQDLKYYSKDDLAMSLICLESSQISSNCRNAALTTKTKKIYLSGNTFKSSLFHKEILN 1008
            YP +L   GSG SI         +++     GG +FLG+   L     ++E +  A+KG+  N+D L+KDI   D    Y +F  +       FG    + +     SK+DLA + +   ++ I S  R  AL     ++   GN  + ++   ++L+
Sbjct:  179 YPMLLVNIGSGVSILAVYSKDNYKRVTGTSLGGGTFLGLCCLLTGCETFEEALEMAAKGDSTNVDKLVKDIYGGD----YERFSLQGSAVASSFGH-MMSKEKRDSISKEDLARATLVTITNNIGSIARMCALNENIDRVIFVGNFLRINMVSMKLLS 331          
BLAST of Type II pantothenate kinase vs. Ensembl Mouse
Match: Pank4 (pantothenate kinase 4 [Source:MGI Symbol;Acc:MGI:2387466])

HSP 1 Score: 58.9214 bits (141), Expect = 7.073e-9
Identity = 64/256 (25.00%), Postives = 113/256 (44.14%), Query Frame = 1
Query:  199 FKNEDIEKALEWLKENAYIQEGTRYEIHCTGTGCLRNKKQIESTFELGLIFVQEGLALIAGHKIALEHCPLENLIHPPTSADELYEIDNNILKTMLTRMQKRINTDTNSNKTSLYPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGKFPPELPVFQFGKCAENNQDLKYYSKDDLAMSLICLESSQISSNCRNAALTTKTKKIYLSG 966
            F+N  +E  L++++++  +   T+  I  TG G  + K  IE    L +        LI G    L++ P E  ++   S  E              R Q        +N  +++P++L   GSG SI   + + + + IG    GG +F G+   L  +  +DE++  AS+G   N+D L++DI     ++        L    FGK A  +++   +SK+D+A SL+ + S+ I       A      ++Y  G
Sbjct:   96 FENTYMEACLDFIRDH-LVNTETKV-IQATGGGAYKFKDLIEEKLRLKVDKEDVMTCLIKGCNFVLKNIPHEAFMYQKDSDPEF-------------RFQ--------TNHPNIFPYLLVNIGSGVSIVKVETEDRFEWIGGSSIGGGTFWGLGALLTKTKKFDELLQLASRGRHANVDMLVQDIYGGAHQTL--GLSGNLIASSFGKSATADRE---FSKEDMAKSLLHMISNDIGQLACLYAKLHGLDRVYFGG 323          
BLAST of Type II pantothenate kinase vs. Ensembl Mouse
Match: Pank4 (pantothenate kinase 4 [Source:MGI Symbol;Acc:MGI:2387466])

HSP 1 Score: 58.5362 bits (140), Expect = 9.566e-9
Identity = 68/271 (25.09%), Postives = 113/271 (41.70%), Query Frame = 1
Query:  190 YSIFKNEDIEKALEWLK-ENAYIQEGTRY-----------EIHCTGTGCLRNKKQIESTFELGLIFVQEGLALIAGHKIALEHCPLENLIHPPTSADELYEIDNNILKTMLTRMQKRINTDTNSNKTSLYPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGKFPPELPVFQFGKCAENNQDLKYYSKDDLAMSLICLESSQISSNCRNAALTTKTKKIYLSG 966
            Y I   E+I   L ++K EN Y++    +            I  TG G  + K  IE    L +        LI G    L++ P E  ++   S  E              R Q        +N  +++P++L   GSG SI   + + + + IG    GG +F G+   L  +  +DE++  AS+G   N+D L++DI     ++        L    FGK A  +++   +SK+D+A SL+ + S+ I       A      ++Y  G
Sbjct:   79 YEISVQEEITARLHFIKFENTYMEACLDFIRDHLVNTETKVIQATGGGAYKFKDLIEEKLRLKVDKEDVMTCLIKGCNFVLKNIPHEAFMYQKDSDPEF-------------RFQ--------TNHPNIFPYLLVNIGSGVSIVKVETEDRFEWIGGSSIGGGTFWGLGALLTKTKKFDELLQLASRGRHANVDMLVQDIYGGAHQTL--GLSGNLIASSFGKSATADRE---FSKEDMAKSLLHMISNDIGQLACLYAKLHGLDRVYFGG 323          
BLAST of Type II pantothenate kinase vs. Ensembl Mouse
Match: Pank1 (pantothenate kinase 1 [Source:MGI Symbol;Acc:MGI:1922985])

HSP 1 Score: 55.4546 bits (132), Expect = 3.131e-8
Identity = 42/157 (26.75%), Postives = 71/157 (45.22%), Query Frame = 1
Query:  541 YPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGKFPPELPVF--QFGKCAENNQDLKYYSKDDLAMSLICLESSQISSNCRNAALTTKTKKIYLSGNTFKSSLFHKEIL 1005
            YP +L   GSG SI         +++     GG +FLG+   L     ++E +  A+KG+  N+D L+KDI   D    Y +F  +       FG      +  +  SK+DLA + +   ++ I S  R  AL     ++   GN  + ++   ++L
Sbjct:   61 YPMLLVNMGSGVSILAVYSKDNYKRVTGTSLGGGTFLGLCCLLTGCETFEEALDMAAKGDSTNVDKLVKDIYGGD----YERFGLQGSAVASSFGNMMSKEKR-ESISKEDLARATLVTITNNIGSIARMCALNENIDRVVFVGNFLRINMVSMKLL 212          
BLAST of Type II pantothenate kinase vs. Ensembl Mouse
Match: Pank3 (pantothenate kinase 3 [Source:MGI Symbol;Acc:MGI:2387464])

HSP 1 Score: 56.225 bits (134), Expect = 3.388e-8
Identity = 49/188 (26.06%), Postives = 82/188 (43.62%), Query Frame = 1
Query:  541 YPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGKFPPELPVFQFGKCAEN---NQDLKYYSKDDLAMSLICLESSQISSNCRNAALTTKTKKIYLSGNTFKSSLFHKEILNRNLRHPIGVEYTFLDL---GYATALGAMF 1086
            YP ++   GSG SI         +++     GG +FLG+   L     ++E +  ASKG+    D L++DI   D    Y +F   LP +       N    +  +  SK+DLA + +   ++ I S  R  A+  K  ++   GN  + +    ++L   L +    +   L L   GY  A+GA+ 
Sbjct:  183 YPLLVVNIGSGVSILAVHSKDNYKRVTGTSLGGGTFLGLCSLLTGCESFEEALEMASKGDSTQADRLVRDIYGGD----YERF--GLPGWAVASSFGNMIYKEKRETVSKEDLARATLVTITNNIGSVARMCAVNEKINRVVFVGNFLRVNTLSMKLLAYALDYWSKGQLKALFLEHEGYFGAVGALL 364          
BLAST of Type II pantothenate kinase vs. Ensembl Mouse
Match: Pank1 (pantothenate kinase 1 [Source:MGI Symbol;Acc:MGI:1922985])

HSP 1 Score: 55.8398 bits (133), Expect = 4.551e-8
Identity = 42/157 (26.75%), Postives = 71/157 (45.22%), Query Frame = 1
Query:  541 YPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGKFPPELPVF--QFGKCAENNQDLKYYSKDDLAMSLICLESSQISSNCRNAALTTKTKKIYLSGNTFKSSLFHKEIL 1005
            YP +L   GSG SI         +++     GG +FLG+   L     ++E +  A+KG+  N+D L+KDI   D    Y +F  +       FG      +  +  SK+DLA + +   ++ I S  R  AL     ++   GN  + ++   ++L
Sbjct:  183 YPMLLVNMGSGVSILAVYSKDNYKRVTGTSLGGGTFLGLCCLLTGCETFEEALDMAAKGDSTNVDKLVKDIYGGD----YERFGLQGSAVASSFGNMMSKEKR-ESISKEDLARATLVTITNNIGSIARMCALNENIDRVVFVGNFLRINMVSMKLL 334          
BLAST of Type II pantothenate kinase vs. UniProt/SwissProt
Match: sp|Q9NVE7|PANK4_HUMAN (4'-phosphopantetheine phosphatase OS=Homo sapiens OX=9606 GN=PANK4 PE=1 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 8.485e-13
Identity = 67/257 (26.07%), Postives = 116/257 (45.14%), Query Frame = 1
Query:  199 FKNEDIEKALEWLKENAYIQEGTRYEIHCTGTGCLRNKKQIESTFELGLIFVQEGLALIAGHKIALEHCPLENLIHPPTSADELYEIDNNILKTMLTRMQKRINTDTNSNKTSLYPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGKFPPELPVFQFGKCAENNQDLKYYSKDDLAMSLICLESSQISS-NCRNAALTTKTKKIYLSG 966
            F+N  IE  L+++K++  +   T+  I  TG G  + K  IE    L +        LI G    L++ P E  ++   S  E              R Q        +N   ++P++L   GSG SI   + + + + +G    GG +F G+   L  +  +DE++  AS+G   N+D L++D+     ++        L    FGK A  +Q+   +SK+D+A SL+ + S+ I    C +A L +   ++Y  G
Sbjct:   96 FENTYIEACLDFIKDH-LVNTETKV-IQATGGGAYKFKDLIEEKLRLKVDKEDVMTCLIKGCNFVLKNIPHEAFVYQKDSDPEF-------------RFQ--------TNHPHIFPYLLVNIGSGVSIVKVETEDRFEWVGGSSIGGGTFWGLGALLTKTKKFDELLHLASRGQHSNVDMLVRDVYGGAHQTL--GLSGNLIASSFGKSATADQE---FSKEDMAKSLLHMISNDIGQLACLHARLHS-LDRVYFGG 323          
BLAST of Type II pantothenate kinase vs. UniProt/SwissProt
Match: sp|Q5R5F8|PANK4_PONAB (4'-phosphopantetheine phosphatase OS=Pongo abelii OX=9601 GN=PANK4 PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 8.872e-13
Identity = 66/256 (25.78%), Postives = 112/256 (43.75%), Query Frame = 1
Query:  199 FKNEDIEKALEWLKENAYIQEGTRYEIHCTGTGCLRNKKQIESTFELGLIFVQEGLALIAGHKIALEHCPLENLIHPPTSADELYEIDNNILKTMLTRMQKRINTDTNSNKTSLYPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGKFPPELPVFQFGKCAENNQDLKYYSKDDLAMSLICLESSQISSNCRNAALTTKTKKIYLSG 966
            F+N  IE  L+++K++  +   T+  I  TG G  + K  IE    L +        LI G    L++ P E  ++   S  E              R Q        +N   ++P++L   GSG SI   +   + + +G    GG +F G+   L  +  +DE++  AS+G   N+DTL++D+     ++        L    FGK A  +Q+   +SK+D+A SL+ + S+ I       A      ++Y  G
Sbjct:   96 FENTYIEACLDFIKDH-LVNTETKV-IQATGGGAYKFKDLIEEKLRLKVDKEDVMTCLIKGCNFVLKNIPHEAFVYQKDSDPEF-------------RFQ--------TNHPHIFPYLLVNIGSGVSIVKVETGDRFEWVGGSSIGGGTFWGLGALLTKTKKFDELLHLASRGQHSNVDTLVRDVYGGAHQTL--GLSGNLIASSFGKSATADQE---FSKEDMAKSLLHMISNDIGQLACLHARPHSLDRVYFGG 323          
BLAST of Type II pantothenate kinase vs. UniProt/SwissProt
Match: sp|Q4R4U1|PANK4_MACFA (4'-phosphopantetheine phosphatase OS=Macaca fascicularis OX=9541 GN=PANK4 PE=2 SV=2)

HSP 1 Score: 73.559 bits (179), Expect = 8.952e-13
Identity = 67/257 (26.07%), Postives = 116/257 (45.14%), Query Frame = 1
Query:  199 FKNEDIEKALEWLKENAYIQEGTRYEIHCTGTGCLRNKKQIESTFELGLIFVQEGLALIAGHKIALEHCPLENLIHPPTSADELYEIDNNILKTMLTRMQKRINTDTNSNKTSLYPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGKFPPELPVFQFGKCAENNQDLKYYSKDDLAMSLICLESSQISS-NCRNAALTTKTKKIYLSG 966
            F+N  IE  L+++K++  +   T+  I  TG G  + K  IE    L +        LI G    L++ P E  ++   S  E              R Q        +N   ++P++L   GSG SI   + + + + +G    GG +F G+   L  +  +DE++  AS+G   N+D L++D+     ++        L    FGK A  +Q+   +SK+D+A SL+ + S+ I    C +A L +   ++Y  G
Sbjct:   96 FENTYIEACLDFIKDH-LVNTETKV-IQATGGGAYKFKDLIEEKLRLKVDKEDVMTCLIKGCNFVLKNIPHEAFVYQKDSDPEF-------------RFQ--------TNHPHIFPYLLVNIGSGVSIVKVETEDRFEWVGGSSIGGGTFWGLGALLTKTKKFDELLHLASRGQHSNVDMLVRDVYGGAHQTL--GLSGNLIASSFGKSATADQE---FSKEDMAKSLLHMISNDIGQLACLHARLHS-LDRVYFGG 323          
BLAST of Type II pantothenate kinase vs. UniProt/SwissProt
Match: sp|Q8L5Y9|PANK2_ARATH (Pantothenate kinase 2 OS=Arabidopsis thaliana OX=3702 GN=PANK2 PE=1 SV=2)

HSP 1 Score: 69.3218 bits (168), Expect = 2.401e-11
Identity = 43/143 (30.07%), Postives = 70/143 (48.95%), Query Frame = 1
Query:  538 LYPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGKFPPELPVFQFGKCAENNQDLKYYSKDDLAMSLICLESSQISSNCRNAALTTKTKKIYLSG 966
            LYP++L   GSG SI   D +GK +++     GG ++ G+ + L     +DE++  + KG+   ID L+ DI    + S  G          FGK    N++L  Y  +D+++SL+ + S  I       AL    K+I+  G
Sbjct:  238 LYPYLLVNVGSGVSIIKVDGEGKFERVSGTNVGGGTYWGLGRLLTKCKSFDELLELSQKGDNSAIDMLVGDIYGGMDYSKIG-LSASTIASSFGKAISENKELDDYRPEDISLSLLRMISYNIGQISYLNALRFGLKRIFFGG 379          
BLAST of Type II pantothenate kinase vs. UniProt/SwissProt
Match: sp|Q0J035|PANK2_ORYSJ (Pantothenate kinase 2 OS=Oryza sativa subsp. japonica OX=39947 GN=Os09g0533100 PE=2 SV=2)

HSP 1 Score: 67.781 bits (164), Expect = 7.485e-11
Identity = 41/147 (27.89%), Postives = 72/147 (48.98%), Query Frame = 1
Query:  526 NKTSLYPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGKFPPELPVFQFGKCAENNQDLKYYSKDDLAMSLICLESSQISSNCRNAALTTKTKKIYLSG 966
            ++  L+PF+L   GSG SI   D  GK Q++     GG ++ G+ + +     +DE++  + +G+   ID L+ DI    + S  G          FGK   ++++L  Y  +D+++SL+ + S  I       AL    K+I+  G
Sbjct:  240 DQNDLFPFLLVNVGSGVSIIKVDGHGKFQRVSGTNVGGGTYWGLGRLMTKCKSFDELLELSQRGDNSTIDMLVGDIYGGLDYSKIG-LSASTIASSFGKTISDDKELSDYRPEDISLSLLRMISYNIGQISYLNALRYGLKRIFFGG 385          
BLAST of Type II pantothenate kinase vs. TrEMBL
Match: A0A267H6I1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034563g1 PE=4 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 4.485e-49
Identity = 105/320 (32.81%), Postives = 174/320 (54.37%), Query Frame = 1
Query:  175 HINFQYSIFKNEDIEKALEWLKENAYIQEGTRYEIHCTGTGCLRNKKQIESTFELGLIFVQEGLALIAGHKIALEHCPLENLIHPPTSADELYEID----NNILKTMLTRMQKRINTDTNSNKTSLYPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGKFPPELPVFQFGKCAENNQDLKYYSKDDLAMSLICLESSQISSNCRNAALTTKTKKIYLSGNTFKSSLFHKEILNRNLRHPIG--VEYTFLDLGYATALGAMFCVNQERAMYV 1116
            H N  +++FKN   E  L++LKE   + +    ++H TG GC  +++ I+    L + F+ E L    G    L  C  ++ I  P    ++ E +    NN L+ ++ + +K +       K   +P ++ + GSG  I   +++G +  +G     G+SFLG++K L+ ++DYDEI+  ASKG R N+DT +KD+L +D  SPYG+ PP LPVF FGK  + ++ L   S++DLA S++   +    +N   AA T+K  K+Y+ GN F+  L   EIL +++R   G  +   FL  G+  A+GAM    ++   Y+
Sbjct:   47 HYNLHFALFKNSHFEAGLDYLKEKGMVVQVPGAKLHVTGAGCDMHRELIKQKLGLEIQFINEFLTQGRGTHW-LIGCADDSEICYPEPELDMSEFEGLQANNFLQKLIEKAKKDLGEPIEGQK---FPCMMLFMGSGGGIMKIEENGMSDMVGGLWFAGRSFLGLSKLLLGTDDYDEILELASKGRRNNVDTEVKDVLANDPNSPYGQLPPNLPVFPFGKAVDTDKTLADLSREDLANSIVFSFAYNAFTNLALAAQTSKIPKLYMGGNFFRHELIRAEIL-KSVRLFTGESIALNFLITGHTGAIGAMISKPEDEFKYL 361          
BLAST of Type II pantothenate kinase vs. TrEMBL
Match: A0A1I8HZ40 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034563g2 PE=4 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 1.642e-48
Identity = 105/320 (32.81%), Postives = 173/320 (54.06%), Query Frame = 1
Query:  175 HINFQYSIFKNEDIEKALEWLKENAYIQEGTRYEIHCTGTGCLRNKKQIESTFELGLIFVQEGLALIAGHKIALEHCPLENLIHPPTSADELYEID----NNILKTMLTRMQKRINTDTNSNKTSLYPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGKFPPELPVFQFGKCAENNQDLKYYSKDDLAMSLICLESSQISSNCRNAALTTKTKKIYLSGNTFKSSLFHKEILNRNLRHPIG--VEYTFLDLGYATALGAMFCVNQERAMYV 1116
            H N  +++FKN   E  L++LKE   + +    ++H TG GC  +++ I+    L + F+ E L    G    L  C  ++ I  P    ++ E +    NN L+ ++ + +K +       K   +P ++ + GSG  I   +++G +  +G     G+SFLG++K L+ ++DYDEI+  ASKG R N+DT +KD+L +D  SPYG+ PP LPVF FGK  + ++ L   S++DLA S++   +    +N   AA T+K  K+Y+ GN F+  L   EIL + +R   G  +   FL  G+  A+GAM    ++   Y+
Sbjct:   47 HYNLHFALFKNSHFEAGLDYLKEKGMVVQVPGAKLHVTGAGCDMHRELIKQKLGLEIQFINEFLTQGRGTHW-LIGCADDSEICYPEPELDMSEFEGLQANNFLQKLIEKAKKDLGEPIEGQK---FPCMMLFMGSGGGIMKIEENGMSDMVGGLWFAGRSFLGLSKLLLGTDDYDEILELASKGRRNNVDTEVKDVLANDPNSPYGQLPPNLPVFPFGKAVDTDKTLADLSREDLANSIVFSFAYNAFTNLALAAQTSKIPKLYMGGNFFRHELIRAEIL-KIVRLFTGESIALKFLITGHTGAIGAMISKPEDEFKYL 361          
BLAST of Type II pantothenate kinase vs. TrEMBL
Match: A0A1I8HLA0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 4.876e-45
Identity = 104/309 (33.66%), Postives = 169/309 (54.69%), Query Frame = 1
Query:  175 HINFQYSIFKNEDIEKALEWLKENAYIQEGTRYEIHCTGTGCLRNKKQIESTFELGLIFVQEGLALIAGHKIALEHCPLENLIHPPTSADELYEID----NNILKTMLTRMQKRINTDTNSNKTSLYPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGKFPPELPVFQFGKCAENNQDLKYYSKDDLAMSLICLESSQISSNCRNAALTTKTKKIYLSGNTFKSSLFHKEILNRNLRHPIG--VEYTFLDLGYATALGAM 1083
            H N  +++FKN   E  L++LKE   + +    ++H TG GC  +++ I+    L + F+ E L    G    L  C  ++ I  P    ++ E +    NN L+ ++ + +K +       K   +P ++ + GSG  I   +++G +  +G     G+SFLG++K L+ ++DYDEI+  ASKG R N+DT +KD+L +D  SPYG+ PP LPVF FGK  + ++ L   S++DLA S++   +    +N   AA T+K  K+Y+ GN F+  L   EIL + +R   G  +   FL  G+  A+GAM
Sbjct:   47 HYNLHFALFKNSHFEAGLDYLKEKGMVVQVPGAKLHVTGAGCDMHRELIKQKLGLEIQFINEFLTQGRGTH-WLIGCADDSEICYPEPELDMSEFEGLQANNFLQKLIEKAKKDLGEPIEGQK---FPCMMLFMGSGGGIMKIEENGMSDMVGGLWFAGRSFLGLSKLLLGTDDYDEILELASKGRRNNVDTEVKDVLANDPNSPYGQLPPNLPVFPFGKAVDTDKTLADLSREDLANSIVFSFAYNAFTNLALAAQTSKIPKLYMGGNFFRHELIRAEIL-KIVRLFTGESIALKFLITGHTGAIGAM 350          
BLAST of Type II pantothenate kinase vs. TrEMBL
Match: A0A1I8GL52 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 5.254e-45
Identity = 104/309 (33.66%), Postives = 169/309 (54.69%), Query Frame = 1
Query:  175 HINFQYSIFKNEDIEKALEWLKENAYIQEGTRYEIHCTGTGCLRNKKQIESTFELGLIFVQEGLALIAGHKIALEHCPLENLIHPPTSADELYEID----NNILKTMLTRMQKRINTDTNSNKTSLYPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGKFPPELPVFQFGKCAENNQDLKYYSKDDLAMSLICLESSQISSNCRNAALTTKTKKIYLSGNTFKSSLFHKEILNRNLRHPIG--VEYTFLDLGYATALGAM 1083
            H N  +++FKN   E  L++LKE   + +    ++H TG GC  +++ I+    L + F+ E L    G    L  C  ++ I  P    ++ E +    NN L+ ++ + +K +       K   +P ++ + GSG  I   +++G +  +G     G+SFLG++K L+ ++DYDEI+  ASKG R N+DT +KD+L +D  SPYG+ PP LPVF FGK  + ++ L   S++DLA S++   +    +N   AA T+K  K+Y+ GN F+  L   EIL + +R   G  +   FL  G+  A+GAM
Sbjct:   47 HYNLHFALFKNSHFEAGLDYLKEKGMVVQVPGAKLHVTGAGCDMHRELIKQKLGLEIQFINEFLTQGRGTH-WLIGCADDSEICYPEPELDMSEFEGLQANNFLQKLIEKAKKDLGEPIEGQK---FPCMMLFMGSGGGIMKIEENGMSDMVGGLWFAGRSFLGLSKLLLGTDDYDEILELASKGRRNNVDTEVKDVLANDPNSPYGQLPPNLPVFPFGKAVDTDKTLADLSREDLANSIVFSFAYNAFTNLALAAQTSKIPKLYMGGNFFRHELIRAEIL-KIVRLFTGESIALKFLITGHTGAIGAM 350          
BLAST of Type II pantothenate kinase vs. TrEMBL
Match: A0A1I8G3I7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 5.467e-45
Identity = 104/309 (33.66%), Postives = 169/309 (54.69%), Query Frame = 1
Query:  175 HINFQYSIFKNEDIEKALEWLKENAYIQEGTRYEIHCTGTGCLRNKKQIESTFELGLIFVQEGLALIAGHKIALEHCPLENLIHPPTSADELYEID----NNILKTMLTRMQKRINTDTNSNKTSLYPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGKFPPELPVFQFGKCAENNQDLKYYSKDDLAMSLICLESSQISSNCRNAALTTKTKKIYLSGNTFKSSLFHKEILNRNLRHPIG--VEYTFLDLGYATALGAM 1083
            H N  +++FKN   E  L++LKE   + +    ++H TG GC  +++ I+    L + F+ E L    G    L  C  ++ I  P    ++ E +    NN L+ ++ + +K +       K   +P ++ + GSG  I   +++G +  +G     G+SFLG++K L+ ++DYDEI+  ASKG R N+DT +KD+L +D  SPYG+ PP LPVF FGK  + ++ L   S++DLA S++   +    +N   AA T+K  K+Y+ GN F+  L   EIL + +R   G  +   FL  G+  A+GAM
Sbjct:   47 HYNLHFALFKNSHFEAGLDYLKEKGMVVQVPGAKLHVTGAGCDMHRELIKQKLGLEIQFINEFLTQGRGTH-WLIGCADDSEICYPEPELDMSEFEGLQANNFLQKLIEKAKKDLGEPIEGQK---FPCMMLFMGSGGGIMKIEENGMSDMVGGLWFAGRSFLGLSKLLLGTDDYDEILELASKGRRNNVDTEVKDVLANDPNSPYGQLPPNLPVFPFGKAVDTDKTLADLSREDLANSIVFSFAYNAFTNLALAAQTSKIPKLYMGGNFFRHELIRAEIL-KIVRLFTGESIALKFLITGHTGAIGAM 350          
BLAST of Type II pantothenate kinase vs. Ensembl Cavefish
Match: pank4 (pantothenate kinase 4 (inactive) [Source:NCBI gene;Acc:103021954])

HSP 1 Score: 66.6254 bits (161), Expect = 1.612e-11
Identity = 69/258 (26.74%), Postives = 115/258 (44.57%), Query Frame = 1
Query:  199 FKNEDIEKALEWLKENAYIQEGTRYEIHCTGTGCLRNKKQIESTFELGLIFVQEGLALIAGHKIALEHCPLENLIHPPTSADELYEIDNNILKTMLTRMQKRINTDTNSNKTSLYPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGK--FPPELPVFQFGKCAENNQDLKYYSKDDLAMSLICLESSQISSNCRNAALTTKTKKIYLSG 966
            F+N  IE  L+++K++  +   T+  I  TG G  + K  IE   +L +    E   LI G    L++ P E  ++    AD  +   N                     +  ++P++L   GSG SI   + + K ++IG    GG +F G+   L  +  +DE++  ASKG   N+D L+KDI        YG      +L    FGK A  +++   +S++D+A SL+ + S+ I       A      ++Y  G
Sbjct:   96 FENTYIETCLDFIKDH-LVNTETKV-IKATGGGAYKFKDLIEKKLKLKVDKEDEMSCLIKGCNFVLKNIPHEAFVYA-KHADSEFRFQNT--------------------RPDIFPYLLVNIGSGVSIVKVESEDKFERIGGSSIGGGTFWGLGALLTKTKRFDELLQLASKGQHTNVDMLVKDIY----GGAYGSLGLTGDLIASSFGKSATADKE---FSQEDMAKSLLHMISNDIGQLACLYARLHNLNRVYFGG 323          
BLAST of Type II pantothenate kinase vs. Ensembl Cavefish
Match: pank2 (pantothenate kinase 2 [Source:NCBI gene;Acc:103044193])

HSP 1 Score: 57.3806 bits (137), Expect = 1.338e-8
Identity = 51/189 (26.98%), Postives = 83/189 (43.92%), Query Frame = 1
Query:  541 YPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGKF--PPELPVFQFGK--CAENNQDLKYYSKDDLAMSLICLESSQISSNCRNAALTTKTKKIYLSGNTFKSSLFHKEILNRNLRHPIGVEYTFLDL---GYATALGAMF 1086
            YP +L   GSG SI         +++     GG +FLG+   L   + ++E +  AS+G    +D L++DI   D    Y +F  P       FG   C E    +   SK+DLA + +   ++ I S  R  AL    +++   GN  + +    ++L   L +    +   L L   GY  A+GA+ 
Sbjct:  251 YPLLLVNIGSGVSILAVYSKDNYKRVTGTSLGGGTFLGLCCLLTGCSTFEEALEMASRGESTRVDKLVRDIYGGD----YERFGLPGWAVASSFGNMMCKEKRDSV---SKEDLARATLVTITNNIGSITRMCALNENIERVVFVGNFLRVNTLSMKLLAYALDYWSKGQLKALFLRHEGYFGAVGALL 432          
BLAST of Type II pantothenate kinase vs. Ensembl Cavefish
Match: pank1b (pantothenate kinase 1 [Source:NCBI gene;Acc:103047703])

HSP 1 Score: 53.9138 bits (128), Expect = 1.446e-7
Identity = 41/157 (26.11%), Postives = 71/157 (45.22%), Query Frame = 1
Query:  541 YPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGKFPPELPVF--QFGKCAENNQDLKYYSKDDLAMSLICLESSQISSNCRNAALTTKTKKIYLSGNTFKSSLFHKEIL 1005
            +P +L   GSG SI         +++     GG +FLG+   L     ++E +  A+KG+  N+D L+KDI   D    Y +F  +       FG      +     SK+DLA + +   ++ I S  R  A+  K +++   GN  + +    ++L
Sbjct:  261 FPMLLVNIGSGVSILAVYSKDNYKRVTGTSLGGGTFLGLCCLLTGCETFEEALEMAAKGDSTNVDKLVKDIYGGD----YERFGLQGSAVASSFGHMMSKERR-DSISKEDLARATLVTITNNIGSIARMCAVNEKIERVVFVGNFLRINTVSTKLL 412          
BLAST of Type II pantothenate kinase vs. Ensembl Cavefish
Match: pank2 (pantothenate kinase 2 [Source:NCBI gene;Acc:103044193])

HSP 1 Score: 50.0618 bits (118), Expect = 2.381e-6
Identity = 40/135 (29.63%), Postives = 61/135 (45.19%), Query Frame = 1
Query:  541 YPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGKF--PPELPVFQFGK--CAENNQDLKYYSKDDLAMSLICLESSQISSNCRNAAL 933
            YP +L   GSG SI         +++     GG +FLG+   L   + ++E +  AS+G    +D L++DI   D    Y +F  P       FG   C E    +   SK+DLA + +   ++ I S  R  AL
Sbjct:  251 YPLLLVNIGSGVSILAVYSKDNYKRVTGTSLGGGTFLGLCCLLTGCSTFEEALEMASRGESTRVDKLVRDIYGGD----YERFGLPGWAVASSFGNMMCKEKRDSV---SKEDLARATLVTITNNIGSITRMCAL 378          
BLAST of Type II pantothenate kinase vs. Ensembl Cavefish
Match: pank1a (pantothenate kinase 1a [Source:ZFIN;Acc:ZDB-GENE-040426-2846])

HSP 1 Score: 49.2914 bits (116), Expect = 3.422e-6
Identity = 41/157 (26.11%), Postives = 70/157 (44.59%), Query Frame = 1
Query:  541 YPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGKFPPELPVF--QFGKCAENNQDLKYYSKDDLAMSLICLESSQISSNCRNAALTTKTKKIYLSGNTFKSSLFHKEIL 1005
            +P +L   GSG SI           +  +  GG +FLG+   L     ++E +  ASKG+  N D L++DI   D    Y +F  +       FG    + +     SK+DLA + +   ++ I S  R  A+  K +++   GN  + +    ++L
Sbjct:  168 FPMLLVNIGSGVSI-----------LAVYSLGGGTFLGLCCLLTGCETFEEALEMASKGDSTNADKLVRDIYGGD----YQRFGLQGSAVASSFGH-MMSKEKRDSISKEDLARATLVTITNNIGSIARMCAVNEKIERVVFVGNFLRINTVSTKLL 308          
BLAST of Type II pantothenate kinase vs. Ensembl Sea Lamprey
Match: pank2 (pantothenate kinase 2 [Source:ZFIN;Acc:ZDB-GENE-070112-1952])

HSP 1 Score: 66.6254 bits (161), Expect = 2.130e-12
Identity = 52/190 (27.37%), Postives = 88/190 (46.32%), Query Frame = 1
Query:  538 LYPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGKF--PPELPVFQFGK--CAENNQDLKYYSKDDLAMSLICLESSQISSNCRNAALTTKTKKIYLSGNTFKSSLFHKEILNRNLRHPIGVEYTFLDL---GYATALGAMF 1086
            LYP +L   GSG SI         +++     GG +FLG++  L     ++E ++ A +G+  N+D L++DI   D    YG+F  P       FG   C E  + +   S++DLA + +   ++ I S  R  AL  K  ++   GN  + +    ++L   + +    +   L L   GY  A+GA+ 
Sbjct:  182 LYPLLLVNIGSGVSILAVHSPNNYKRVTGTSLGGGTFLGLSCLLTGCKTFEEALSLAERGDSTNVDKLVRDIYGGD----YGRFGLPGSTVASSFGNMMCKERREAV---SREDLARATLVTITNNIGSIARMCALNEKIDRVVFVGNFLRVNTLSMKLLAYAMDYWSKGQLKALFLEHEGYFGAVGALL 364          
BLAST of Type II pantothenate kinase vs. Ensembl Sea Lamprey
Match: pank2 (pantothenate kinase 2 [Source:ZFIN;Acc:ZDB-GENE-070112-1952])

HSP 1 Score: 64.6994 bits (156), Expect = 7.563e-12
Identity = 50/189 (26.46%), Postives = 88/189 (46.56%), Query Frame = 1
Query:  535 SLYPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGKFPPELPVF--QFGKCAENNQDLKYYSKDDLAMSLICLESSQISSNCRNAALTTKTKKIYLSGNTFKSSLFHKEILNRNLRHPIGVEYTFLDL---GYATALGAMF 1086
            S YP +L   GSG S+         +++     GG +FLG+   L   + +DE ++ A +G+  N+D L++DI   D    Y +F          FG+    ++  +  SK+DLAM+ +   ++ I S  R  AL  K +++   GN  + +   + +L   + +  G +     L   GY  A+GA+ 
Sbjct:  181 SRYPLLLVNIGSGVSMLAVYSPHDYRRVTGTSLGGGTFLGLCCLLTGCDSFDEALSLAERGDSTNVDKLVRDIYGGD----YERFGLRGSAVASSFGQMISLDRR-EAVSKEDLAMATLVTITNNIGSIARMCALNEKMERVVFVGNFLRVNQLSRRLLAHAMEYWSGGQLKAFFLEHEGYFGAVGALL 364          
BLAST of Type II pantothenate kinase vs. Ensembl Nematostella
Match: EDO37713 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEX1])

HSP 1 Score: 57.7658 bits (138), Expect = 2.499e-9
Identity = 48/188 (25.53%), Postives = 88/188 (46.81%), Query Frame = 1
Query:  541 YPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGKF--PPELPVFQFGK-CAENNQDLKYYSKDDLAMSLICLESSQISSNCRNAALTTKTKKIYLSGNTFKSSLFHKEILNRNLRHPIGVEYTFLDL---GYATALGAMF 1086
            +P+++   GSG SI       K  +I     GG +FLG+   +     ++E ++ A++G+   +D L+KDI   D    Y KF  P +     FGK C    Q+    + +D+A + + + ++ I S  R  A+  K +++   GN  +++    ++L   + +        L L   GY  A+GA+ 
Sbjct:  175 FPYLVVNIGSGVSIMAVYSAEKFDRISGTSLGGGTFLGLCCLMTGCTTFEEALSMAARGDSTKVDKLVKDIYGGD----YNKFNLPGDTVASSFGKMCYPERQN--EVNNEDIASATLIMITNNIGSIARMCAVNAKIERVVFVGNFLRTNEIAMKLLAYAMDYWSQGTMKALFLQHEGYFGAVGALL 356          
BLAST of Type II pantothenate kinase vs. Ensembl Medaka
Match: pank4 (pantothenate kinase 4 (inactive) [Source:NCBI gene;Acc:101161916])

HSP 1 Score: 66.2402 bits (160), Expect = 2.714e-11
Identity = 75/273 (27.47%), Postives = 117/273 (42.86%), Query Frame = 1
Query:  190 YSIFKNEDIEKALEWLK-ENAYIQEGTRY-----------EIHCTGTGCLRNKKQIESTFELGLIFVQEGLALIAGHKIALEHCPLENLIHPPTSADELYEIDNNILKTMLTRMQKRINTDTNSNKTSLYPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYG--KFPPELPVFQFGKCAENNQDLKYYSKDDLAMSLICLESSQISSNCRNAALTTKTKKIYLSG 966
            Y I   E++   L ++K ENAYI+    +            I  TG G  + K+ IE    L +    E   LI G    L++ P E  ++   +  E                  R  T TN +   ++P++L   GSG SI   + + K ++IG    GG +F G+   L  +  +DE++  ASKG   N+D L+KDI        YG      +L    FGK A  ++D   + K+D+A SL+ + S+ I       A      ++Y  G
Sbjct:   73 YEISMQEEVTARLHFIKFENAYIETCLDFIKDHLVNTETKVIKATGGGAHKFKELIEKKLGLKVDKEDEMTCLIKGCNFVLKNIPHEAFVYARHADSEF-----------------RFQT-TNPD---IFPYLLVNIGSGVSIVKVESEDKFERIGGSSIGGGTFWGLGALLTKTKRFDELLQLASKGQHTNVDMLVKDIY----GGSYGCLGLTGDLIASSFGKSATADKD---FCKEDMAKSLLHMISNDIGQLACLYAKLHGLSRVYFGG 317          
BLAST of Type II pantothenate kinase vs. Ensembl Medaka
Match: pank1a (pantothenate kinase 1 [Source:NCBI gene;Acc:101175261])

HSP 1 Score: 60.077 bits (144), Expect = 1.526e-9
Identity = 41/155 (26.45%), Postives = 72/155 (46.45%), Query Frame = 1
Query:  541 YPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGKFPPELPVFQFGKCAENNQDLKYYSKDDLAMSLICLESSQISSNCRNAALTTKTKKIYLSGNTFKSSLFHKEIL 1005
            +P +L   GSG S+     +   +++     GG +FLG+   L     ++E +  ASKG+ KN+D L+KDI   D +    +       F    C E    +   SK+DLA + +   ++ I S  R  A+  K +++   GN  + +    ++L
Sbjct:  262 FPMLLVNIGSGVSVLAVYSEDNYKRVTGTSLGGGTFLGLCCLLTGCETFEEALEMASKGDSKNVDKLVKDIYGGDYERFGLQGSAVASSFGHMMCKEKRDSI---SKEDLARATLVTITNNIGSIARMCAVNEKIERVVFVGNFLRINTVSTKLL 413          
BLAST of Type II pantothenate kinase vs. Ensembl Medaka
Match: pank1a (pantothenate kinase 1 [Source:NCBI gene;Acc:101175261])

HSP 1 Score: 60.077 bits (144), Expect = 1.591e-9
Identity = 41/155 (26.45%), Postives = 72/155 (46.45%), Query Frame = 1
Query:  541 YPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGKFPPELPVFQFGKCAENNQDLKYYSKDDLAMSLICLESSQISSNCRNAALTTKTKKIYLSGNTFKSSLFHKEIL 1005
            +P +L   GSG S+     +   +++     GG +FLG+   L     ++E +  ASKG+ KN+D L+KDI   D +    +       F    C E    +   SK+DLA + +   ++ I S  R  A+  K +++   GN  + +    ++L
Sbjct:  262 FPMLLVNIGSGVSVLAVYSEDNYKRVTGTSLGGGTFLGLCCLLTGCETFEEALEMASKGDSKNVDKLVKDIYGGDYERFGLQGSAVASSFGHMMCKEKRDSI---SKEDLARATLVTITNNIGSIARMCAVNEKIERVVFVGNFLRINTVSTKLL 413          
BLAST of Type II pantothenate kinase vs. Ensembl Medaka
Match: pank2 (pantothenate kinase 3 [Source:NCBI gene;Acc:101161204])

HSP 1 Score: 56.9954 bits (136), Expect = 1.202e-8
Identity = 48/187 (25.67%), Postives = 83/187 (44.39%), Query Frame = 1
Query:  541 YPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGKF--PPELPVFQFGKCAENNQDLKYYSKDDLAMSLICLESSQISSNCRNAALTTKTKKIYLSGNTFKSSLFHKEILNRNLRHPIGVEYTFLDL---GYATALGAMF 1086
            YP +L   GSG SI     +   +++     GG +FLG+   L   + ++E +  AS+G    +D L++DI   D    Y +F  P       FG      +  +  SK+DLA + +   ++ I S  R  AL    +++   GN  + +    ++L   + +    +   L L   GY  A+GA+ 
Sbjct:  180 YPLLLVNIGSGVSILAVYSENNYKRVTGTSLGGGTFLGLCCLLTGCSTFEEALQMASEGESTRVDKLVRDIYGGD----YERFGLPGWAVASSFGNMMSKEKR-ESVSKEDLARATLVTITNNIGSITRMCALNESIERVVFVGNFLRVNTLSMKLLAYAMDYWSKGQLKALFLRHEGYFGAVGALL 361          
BLAST of Type II pantothenate kinase vs. Ensembl Medaka
Match: pank2 (pantothenate kinase 3 [Source:NCBI gene;Acc:101161204])

HSP 1 Score: 56.6102 bits (135), Expect = 1.872e-8
Identity = 48/187 (25.67%), Postives = 84/187 (44.92%), Query Frame = 1
Query:  541 YPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGKF--PPELPVFQFGKCAENNQDLKYYSKDDLAMSLICLESSQISSNCRNAALTTKTKKIYLSGNTFKSSLFHKEILNRNLRHPIGVEYTFLDL---GYATALGAMF 1086
            YP +L   GSG SI     +   +++     GG +FLG+   L   + ++E +  AS+G    +D L++DI   D    Y +F  P       FG    + +  +  SK+DLA + +   ++ I S  R  AL    +++   GN  + +    ++L   + +    +   L L   GY  A+GA+ 
Sbjct:  240 YPLLLVNIGSGVSILAVYSENNYKRVTGTSLGGGTFLGLCCLLTGCSTFEEALQMASEGESTRVDKLVRDIYGGD----YERFGLPGWAVASSFGNMM-SKEKRESVSKEDLARATLVTITNNIGSITRMCALNESIERVVFVGNFLRVNTLSMKLLAYAMDYWSKGQLKALFLRHEGYFGAVGALL 421          
BLAST of Type II pantothenate kinase vs. Planmine SMEST
Match: SMESG000077416.1 (SMESG000077416.1)

HSP 1 Score: 734.561 bits (1895), Expect = 0.000e+0
Identity = 368/368 (100.00%), Postives = 368/368 (100.00%), Query Frame = 1
Query:   16 MIIKPIKTGLVNFKKCNLLENRXXXXXXXXXXXXKFIFVNKQNRCQLYDESTHHINFQYSIFKNEDIEKALEWLKENAYIQEGTRYEIHCTGTGCLRNKKQIESTFELGLIFVQEGLALIAGHKIALEHCPLENLIHPPTSADELYEIDNNILKTMLTRMQKRINTDTNSNKTSLYPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGKFPPELPVFQFGKCAENNQDLKYYSKDDLAMSLICLESSQISSNCRNAALTTKTKKIYLSGNTFKSSLFHKEILNRNLRHPIGVEYTFLDLGYATALGAMFCVNQERAMYVK 1119
            MIIKPIKTGLVNFKKCNLLENRILIGIDIGSSLSKFIFVNKQNRCQLYDESTHHINFQYSIFKNEDIEKALEWLKENAYIQEGTRYEIHCTGTGCLRNKKQIESTFELGLIFVQEGLALIAGHKIALEHCPLENLIHPPTSADELYEIDNNILKTMLTRMQKRINTDTNSNKTSLYPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGKFPPELPVFQFGKCAENNQDLKYYSKDDLAMSLICLESSQISSNCRNAALTTKTKKIYLSGNTFKSSLFHKEILNRNLRHPIGVEYTFLDLGYATALGAMFCVNQERAMYVK
Sbjct:    1 MIIKPIKTGLVNFKKCNLLENRILIGIDIGSSLSKFIFVNKQNRCQLYDESTHHINFQYSIFKNEDIEKALEWLKENAYIQEGTRYEIHCTGTGCLRNKKQIESTFELGLIFVQEGLALIAGHKIALEHCPLENLIHPPTSADELYEIDNNILKTMLTRMQKRINTDTNSNKTSLYPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGKFPPELPVFQFGKCAENNQDLKYYSKDDLAMSLICLESSQISSNCRNAALTTKTKKIYLSGNTFKSSLFHKEILNRNLRHPIGVEYTFLDLGYATALGAMFCVNQERAMYVK 368          
BLAST of Type II pantothenate kinase vs. Planmine SMEST
Match: SMESG000031677.1 (SMESG000031677.1)

HSP 1 Score: 198.364 bits (503), Expect = 4.854e-60
Identity = 124/354 (35.03%), Postives = 197/354 (55.65%), Query Frame = 1
Query:   22 IKPIKTGLVNFKKCNLLENRXXXXXXXXXXXXKFIFVNKQNRCQLYDESTHHINFQYSIFKNEDIEKALEWLKENAYIQEGTRYEIHCTGTGCLRNKKQIESTFELGLIFVQEGLALIAGHKIALEHCPLENLIHPPTSADELYEIDNNILKTMLTRMQKRINTDTNSNKTSLYPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGKFPPELPVFQFGKCAENNQDLKYYSKDDLAMSLICLESSQISSNCRNAALTTKTKKIYLSGNTFKSSLFHKEILNRNLRHPIGVEYTFLDLGYATALGAM 1083
            + P+KT  +  KK   ++NR+LI ID G+SL+K +F+NK +   L ++    I   + +FKN D + ALE +K +AY  E   + ++ TG   L+N ++I+    +  IF+ E L +   H+  +EH  ++NL+     A++  E + N           +IN  ++S    LYP +    GS S  F+F +D   +       GGK+FLG+AKC++++NDYDEI++ A++GN+ N+DT +K++      S Y + P E+ +F +GKC + N+ L+ +SK DLA SLI   +  I     +     K  KIYL+GN F S +F KEI+      P  V+   L+ GY  ALGAM
Sbjct:    1 MPPLKTEFITVKKSKWIKNRLLISIDSGNSLTKLLFLNKMHYYLLKNKEEASILLNFILFKNSDFDCALELVKNSAYFPENNNFNLYVTGVFALKNLEKIKFNLGINTIFIDEFLTIAESHRFLVEHIGVDNLL-----ANKFMESNIN-----------KINNQSSSIMPDLYPKLFHIHGSSSGCFYFSND-ITEYWSILHQGGKTFLGLAKCILNTNDYDEIVSLATQGNKCNVDTQVKEMFDQTIDSTY-ELPSEMSIFSYGKCMDLNKGLRDFSKHDLAASLISYHAKFIIMFAASICSIKKVSKIYLTGNIFNSEIFQKEIVQFESNFPFAVKPIILNFGYFGALGAM 336          
BLAST of Type II pantothenate kinase vs. Planmine SMEST
Match: SMESG000008042.1 (SMESG000008042.1)

HSP 1 Score: 170.629 bits (431), Expect = 3.805e-49
Identity = 110/369 (29.81%), Postives = 192/369 (52.03%), Query Frame = 1
Query:   22 IKPIKTGLVNFKKCNLLENRXXXXXXXXXXXXKFIFVNKQNRCQLYDE--STHHINFQYSIFKNEDIEKALEWLKENAYIQEGTRYEIHCTGTGCLRNKKQIESTFELGLIFVQEGLALIAGHKIALEHCPLENLIHPPTSADELYEIDNNILKTMLTRMQKRINTDTNSNKTSLYPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGKFPPELPVFQFGKCAENNQDLKYYSKDDLAMSLICLESSQISSNCRNAALTTKTKKIYLSGNTFKSSLFHKEI-LNRNLRHPIGVEYTFLDLGYATALGAMFCVNQERAMYVK 1119
            + PI    ++FKKC L +  +L  +D G SL+K I+ +K ++  L DE  S   +    ++F N ++++ L  LKENAY  E      H TG G  +  K+I+   E  +IF+ E L+   G    L++  LE++I+     +++  I+      +       +  +        +P +    GSG+     + DG      +  + GK F+GM +C++++N+Y+EI+  A+KG+R+N+DT  +DI+ +D  SPYGK P  + +   GK A+ N+D+  ++K+D+A SL+ L       N  +  +  K K ++  GN F+S +F KE    R +     V + F++ G++ ALGAM    ++   Y K
Sbjct:    1 MPPIVVKKISFKKCFLNQVEVLASLDRGCSLTKVIYFDKSDK-NLADEDPSIDTVILTLALFDNNNLDEVLLILKENAYFPENQTLPFHVTGAGGDKYSKRIKEILERDVIFIDEYLSQARGTYFFLKYASLEDIIYENVEIEDVEPIEAPFASNIKGHFDTIVTNNITEEDDEKFPCIFAIMGSGAGCMRLNSDGTFHMACNMIDVGKPFIGMCRCILETNNYEEIMDMAAKGDRRNVDTTTEDIVTAD--SPYGKIPGGISLIPLGKLADTNKDISEFNKNDIAHSLVSLFIYNAMINAIHCCIAEKVKTVFFGGNLFQSEIFRKEYSYLRKVYTLDFVNFYFVNNGHSGALGAMVSCPEDVKKYKK 366          
BLAST of Type II pantothenate kinase vs. Planmine SMEST
Match: SMESG000008043.1 (SMESG000008043.1)

HSP 1 Score: 152.91 bits (385), Expect = 2.193e-42
Identity = 113/375 (30.13%), Postives = 190/375 (50.67%), Query Frame = 1
Query:   22 IKPIKTGLVNFKKCNLLENRXXXXXXXXXXXXKFIFVNKQNRCQLYDESTHH-INFQYSIFKNEDIEKALEWLKENAYIQEGTRYEIHCTGTGCLRNKKQIESTFELGLIFVQEGLALIAGHKIALEHCPLENLIHPPTSADELYEIDNNILKTMLTRMQKRINTDTNSNKT-SLYPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGKFPPELPVFQFGKCAENNQDLKYYSKDDLAMSLICLESSQISSNCRNAA----LTTKTKKIYLSGNTFKSSLFHKEILNRNLRHPIG-VEYTFLDLGYATALGAMFCVNQERAMYVK*Q 1125
            I PI     +FKK  L    +L G+D G SL+K I+V+K++  ++ + ST   I    ++F N   + AL WLK+ A+  E     IH TG G ++  ++I+   +  ++FV E ++   G    L + PL  + +     D     D   +  +  + ++ +    +   T  L P + G+ GSG    +   DG  + +      GK+F+G+++C++ +NDY+EI+  AS+G+R+N+D  +KDI+  DE   + K  PELP+   GK AE  + +  ++KDDLA SL+    S    N  NAA    ++ K   ++  GN F+S +F KE         +  + + F+  G+  ALGAM C   +   Y + Q
Sbjct:    5 IIPIMERKFSFKKSVLSHIEVLAGLDRGCSLTKIIYVDKKDSDKVDENSTSDVIILTVALFLNSKFDDALIWLKDKAFFPENKELPIHLTGAGGVKYSEKIKEILDRDVVFVDEFMSQSRGAYYMLANVPLSEVTYAEIETDTTDWFDVPFITDVKIQFEEIVGKRKDVKTTEDLLPCIFGFIGSGGGFTYIGSDGTFRMVSGLPAAGKTFIGLSRCILGTNDYNEIMEMASRGDRRNVDLQVKDIM-GDES--FEKLSPELPIIHMGKLAETKKSITEFNKDDLAHSLV----SMFIYNAINAAIHVCMSEKVHNVFFGGNLFQSEVFRKEFSTLKKMFSVNFINFYFVSNGHTGALGAMVCSPNDMEKYFQMQ 372          
BLAST of Type II pantothenate kinase vs. Planmine SMEST
Match: SMESG000008043.1 (SMESG000008043.1)

HSP 1 Score: 151.754 bits (382), Expect = 5.061e-42
Identity = 100/343 (29.15%), Postives = 173/343 (50.44%), Query Frame = 1
Query:  118 KFIFVNKQNRCQLYDESTHH-INFQYSIFKNEDIEKALEWLKENAYIQEGTRYEIHCTGTGCLRNKKQIESTFELGLIFVQEGLALIAGHKIALEHCPLENLIHPPTSADELYEIDNNILKTMLTRMQKRINTDTNSNKT-SLYPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGKFPPELPVFQFGKCAENNQDLKYYSKDDLAMSLICLESSQISSNCRNAA----LTTKTKKIYLSGNTFKSSLFHKEILNRNLRHPIG-VEYTFLDLGYATALGAMFCVNQERAMYVK*Q 1125
            K I+V+K++  ++ + ST   I    ++F N   + AL WLK+ A+  E     IH TG G ++  ++I+   +  ++FV E ++   G    L + PL  + +     D     D   +  +  + ++ +    +   T  L P + G+ GSG    +   DG  + +      GK+F+G+++C++ +NDY+EI+  AS+G+R+N+D  +KDI+  DE   + K  PELP+   GK AE  + +  ++KDDLA SL+    S    N  NAA    ++ K   ++  GN F+S +F KE         +  + + F+  G+  ALGAM C   +   Y + Q
Sbjct:   29 KIIYVDKKDSDKVDENSTSDVIILTVALFLNSKFDDALIWLKDKAFFPENKELPIHLTGAGGVKYSEKIKEILDRDVVFVDEFMSQSRGAYYMLANVPLSEVTYAEIETDTTDWFDVPFITDVKIQFEEIVGKRKDVKTTEDLLPCIFGFIGSGGGFTYIGSDGTFRMVSGLPAAGKTFIGLSRCILGTNDYNEIMEMASRGDRRNVDLQVKDIM-GDES--FEKLSPELPIIHMGKLAETKKSITEFNKDDLAHSLV----SMFIYNAINAAIHVCMSEKVHNVFFGGNLFQSEVFRKEFSTLKKMFSVNFINFYFVSNGHTGALGAMVCSPNDMEKYFQMQ 364          
The following BLAST results are available for this feature:
BLAST of Type II pantothenate kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PANK41.767e-1326.07pantothenate kinase 4 (inactive) [Source:HGNC Symb... [more]
PANK41.767e-1326.07pantothenate kinase 4 (inactive) [Source:HGNC Symb... [more]
PANK41.807e-1326.07pantothenate kinase 4 (inactive) [Source:HGNC Symb... [more]
PANK45.328e-1128.00pantothenate kinase 4 (inactive) [Source:HGNC Symb... [more]
PANK45.328e-1128.00pantothenate kinase 4 (inactive) [Source:HGNC Symb... [more]
back to top
BLAST of Type II pantothenate kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
pnk-11.108e-1124.07PaNtothenate Kinase [Source:UniProtKB/TrEMBL;Acc:... [more]
pnk-11.108e-1124.07PaNtothenate Kinase [Source:UniProtKB/TrEMBL;Acc:... [more]
pnk-11.510e-1123.78PaNtothenate Kinase [Source:UniProtKB/TrEMBL;Acc:... [more]
pnk-11.863e-1025.00PaNtothenate Kinase [Source:UniProtKB/TrEMBL;Acc:... [more]
back to top
BLAST of Type II pantothenate kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fbl3.387e-1228.87gene:FBgn0011205 transcript:FBtr0307392[more]
fbl4.199e-1228.64gene:FBgn0011205 transcript:FBtr0078188[more]
fbl4.365e-1228.64gene:FBgn0011205 transcript:FBtr0078186[more]
fbl4.565e-1228.64gene:FBgn0011205 transcript:FBtr0078190[more]
fbl4.565e-1228.64gene:FBgn0011205 transcript:FBtr0078189[more]
back to top
BLAST of Type II pantothenate kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pank46.127e-1328.00pantothenate kinase 4 (inactive) [Source:ZFIN;Acc:... [more]
pank46.127e-1328.00pantothenate kinase 4 (inactive) [Source:ZFIN;Acc:... [more]
pank41.368e-1228.85pantothenate kinase 4 (inactive) [Source:ZFIN;Acc:... [more]
pank41.761e-928.14pantothenate kinase 4 (inactive) [Source:ZFIN;Acc:... [more]
pank23.477e-926.98pantothenate kinase 2 [Source:ZFIN;Acc:ZDB-GENE-07... [more]
back to top
BLAST of Type II pantothenate kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ca15.627e-1026.60carbonic anhydrase I [Source:Xenbase;Acc:XB-GENE-9... [more]
ca15.758e-1026.60carbonic anhydrase I [Source:Xenbase;Acc:XB-GENE-9... [more]
ca14.791e-926.67carbonic anhydrase I [Source:Xenbase;Acc:XB-GENE-9... [more]
pank36.295e-926.74pantothenate kinase 3 [Source:NCBI gene;Acc:100135... [more]
cidea7.081e-826.58cell death inducing DFFA like effector a [Source:X... [more]
back to top
BLAST of Type II pantothenate kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pank47.073e-925.00pantothenate kinase 4 [Source:MGI Symbol;Acc:MGI:2... [more]
Pank49.566e-925.09pantothenate kinase 4 [Source:MGI Symbol;Acc:MGI:2... [more]
Pank13.131e-826.75pantothenate kinase 1 [Source:MGI Symbol;Acc:MGI:1... [more]
Pank33.388e-826.06pantothenate kinase 3 [Source:MGI Symbol;Acc:MGI:2... [more]
Pank14.551e-826.75pantothenate kinase 1 [Source:MGI Symbol;Acc:MGI:1... [more]
back to top
BLAST of Type II pantothenate kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9NVE7|PANK4_HUMAN8.485e-1326.074'-phosphopantetheine phosphatase OS=Homo sapiens ... [more]
sp|Q5R5F8|PANK4_PONAB8.872e-1325.784'-phosphopantetheine phosphatase OS=Pongo abelii ... [more]
sp|Q4R4U1|PANK4_MACFA8.952e-1326.074'-phosphopantetheine phosphatase OS=Macaca fascic... [more]
sp|Q8L5Y9|PANK2_ARATH2.401e-1130.07Pantothenate kinase 2 OS=Arabidopsis thaliana OX=3... [more]
sp|Q0J035|PANK2_ORYSJ7.485e-1127.89Pantothenate kinase 2 OS=Oryza sativa subsp. japon... [more]
back to top
BLAST of Type II pantothenate kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267H6I14.485e-4932.81Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8HZ401.642e-4832.81Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8HLA04.876e-4533.66Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GL525.254e-4533.66Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8G3I75.467e-4533.66Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Type II pantothenate kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pank41.612e-1126.74pantothenate kinase 4 (inactive) [Source:NCBI gene... [more]
pank21.338e-826.98pantothenate kinase 2 [Source:NCBI gene;Acc:103044... [more]
pank1b1.446e-726.11pantothenate kinase 1 [Source:NCBI gene;Acc:103047... [more]
pank22.381e-629.63pantothenate kinase 2 [Source:NCBI gene;Acc:103044... [more]
pank1a3.422e-626.11pantothenate kinase 1a [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of Type II pantothenate kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pank22.130e-1227.37pantothenate kinase 2 [Source:ZFIN;Acc:ZDB-GENE-07... [more]
pank27.563e-1226.46pantothenate kinase 2 [Source:ZFIN;Acc:ZDB-GENE-07... [more]
back to top
BLAST of Type II pantothenate kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Type II pantothenate kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO377132.499e-925.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Type II pantothenate kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pank42.714e-1127.47pantothenate kinase 4 (inactive) [Source:NCBI gene... [more]
pank1a1.526e-926.45pantothenate kinase 1 [Source:NCBI gene;Acc:101175... [more]
pank1a1.591e-926.45pantothenate kinase 1 [Source:NCBI gene;Acc:101175... [more]
pank21.202e-825.67pantothenate kinase 3 [Source:NCBI gene;Acc:101161... [more]
pank21.872e-825.67pantothenate kinase 3 [Source:NCBI gene;Acc:101161... [more]
back to top
BLAST of Type II pantothenate kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000077416.10.000e+0100.00SMESG000077416.1[more]
SMESG000031677.14.854e-6035.03SMESG000031677.1[more]
SMESG000008042.13.805e-4929.81SMESG000008042.1[more]
SMESG000008043.12.193e-4230.13SMESG000008043.1[more]
SMESG000008043.15.061e-4229.15SMESG000008043.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010964 ID=SMED30010964|Name=Type II pantothenate kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=1183bp
TAATCATATTTTAAAATGATTATAAAACCTATTAAAACCGGATTAGTAAA
CTTTAAAAAATGTAACTTGCTTGAAAATCGTATTCTTATAGGCATTGACA
TCGGATCTTCATTGTCAAAATTTATATTTGTTAATAAGCAAAATAGATGC
CAACTTTATGATGAAAGTACACATCATATCAACTTTCAATACTCGATTTT
TAAAAATGAAGATATCGAAAAAGCTTTAGAGTGGTTAAAAGAAAATGCCT
ATATTCAAGAAGGAACCAGGTATGAAATCCATTGCACTGGAACTGGATGT
TTAAGAAACAAAAAACAGATTGAATCAACTTTTGAATTGGGTTTGATTTT
TGTCCAAGAAGGATTAGCTTTAATAGCTGGTCATAAAATAGCTTTAGAAC
ATTGTCCACTCGAGAATCTGATACATCCACCAACAAGTGCTGATGAACTC
TATGAAATTGATAATAACATTCTTAAAACAATGTTGACTAGAATGCAGAA
AAGAATAAATACGGACACTAATTCGAATAAAACTTCTCTTTATCCTTTTG
TTCTTGGATATTGGGGATCCGGTTCTTCAATTTTTTTCTTTGATGACGAT
GGAAAAGCTCAACAAATAGGTTCTTTTCAAAATGGAGGAAAATCATTTCT
TGGAATGGCAAAGTGCCTAATAGATTCTAATGATTACGATGAAATAATAG
CTAGCGCGTCTAAAGGCAATAGAAAAAACATAGATACTCTAATTAAAGAT
ATCCTTATTTCTGATGAAAAATCCCCATATGGAAAATTTCCACCTGAATT
ACCGGTTTTCCAATTTGGAAAATGTGCAGAAAACAACCAAGACTTGAAAT
ATTATTCTAAAGACGATTTAGCTATGTCTTTAATTTGCTTGGAAAGTTCA
CAGATTTCGTCGAATTGTCGGAACGCTGCTTTGACAACAAAAACCAAAAA
AATATATTTGTCTGGAAACACATTCAAATCAAGTCTTTTTCATAAAGAAA
TTCTCAACCGTAACCTAAGGCATCCTATTGGAGTTGAATATACATTTTTA
GATTTAGGATACGCAACTGCACTTGGTGCTATGTTTTGTGTTAATCAGGA
AAGGGCAATGTATGTGAAATAACAATGAATTTAACAGTTGAAAATGATTA
AACTTGATTCTAAATTAAACTAAATTTTGAATT
back to top

protein sequence of SMED30010964-orf-1

>SMED30010964-orf-1 ID=SMED30010964-orf-1|Name=SMED30010964-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=369bp
MIIKPIKTGLVNFKKCNLLENRILIGIDIGSSLSKFIFVNKQNRCQLYDE
STHHINFQYSIFKNEDIEKALEWLKENAYIQEGTRYEIHCTGTGCLRNKK
QIESTFELGLIFVQEGLALIAGHKIALEHCPLENLIHPPTSADELYEIDN
NILKTMLTRMQKRINTDTNSNKTSLYPFVLGYWGSGSSIFFFDDDGKAQQ
IGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISD
EKSPYGKFPPELPVFQFGKCAENNQDLKYYSKDDLAMSLICLESSQISSN
CRNAALTTKTKKIYLSGNTFKSSLFHKEILNRNLRHPIGVEYTFLDLGYA
TALGAMFCVNQERAMYVK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR043129ATPase_NBD
IPR004567Type_II_PanK
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004594pantothenate kinase activity
GO:0000166nucleotide binding
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0015937coenzyme A biosynthetic process
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 144..349
e-value: 7.9E-33
score: 116.0
NoneNo IPR availableGENE3DG3DSA:1.10.8.780coord: 236..281
e-value: 7.9E-33
score: 116.0
NoneNo IPR availableGENE3DG3DSA:3.30.420.510coord: 25..356
e-value: 7.9E-33
score: 116.0
NoneNo IPR availablePANTHERPTHR12280:SF20PANTOTHENATE KINASE 4coord: 25..333
NoneNo IPR availablePANTHERPTHR12280PANTOTHENATE KINASEcoord: 25..333
IPR004567Type II pantothenate kinasePFAMPF03630Fumblecoord: 25..330
e-value: 5.8E-34
score: 117.7
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 24..357